F345541

General Info

Members Datasets Scaffolds Average Seq Length
232 135 464 187

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_120810_c1|nmdc:mga00v17_120810_c1_846_1502
Length 218
Sequence VRFEKPVRRTSPPTLAKPTPFSDGEGRAIIEGVFDLDEFVSECQQANAESEPRRAIREVLDRALVDASSIGDALKPGEGGITLLHHADDLTVLHAVWAPGMRLYPHNHEMWAAIGIYAGQEDNAFYRRRAPGDRFLTESGGKQLRTGDTVLLGDDTIHAVTNPLRSLTAAIHIYGGDFVNQPRSQWGPGPEEERPYDYDLVRQQFADANAAWRAEADA

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
77 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 6.9
Rhizosphere 87.93
Stem 0
Stem Tuber 0
Unclassified 9.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_120810_c1 3300050491 Bacteria 1668
2 Ga0070683_100196552 3300005329 Bacteria 1915
3 Ga0070680_100000279 3300005336 Bacteria 33924
4 Ga0068868_100260448 3300005338 Bacteria 1462
5 Ga0068868_101286084 3300005338 Unclassified 679
6 Ga0068868_101375448 3300005338 Bacteria 658
7 Ga0070667_100629358 3300005367 Bacteria 990
8 Ga0070700_100255607 3300005441 Bacteria 1259
9 Ga0070708_100003714 3300005445 Bacteria 11969
10 Ga0070708_100035685 3300005445 Bacteria 4333
11 Ga0070708_100288551 3300005445 Bacteria 1545
12 Ga0070708_100964380 3300005445 Unclassified 800
13 Ga0070681_10000009 3300005458 Bacteria 146582
14 Ga0070681_10023743 3300005458 Bacteria 6171
15 Ga0070681_10399992 3300005458 Bacteria 1285
16 Ga0070706_100005832 3300005467 Bacteria 11681
17 Ga0070707_100014536 3300005468 Bacteria 7380
18 Ga0070707_100101437 3300005468 Bacteria 2789
19 Ga0070698_100165878 3300005471 Bacteria 2152
20 Ga0070679_100000107 3300005530 Bacteria 65501
21 Ga0070697_100598308 3300005536 Unclassified 969
22 Ga0068853_100467816 3300005539 Bacteria 1187
23 Ga0070695_100043266 3300005545 Bacteria 2863
24 Ga0068856_100044234 3300005614 Bacteria 4382
25 Ga0068856_100779131 3300005614 Bacteria 976
26 Ga0068864_101071447 3300005618 Bacteria 801
27 Ga0068863_101100495 3300005841 Bacteria 799
28 Ga0068863_101299695 3300005841 Bacteria 734
29 Ga0068858_100953007 3300005842 Bacteria 840
30 Ga0068860_100690031 3300005843 Unclassified 1030
31 Ga0070717_10981712 3300006028 Unclassified 769
32 Ga0075365_10050227 3300006038 Bacteria 2751
33 Ga0075365_10104882 3300006038 Bacteria 1939
34 Ga0075364_10026348 3300006051 Bacteria 3708
35 Ga0070712_100130960 3300006175 Bacteria 1901
36 Ga0075367_10046358 3300006178 Bacteria 2554
37 Ga0075428_100000002 3300006844 Bacteria 546374
38 Ga0075428_100025327 3300006844 Bacteria 6566
39 Ga0075428_100217811 3300006844 Bacteria 2062
40 Ga0075428_100404800 3300006844 Bacteria 1462
41 Ga0075430_100083898 3300006846 Bacteria 2669
42 Ga0075431_100092933 3300006847 Bacteria 3114
43 Ga0075431_100168177 3300006847 Bacteria 2253
44 Ga0075431_100211212 3300006847 Bacteria 1982
45 Ga0075434_100220367 3300006871 Bacteria 1917
46 Ga0075434_100238186 3300006871 Bacteria 1840
47 Ga0075434_101636890 3300006871 Unclassified 652
48 Ga0075429_100282803 3300006880 Bacteria 1453
49 Ga0075435_100654227 3300007076 Bacteria 912
50 Ga0111539_10017154 3300009094 Bacteria 8963
51 Ga0111539_10529872 3300009094 Bacteria 1372
52 Ga0111539_10867051 3300009094 Bacteria 1050
53 Ga0105245_10005312 3300009098 Bacteria 11318
54 Ga0114129_10248010 3300009147 Bacteria 2391
55 Ga0114129_10856751 3300009147 Unclassified 1155
56 Ga0105243_10024785 3300009148 Bacteria 4579
57 Ga0105241_10108988 3300009174 Bacteria 2214
58 Ga0105242_10010935 3300009176 Bacteria 6971
59 Ga0105249_10665209 3300009553 Bacteria 1100
60 Ga0105239_10279994 3300010375 Bacteria 1877
61 Ga0105239_10796293 3300010375 Bacteria 1083
62 Ga0157370_10080927 3300013104 Bacteria 3058
63 Ga0157369_10071866 3300013105 Bacteria 3713
64 Ga0157379_10242120 3300014968 Bacteria 1636
65 Ga0163161_10526787 3300017792 Bacteria 966
66 Ga0213874_10016733 3300021377 Bacteria 1958
67 Ga0213876_10078444 3300021384 Bacteria 1745
68 Ga0207645_10139894 3300025907 Bacteria 1577
69 Ga0207684_10008038 3300025910 Bacteria 9419
70 Ga0207654_10343515 3300025911 Unclassified 1026
71 Ga0207707_10000396 3300025912 Bacteria 45547
72 Ga0207707_10012345 3300025912 Bacteria 7424
73 Ga0207707_10344415 3300025912 Bacteria 1285
74 Ga0207660_10000105 3300025917 Bacteria 47224
75 Ga0207652_10000118 3300025921 Bacteria 87541
76 Ga0207646_10016218 3300025922 Bacteria 6998
77 Ga0207646_10099584 3300025922 Bacteria 2605
78 Ga0207687_10052923 3300025927 Bacteria 2834
79 Ga0207687_10167502 3300025927 Bacteria 1692
80 Ga0207644_10282175 3300025931 Bacteria 1334
81 Ga0207644_10505022 3300025931 Bacteria 998
82 Ga0207686_10041821 3300025934 Bacteria 2797
83 Ga0207686_10350374 3300025934 Bacteria 1111
84 Ga0207709_10660638 3300025935 Bacteria 833
85 Ga0207704_10367316 3300025938 Bacteria 1125
86 Ga0207689_10373472 3300025942 Bacteria 1187
87 Ga0207661_10238922 3300025944 Bacteria 1611
88 Ga0207712_10574543 3300025961 Bacteria 972
89 Ga0207639_10372731 3300026041 Bacteria 1280
90 Ga0207708_10054729 3300026075 Bacteria 3042
91 Ga0207702_10647800 3300026078 Bacteria 1039
92 Ga0207641_10999543 3300026088 Bacteria 833
93 Ga0207428_10084908 3300027907 Bacteria 2466
94 Ga0207428_10211479 3300027907 Bacteria 1457
95 Ga0268264_10463397 3300028381 Bacteria 1230
96 Ga0316576_10316589 3300031727 Bacteria 1164
97 Ga0307410_10567844 3300031852 Bacteria 942
98 Ga0307416_100553391 3300032002 Bacteria 1224
99 Ga0373937_0586129 3300036401 Bacteria 1059
100 Ga0373925_0031576 3300037068 Bacteria 3893
101 Ga0436365_0431313 3300039437 Bacteria 1099
102 Ga0436365_1579874 3300039437 Bacteria 6196
103 Ga0436360_0330241 3300039438 Bacteria 641
104 Ga0436363_1203956 3300039450 Bacteria 2397
105 Ga0436362_0729919 3300039453 Bacteria 1794
106 Ga0436362_0865812 3300039453 Bacteria 2664
107 Ga0451791_0192888 3300041451 Bacteria 1117
108 Ga0439452_026924 3300042010 Bacteria 1448
109 Ga0466961_0036656 3300044693 Bacteria 3148
110 Ga0466961_0130671 3300044693 Bacteria 1574
111 Ga0466964_0100661 3300044706 Unclassified 1273
112 Ga0466971_0029414 3300044719 Bacteria 2457
113 Ga0466968_0158937 3300044735 Bacteria 1042
114 Ga0466957_0002722 3300044842 Bacteria 9558
115 Ga0466958_0012305 3300045836 Bacteria 4844
116 Ga0495624_0061641 3300046690 Bacteria 2349
117 Ga0495581_0147135 3300047315 Bacteria 1375
118 Ga0496100_0048819 3300048903 Bacteria 2734
119 Ga0496101_0053903 3300048904 Bacteria 2903
120 Ga0496102_0729500 3300048905 Bacteria 914
121 Ga0496104_0011723 3300048907 Bacteria 7863
122 Ga0496106_0186979 3300048909 Bacteria 1646
123 Ga0496108_0672610 3300048911 Bacteria 899
124 Ga0496109_0151390 3300048912 Bacteria 2172
125 Ga0496109_0442526 3300048912 Bacteria 1228
126 Ga0496109_0653813 3300048912 Bacteria 988
127 Ga0496110_0138048 3300048913 Bacteria 2204
128 Ga0496110_0655420 3300048913 Bacteria 950
129 Ga0496111_0069349 3300048914 Bacteria 2564
130 Ga0496114_0039772 3300048917 Bacteria 3892
131 Ga0496114_0458931 3300048917 Bacteria 1128
132 Ga0496115_0333754 3300048918 Bacteria 1238
133 Ga0501031_0029061 3300049568 Bacteria 3605
134 Ga0501031_0045626 3300049568 Bacteria 2860
135 Ga0501031_0090492 3300049568 Bacteria 1996
136 Ga0501031_0119169 3300049568 Unclassified 1724
137 Ga0501033_0052492 3300049570 Bacteria 3021
138 Ga0501033_0068083 3300049570 Bacteria 2618
139 Ga0501033_1004820 3300049570 Unclassified 557
140 Ga0501036_0008564 3300049572 Bacteria 8389
141 Ga0501036_0074869 3300049572 Bacteria 2864
142 Ga0501036_0193114 3300049572 Unclassified 1713
143 Ga0501037_0251177 3300049573 Bacteria 1238
144 Ga0501038_0116577 3300049574 Bacteria 2207
145 Ga0501039_0005221 3300049575 Bacteria 9835
146 Ga0501039_0009764 3300049575 Bacteria 7311
147 Ga0501039_0022701 3300049575 Bacteria 4815
148 Ga0501039_0175488 3300049575 Bacteria 1685
149 Ga0501040_0015352 3300049576 Bacteria 5064
150 Ga0501040_0021776 3300049576 Bacteria 4285
151 Ga0501040_0666324 3300049576 Bacteria 752
152 Ga0501041_0015065 3300049577 Bacteria 4592
153 Ga0501041_0201235 3300049577 Bacteria 1248
154 Ga0501042_0031148 3300049578 Bacteria 3774
155 Ga0501042_0062525 3300049578 Unclassified 2660
156 Ga0501042_0069895 3300049578 Bacteria 2511
157 Ga0501042_0231110 3300049578 Bacteria 1334
158 Ga0501043_0120221 3300049579 Bacteria 2060
159 Ga0501043_0475346 3300049579 Bacteria 936
160 Ga0501046_0110886 3300049580 Bacteria 2096
161 Ga0501046_0235969 3300049580 Unclassified 1350
162 Ga0501048_0012084 3300049582 Bacteria 6434
163 Ga0501068_0071110 3300049584 Bacteria 2124
164 Ga0501068_0202463 3300049584 Bacteria 1259
165 Ga0501071_0007079 3300049587 Bacteria 7328
166 Ga0501071_0008766 3300049587 Bacteria 6699
167 Ga0501071_0038246 3300049587 Bacteria 3428
168 Ga0501071_0045385 3300049587 Bacteria 3155
169 Ga0501071_0427340 3300049587 Bacteria 1013
170 Ga0501071_0620523 3300049587 Unclassified 831
171 Ga0501072_0003175 3300049588 Bacteria 12358
172 Ga0501072_0011389 3300049588 Bacteria 6797
173 Ga0501072_0019717 3300049588 Bacteria 5216
174 Ga0501072_0226621 3300049588 Bacteria 1489
175 Ga0501074_0082004 3300049590 Bacteria 2313
176 Ga0501074_0200460 3300049590 Bacteria 1422
177 Ga0501075_0005970 3300049591 Bacteria 8338
178 Ga0501075_0014561 3300049591 Bacteria 5638
179 Ga0501075_0071170 3300049591 Bacteria 2628
180 Ga0501075_0093252 3300049591 Bacteria 2286
181 Ga0501076_0060260 3300049592 Bacteria 3019
182 Ga0501076_0085792 3300049592 Bacteria 2530
183 Ga0501076_0297207 3300049592 Unclassified 1323
184 Ga0501076_0425051 3300049592 Bacteria 1093
185 Ga0501076_0615785 3300049592 Bacteria 896
186 Ga0501077_0000888 3300049593 Bacteria 17971
187 Ga0501077_0036713 3300049593 Bacteria 3122
188 Ga0501079_0059945 3300049741 Bacteria 2935
189 Ga0501079_0099422 3300049741 Bacteria 2254
190 Ga0501079_0306169 3300049741 Unclassified 1243
191 Ga0501081_0036210 3300049743 Bacteria 3364
192 Ga0501083_0099976 3300049744 Unclassified 1913
193 Ga0501035_0093954 3300049822 Bacteria 2638
194 Ga0501035_0268282 3300049822 Unclassified 1445
195 Ga0501035_0341693 3300049822 Bacteria 1254
196 Ga0501044_0468883 3300049823 Bacteria 1164
197 Ga0501044_1028502 3300049823 Bacteria 695
198 Ga0501045_0001378 3300049824 Bacteria 16195
199 Ga0501045_0037014 3300049824 Bacteria 3546
200 Ga0501045_0056703 3300049824 Bacteria 2866
201 Ga0501045_0076087 3300049824 Bacteria 2473
202 Ga0501045_0680863 3300049824 Bacteria 759
203 nmdc:mga0yw44_52919_c1 3300050492 Bacteria 2463
204 nmdc:mga0yw44_771093_c1 3300050492 Bacteria 653
205 nmdc:mga05p37_31336_c1 3300050507 Bacteria 6495
206 nmdc:mga05p37_35389_c1 3300050507 Bacteria 6122
207 nmdc:mga09592_585864_c1 3300050508 Bacteria 956
208 nmdc:mga0qj67_246711_c1 3300050509 Bacteria 1449
209 nmdc:mga06r32_14563_c1 3300050510 Bacteria 7140
210 nmdc:mga06r32_296414_c1 3300050510 Bacteria 1603
211 nmdc:mga06r32_328041_c1 3300050510 Bacteria 1516
212 nmdc:mga08y16_176326_c1 3300050511 Bacteria 2220
213 nmdc:mga08y16_37553_c1 3300050511 Bacteria 5086
214 nmdc:mga08y16_80049_c1 3300050511 Bacteria 3406
215 nmdc:mga0n895_200404_c1 3300050512 Bacteria 2027
216 nmdc:mga08x19_77992_c1 3300050514 Unclassified 2170
217 nmdc:mga0a205_728191_c1 3300050515 Unclassified 841
218 Ga0495595_0019363 3300053084 Bacteria 2953
219 Ga0501084_0094544 3300054114 Bacteria 2509
220 Ga0501082_0072331 3300060353 Bacteria 2970
221 Ga0501082_0112758 3300060353 Bacteria 2354
222 Ga0501082_0314216 3300060353 Bacteria 1364
223 Ga0501082_0635081 3300060353 Unclassified 934
224 Ga0501082_0713571 3300060353 Bacteria 878
225 Ga0501082_0879363 3300060353 Bacteria 784
226 Ga0501082_0904724 3300060353 Bacteria 772
227 Ga0466962_0010516 3300061719 Bacteria 4451
228 Ga0530510_0039874 3300061734 Bacteria 3389
229 Ga0530510_0058612 3300061734 Bacteria 2784
230 Ga0530510_0214650 3300061734 Bacteria 1429
231 Ga0530510_0341655 3300061734 Unclassified 1124
232 Ga0530510_0798746 3300061734 Bacteria 720
233 nmdc:mga00v17_120810_c1
234 Ga0070683_100196552
235 Ga0070680_100000279
236 Ga0068868_100260448
237 Ga0068868_101286084
238 Ga0068868_101375448
239 Ga0070667_100629358
240 Ga0070700_100255607
241 Ga0070708_100003714
242 Ga0070708_100035685
243 Ga0070708_100288551
244 Ga0070708_100964380
245 Ga0070681_10000009
246 Ga0070681_10023743
247 Ga0070681_10399992
248 Ga0070706_100005832
249 Ga0070707_100014536
250 Ga0070707_100101437
251 Ga0070698_100165878
252 Ga0070679_100000107
253 Ga0070697_100598308
254 Ga0068853_100467816
255 Ga0070695_100043266
256 Ga0068856_100044234
257 Ga0068856_100779131
258 Ga0068864_101071447
259 Ga0068863_101100495
260 Ga0068863_101299695
261 Ga0068858_100953007
262 Ga0068860_100690031
263 Ga0070717_10981712
264 Ga0075365_10050227
265 Ga0075365_10104882
266 Ga0075364_10026348
267 Ga0070712_100130960
268 Ga0075367_10046358
269 Ga0075428_100000002
270 Ga0075428_100025327
271 Ga0075428_100217811
272 Ga0075428_100404800
273 Ga0075430_100083898
274 Ga0075431_100092933
275 Ga0075431_100168177
276 Ga0075431_100211212
277 Ga0075434_100220367
278 Ga0075434_100238186
279 Ga0075434_101636890
280 Ga0075429_100282803
281 Ga0075435_100654227
282 Ga0111539_10017154
283 Ga0111539_10529872
284 Ga0111539_10867051
285 Ga0105245_10005312
286 Ga0114129_10248010
287 Ga0114129_10856751
288 Ga0105243_10024785
289 Ga0105241_10108988
290 Ga0105242_10010935
291 Ga0105249_10665209
292 Ga0105239_10279994
293 Ga0105239_10796293
294 Ga0157370_10080927
295 Ga0157369_10071866
296 Ga0157379_10242120
297 Ga0163161_10526787
298 Ga0213874_10016733
299 Ga0213876_10078444
300 Ga0207645_10139894
301 Ga0207684_10008038
302 Ga0207654_10343515
303 Ga0207707_10000396
304 Ga0207707_10012345
305 Ga0207707_10344415
306 Ga0207660_10000105
307 Ga0207652_10000118
308 Ga0207646_10016218
309 Ga0207646_10099584
310 Ga0207687_10052923
311 Ga0207687_10167502
312 Ga0207644_10282175
313 Ga0207644_10505022
314 Ga0207686_10041821
315 Ga0207686_10350374
316 Ga0207709_10660638
317 Ga0207704_10367316
318 Ga0207689_10373472
319 Ga0207661_10238922
320 Ga0207712_10574543
321 Ga0207639_10372731
322 Ga0207708_10054729
323 Ga0207702_10647800
324 Ga0207641_10999543
325 Ga0207428_10084908
326 Ga0207428_10211479
327 Ga0268264_10463397
328 Ga0316576_10316589
329 Ga0307410_10567844
330 Ga0307416_100553391
331 Ga0373937_0586129
332 Ga0373925_0031576
333 Ga0436365_0431313
334 Ga0436365_1579874
335 Ga0436360_0330241
336 Ga0436363_1203956
337 Ga0436362_0729919
338 Ga0436362_0865812
339 Ga0451791_0192888
340 Ga0439452_026924
341 Ga0466961_0036656
342 Ga0466961_0130671
343 Ga0466964_0100661
344 Ga0466971_0029414
345 Ga0466968_0158937
346 Ga0466957_0002722
347 Ga0466958_0012305
348 Ga0495624_0061641
349 Ga0495581_0147135
350 Ga0496100_0048819
351 Ga0496101_0053903
352 Ga0496102_0729500
353 Ga0496104_0011723
354 Ga0496106_0186979
355 Ga0496108_0672610
356 Ga0496109_0151390
357 Ga0496109_0442526
358 Ga0496109_0653813
359 Ga0496110_0138048
360 Ga0496110_0655420
361 Ga0496111_0069349
362 Ga0496114_0039772
363 Ga0496114_0458931
364 Ga0496115_0333754
365 Ga0501031_0029061
366 Ga0501031_0045626
367 Ga0501031_0090492
368 Ga0501031_0119169
369 Ga0501033_0052492
370 Ga0501033_0068083
371 Ga0501033_1004820
372 Ga0501036_0008564
373 Ga0501036_0074869
374 Ga0501036_0193114
375 Ga0501037_0251177
376 Ga0501038_0116577
377 Ga0501039_0005221
378 Ga0501039_0009764
379 Ga0501039_0022701
380 Ga0501039_0175488
381 Ga0501040_0015352
382 Ga0501040_0021776
383 Ga0501040_0666324
384 Ga0501041_0015065
385 Ga0501041_0201235
386 Ga0501042_0031148
387 Ga0501042_0062525
388 Ga0501042_0069895
389 Ga0501042_0231110
390 Ga0501043_0120221
391 Ga0501043_0475346
392 Ga0501046_0110886
393 Ga0501046_0235969
394 Ga0501048_0012084
395 Ga0501068_0071110
396 Ga0501068_0202463
397 Ga0501071_0007079
398 Ga0501071_0008766
399 Ga0501071_0038246
400 Ga0501071_0045385
401 Ga0501071_0427340
402 Ga0501071_0620523
403 Ga0501072_0003175
404 Ga0501072_0011389
405 Ga0501072_0019717
406 Ga0501072_0226621
407 Ga0501074_0082004
408 Ga0501074_0200460
409 Ga0501075_0005970
410 Ga0501075_0014561
411 Ga0501075_0071170
412 Ga0501075_0093252
413 Ga0501076_0060260
414 Ga0501076_0085792
415 Ga0501076_0297207
416 Ga0501076_0425051
417 Ga0501076_0615785
418 Ga0501077_0000888
419 Ga0501077_0036713
420 Ga0501079_0059945
421 Ga0501079_0099422
422 Ga0501079_0306169
423 Ga0501081_0036210
424 Ga0501083_0099976
425 Ga0501035_0093954
426 Ga0501035_0268282
427 Ga0501035_0341693
428 Ga0501044_0468883
429 Ga0501044_1028502
430 Ga0501045_0001378
431 Ga0501045_0037014
432 Ga0501045_0056703
433 Ga0501045_0076087
434 Ga0501045_0680863
435 nmdc:mga0yw44_52919_c1
436 nmdc:mga0yw44_771093_c1
437 nmdc:mga05p37_31336_c1
438 nmdc:mga05p37_35389_c1
439 nmdc:mga09592_585864_c1
440 nmdc:mga0qj67_246711_c1
441 nmdc:mga06r32_14563_c1
442 nmdc:mga06r32_296414_c1
443 nmdc:mga06r32_328041_c1
444 nmdc:mga08y16_176326_c1
445 nmdc:mga08y16_37553_c1
446 nmdc:mga08y16_80049_c1
447 nmdc:mga0n895_200404_c1
448 nmdc:mga08x19_77992_c1
449 nmdc:mga0a205_728191_c1
450 Ga0495595_0019363
451 Ga0501084_0094544
452 Ga0501082_0072331
453 Ga0501082_0112758
454 Ga0501082_0314216
455 Ga0501082_0635081
456 Ga0501082_0713571
457 Ga0501082_0879363
458 Ga0501082_0904724
459 Ga0466962_0010516
460 Ga0530510_0039874
461 Ga0530510_0058612
462 Ga0530510_0214650
463 Ga0530510_0341655
464 Ga0530510_0798746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.9134 57 140
4qma-assembly1.cif.gz_A crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076 0.8924 4 161
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.891 49 142
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.8878 49 142
6v7l-assembly1.cif.gz_C the structure of the p212121 crystal form of canavalin at 173 k 0.8874 57 141
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9474 48 139 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9384 48 140 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9098 48 140 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8977 48 140 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8962 47 146 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3N5KMR7-F1-model_v4 Cysteine dioxygenase 0.9851 1 179
AF-A0A451BLV3-F1-model_v4 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily 0.9814 1 175
AF-A0A6L7TRV1-F1-model_v4 Cysteine dioxygenase 0.9794 1 182
AF-A0A1G7C9S7-F1-model_v4 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily 0.9752 3 180
AF-A0A450RWB1-F1-model_v4 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily 0.975 1 177

Map