F345300

General Info

Members Datasets Scaffolds Average Seq Length
232 149 232 337

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0543889|Ga0436365_0543889_346_1479
Length 377
Sequence MLSKLSSPKSGDVPVMPFSKKFSRTLSACTLVCLAALLIGCSRQGGGDGAGGSVRLQGAGATFPNPLYQKWLSEYTKLNPNVKIDYQSIGSGGGIKQIKEETVDFGASDAPMSDDDLKSARGGEILHIPTVLGAVVLTYNLQGVSQPLRFSPDVIADIFLGKIKKWDDARIKADNAGAALPAADITVVHRSDGSGTSAVFTEYLSKVSAEWKEKVGKGSSPNWPVGLGGKGNEGVTGTVKQTPNAIGYVELAYAVKNNLPVALIKNKSGNFVEPSLDAVTAAASEALAATPDDLRVSITDGTGASAYPISSYTYILAYKEQKDAAKGKALVDFLWWGIHDGEQYARDLTYAPLPAEIIKRAEAKIRMIASGGKALRQ

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
141 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.86
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000001 3300002074 Bacteria 444271
2 JGI24034J26672_10000001 3300002239 Bacteria 1118280
3 JGI24751J29686_10000006 3300002459 Bacteria 134556
4 JGI25406J46586_10003759 3300003203 Bacteria 7099
5 Ga0065704_10016105 3300005289 Bacteria 1592
6 Ga0070670_100001299 3300005331 Bacteria 19892
7 Ga0070670_100363454 3300005331 Bacteria 1273
8 Ga0068869_100091550 3300005334 Bacteria 2288
9 Ga0070666_10034059 3300005335 Unclassified 3375
10 Ga0070680_100034160 3300005336 Unclassified 4101
11 Ga0068868_100057457 3300005338 Unclassified 3074
12 Ga0068868_100062687 3300005338 Bacteria 2948
13 Ga0070660_100040792 3300005339 Bacteria 3535
14 Ga0070661_100016994 3300005344 Bacteria 5154
15 Ga0070668_100002227 3300005347 Bacteria 14250
16 Ga0070673_100012172 3300005364 Bacteria 5897
17 Ga0070673_100254085 3300005364 Bacteria 1533
18 Ga0070659_100002910 3300005366 Bacteria 12198
19 Ga0070709_10148671 3300005434 Bacteria 1617
20 Ga0070709_10149879 3300005434 Unclassified 1611
21 Ga0070714_100039938 3300005435 Unclassified 3954
22 Ga0070713_100006011 3300005436 Bacteria 8358
23 Ga0070713_100035502 3300005436 Bacteria 4014
24 Ga0070713_100081478 3300005436 Unclassified 2762
25 Ga0070713_100084405 3300005436 Bacteria 2717
26 Ga0070710_10116379 3300005437 Bacteria 1612
27 Ga0070711_100024748 3300005439 Unclassified 3921
28 Ga0070711_100026974 3300005439 Bacteria 3767
29 Ga0070700_100128137 3300005441 Bacteria 1709
30 Ga0070694_100196682 3300005444 Bacteria 1500
31 Ga0070681_10016366 3300005458 Bacteria 7402
32 Ga0068867_100162985 3300005459 Bacteria 1759
33 Ga0070706_100000410 3300005467 Bacteria 51662
34 Ga0070706_100008810 3300005467 Bacteria 9401
35 Ga0070706_100016174 3300005467 Bacteria 6890
36 Ga0070706_100116075 3300005467 Bacteria 2493
37 Ga0070706_100192577 3300005467 Bacteria 1905
38 Ga0070707_100027976 3300005468 Bacteria 5363
39 Ga0070698_100030895 3300005471 Bacteria 5554
40 Ga0070698_100034824 3300005471 Bacteria 5209
41 Ga0070698_100050623 3300005471 Bacteria 4234
42 Ga0070698_100112982 3300005471 Bacteria 2681
43 Ga0070698_100434581 3300005471 Bacteria 1247
44 Ga0070699_100001635 3300005518 Bacteria 20447
45 Ga0070699_100011249 3300005518 Bacteria 7730
46 Ga0070699_100016326 3300005518 Bacteria 6376
47 Ga0070679_100009434 3300005530 Bacteria 9230
48 Ga0070697_100000054 3300005536 Bacteria 88022
49 Ga0070697_100000336 3300005536 Bacteria 37001
50 Ga0070697_100000466 3300005536 Bacteria 30951
51 Ga0070697_100045605 3300005536 Unclassified 3552
52 Ga0070697_100083938 3300005536 Bacteria 2627
53 Ga0070696_100255398 3300005546 Bacteria 1327
54 Ga0070704_100040301 3300005549 Bacteria 3214
55 Ga0070664_100004142 3300005564 Bacteria 11650
56 Ga0068857_100002169 3300005577 Bacteria 15952
57 Ga0068854_100105859 3300005578 Unclassified 2115
58 Ga0068854_100119855 3300005578 Bacteria 1996
59 Ga0068856_100201378 3300005614 Bacteria 2005
60 Ga0070702_100022948 3300005615 Bacteria 3309
61 Ga0068852_100145054 3300005616 Bacteria 2201
62 Ga0068859_100073174 3300005617 Bacteria 3465
63 Ga0068859_100223565 3300005617 Bacteria 1970
64 Ga0068864_100010153 3300005618 Bacteria 7774
65 Ga0068864_100020804 3300005618 Bacteria 5490
66 Ga0068851_10000522 3300005834 Bacteria 16803
67 Ga0068858_100000051 3300005842 Bacteria 120692
68 Ga0068858_100010751 3300005842 Bacteria 8654
69 Ga0068860_100075308 3300005843 Bacteria 3210
70 Ga0068860_100393755 3300005843 Unclassified 1369
71 Ga0081539_10001299 3300005985 Bacteria 43815
72 Ga0081539_10001310 3300005985 Bacteria 43539
73 Ga0070717_10000415 3300006028 Bacteria 27295
74 Ga0070715_10000006 3300006163 Bacteria 216296
75 Ga0070715_10003398 3300006163 Bacteria 5054
76 Ga0070715_10005306 3300006163 Bacteria 4289
77 Ga0070716_100000013 3300006173 Bacteria 100600
78 Ga0070716_100242998 3300006173 Bacteria 1222
79 Ga0070712_100008636 3300006175 Bacteria 6414
80 Ga0097621_100001104 3300006237 Bacteria 18848
81 Ga0097621_100011912 3300006237 Bacteria 6432
82 Ga0068871_100001486 3300006358 Bacteria 15714
83 Ga0068871_100008721 3300006358 Bacteria 7294
84 Ga0075428_100468001 3300006844 Unclassified 1349
85 Ga0075433_10058460 3300006852 Unclassified 3372
86 Ga0075433_10084257 3300006852 Bacteria 2806
87 Ga0075434_100068804 3300006871 Bacteria 3528
88 Ga0075429_100069492 3300006880 Bacteria 3067
89 Ga0097620_100073177 3300006931 Bacteria 3465
90 Ga0097620_100223561 3300006931 Bacteria 1970
91 Ga0075435_100003512 3300007076 Bacteria 10644
92 Ga0075435_100129510 3300007076 Bacteria 2111
93 Ga0099794_10008154 3300007265 Bacteria 4340
94 Ga0105240_10091039 3300009093 Bacteria 3727
95 Ga0111539_10206686 3300009094 Bacteria 2288
96 Ga0105245_10002664 3300009098 Bacteria 16075
97 Ga0105247_10000004 3300009101 Bacteria 455497
98 Ga0114129_10018348 3300009147 Bacteria 9965
99 Ga0114129_10040166 3300009147 Bacteria 6596
100 Ga0114129_10040634 3300009147 Bacteria 6555
101 Ga0105243_10000446 3300009148 Bacteria 43049
102 Ga0105243_10060445 3300009148 Bacteria 3027
103 Ga0105243_10104732 3300009148 Bacteria 2355
104 Ga0105242_10000928 3300009176 Bacteria 22787
105 Ga0105242_10008678 3300009176 Bacteria 7801
106 Ga0105242_10083372 3300009176 Bacteria 2677
107 Ga0105242_10098338 3300009176 Bacteria 2475
108 Ga0105248_10038007 3300009177 Bacteria 5385
109 Ga0105237_10001434 3300009545 Bacteria 31525
110 Ga0105249_10000369 3300009553 Bacteria 44503
111 Ga0105239_10018354 3300010375 Bacteria 7733
112 Ga0157373_10008902 3300013100 Bacteria 7428
113 Ga0157373_10013253 3300013100 Bacteria 6052
114 Ga0157374_10009225 3300013296 Bacteria 8458
115 Ga0157374_10281273 3300013296 Bacteria 1643
116 Ga0157378_10000004 3300013297 Bacteria 201051
117 Ga0157378_10000144 3300013297 Bacteria 67006
118 Ga0163162_10000019 3300013306 Bacteria 220603
119 Ga0163162_10089127 3300013306 Unclassified 3165
120 Ga0157372_10036346 3300013307 Bacteria 5429
121 Ga0157372_10040596 3300013307 Bacteria 5140
122 Ga0157372_10118792 3300013307 Unclassified 3034
123 Ga0157372_10303292 3300013307 Bacteria 1858
124 Ga0157375_10003976 3300013308 Bacteria 12822
125 Ga0157375_10052563 3300013308 Bacteria 4005
126 Ga0157375_10333797 3300013308 Bacteria 1681
127 Ga0157375_10340607 3300013308 Bacteria 1665
128 Ga0163163_10001375 3300014325 Bacteria 20531
129 Ga0163163_10003120 3300014325 Bacteria 14042
130 Ga0157380_10037083 3300014326 Bacteria 3776
131 Ga0157380_10141361 3300014326 Unclassified 2069
132 Ga0157379_10150951 3300014968 Bacteria 2096
133 Ga0157376_10159990 3300014969 Unclassified 2040
134 Ga0213876_10000246 3300021384 Bacteria 51765
135 Ga0213876_10080200 3300021384 Bacteria 1725
136 Ga0224572_1000402 3300024225 Unclassified 4904
137 Ga0228598_1003132 3300024227 Bacteria 3579
138 Ga0207692_10012476 3300025898 Bacteria 3651
139 Ga0207710_10000002 3300025900 Bacteria 1251998
140 Ga0207685_10000010 3300025905 Bacteria 216792
141 Ga0207685_10009744 3300025905 Bacteria 2803
142 Ga0207699_10023029 3300025906 Bacteria 3384
143 Ga0207699_10086839 3300025906 Bacteria 1954
144 Ga0207684_10007383 3300025910 Bacteria 9905
145 Ga0207684_10008827 3300025910 Bacteria 8948
146 Ga0207684_10048803 3300025910 Unclassified 3591
147 Ga0207684_10190999 3300025910 Bacteria 1767
148 Ga0207654_10280572 3300025911 Bacteria 1127
149 Ga0207707_10002505 3300025912 Bacteria 16535
150 Ga0207695_10075557 3300025913 Bacteria 3428
151 Ga0207695_10108016 3300025913 Bacteria 2767
152 Ga0207671_10000811 3300025914 Bacteria 39493
153 Ga0207693_10000152 3300025915 Bacteria 63967
154 Ga0207663_10002477 3300025916 Bacteria 8894
155 Ga0207663_10027968 3300025916 Bacteria 3294
156 Ga0207660_10014078 3300025917 Bacteria 5251
157 Ga0207652_10027592 3300025921 Unclassified 4732
158 Ga0207646_10137138 3300025922 Bacteria 2203
159 Ga0207646_10251519 3300025922 Unclassified 1597
160 Ga0207694_10080683 3300025924 Bacteria 2554
161 Ga0207650_10000028 3300025925 Bacteria 236867
162 Ga0207687_10002906 3300025927 Bacteria 11625
163 Ga0207700_10041215 3300025928 Unclassified 3377
164 Ga0207700_10050630 3300025928 Bacteria 3096
165 Ga0207700_10138079 3300025928 Bacteria 1999
166 Ga0207700_10189500 3300025928 Bacteria 1728
167 Ga0207644_10001949 3300025931 Bacteria 13370
168 Ga0207644_10104170 3300025931 Bacteria 2136
169 Ga0207690_10005263 3300025932 Bacteria 7624
170 Ga0207706_10040184 3300025933 Unclassified 4145
171 Ga0207686_10003763 3300025934 Bacteria 8141
172 Ga0207709_10000718 3300025935 Bacteria 26589
173 Ga0207704_10097466 3300025938 Bacteria 1950
174 Ga0207665_10000025 3300025939 Bacteria 100584
175 Ga0207665_10000125 3300025939 Bacteria 50974
176 Ga0207665_10101114 3300025939 Bacteria 2013
177 Ga0207665_10121617 3300025939 Unclassified 1845
178 Ga0207665_10331618 3300025939 Bacteria 1144
179 Ga0207711_10047534 3300025941 Unclassified 3669
180 Ga0207689_10039881 3300025942 Bacteria 3887
181 Ga0207679_10001272 3300025945 Bacteria 15982
182 Ga0207651_10171607 3300025960 Bacteria 1711
183 Ga0207651_10223929 3300025960 Unclassified 1522
184 Ga0207712_10000544 3300025961 Bacteria 30557
185 Ga0207668_10002854 3300025972 Bacteria 10126
186 Ga0207640_10106117 3300025981 Bacteria 1981
187 Ga0207640_10241155 3300025981 Unclassified 1397
188 Ga0207677_10004099 3300026023 Bacteria 7792
189 Ga0207703_10000114 3300026035 Bacteria 96051
190 Ga0207708_10007551 3300026075 Bacteria 8041
191 Ga0207708_10030991 3300026075 Bacteria 4058
192 Ga0207702_10156539 3300026078 Bacteria 2077
193 Ga0207676_10073404 3300026095 Bacteria 2753
194 Ga0207674_10000790 3300026116 Bacteria 41276
195 Ga0207675_100015493 3300026118 Bacteria 7111
196 Ga0207675_100335387 3300026118 Bacteria 1479
197 Ga0207675_100449940 3300026118 Bacteria 1276
198 Ga0268265_10242093 3300028380 Bacteria 1593
199 Ga0268264_10386406 3300028381 Unclassified 1341
200 Ga0265762_1000387 3300030760 Bacteria 7554
201 Ga0307513_10001475 3300031456 Bacteria 33811
202 Ga0307405_10129856 3300031731 Bacteria 1739
203 Ga0307407_10058953 3300031903 Bacteria 2234
204 Ga0307416_100171628 3300032002 Unclassified 2020
205 Ga0373934_0041758 3300035086 Bacteria 1811
206 Ga0373933_0033745 3300035724 Bacteria 2979
207 Ga0373937_0053049 3300036401 Bacteria 3719
208 Ga0436365_0213934 3300039437 Bacteria 51788
209 Ga0436365_0543889 3300039437 Bacteria 17802
210 Ga0439445_0008770 3300042004 Bacteria 2373
211 Ga0439449_0070127 3300042007 Bacteria 1292
212 Ga0451576_0063464 3300045051 Unclassified 3850
213 Ga0495580_0003701 3300046472 Bacteria 12962
214 Ga0495580_0096405 3300046472 Bacteria 2057
215 Ga0495580_0146112 3300046472 Bacteria 1639
216 Ga0495584_0100529 3300046491 Bacteria 1462
217 Ga0495594_0165159 3300046499 Unclassified 1259
218 Ga0496102_0197344 3300048905 Unclassified 1897
219 Ga0496106_0012966 3300048909 Bacteria 6150
220 Ga0501291_003420 3300049514 Bacteria 1972
221 Ga0501298_007647 3300049521 Bacteria 1796
222 nmdc:mga05p37_5656_c1 3300050507 Bacteria 14697
223 nmdc:mga09592_195339_c1 3300050508 Bacteria 1752
224 nmdc:mga08y16_43825_c1 3300050511 Bacteria 4688
225 nmdc:mga0n895_61999_c1 3300050512 Bacteria 3694
226 nmdc:mga0rr50_10892_c1 3300050513 Bacteria 5797
227 nmdc:mga0rr50_117639_c1 3300050513 Bacteria 2111
228 nmdc:mga0rr50_320949_c1 3300050513 Unclassified 1298
229 nmdc:mga08x19_40577_c1 3300050514 Unclassified 2962
230 nmdc:mga0a205_18770_c1 3300050515 Bacteria 6509
231 nmdc:mga0a205_43157_c1 3300050515 Bacteria 4348
232 Ga0495655_0002356 3300053083 Bacteria 2989

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10089127 Ga0163162_100891271 283
2 3300046472 Ga0495580_0003701 Ga0495580_0003701_4590_5495 283
3 3300046472 Ga0495580_0096405 Ga0495580_0096405_1111_2016 283
4 3300046472 Ga0495580_0146112 Ga0495580_0146112_403_1308 283
5 3300046499 Ga0495594_0165159 Ga0495594_0165159_100_1005 283
6 3300050508 nmdc:mga09592_195339_c1 nmdc:mga09592_195339_c1_45_1013 291
7 3300005834 Ga0068851_10000522 Ga0068851_100005223 293
8 3300046491 Ga0495584_0100529 Ga0495584_0100529_460_1395 293
9 3300049514 Ga0501291_003420 Ga0501291_003420_924_1892 298
10 3300049521 Ga0501298_007647 Ga0501298_007647_635_1603 298
11 3300009148 Ga0105243_10060445 Ga0105243_100604452 299
12 3300005435 Ga0070714_100039938 Ga0070714_1000399382 302
13 3300005444 Ga0070694_100196682 Ga0070694_1001966822 302
14 3300005546 Ga0070696_100255398 Ga0070696_1002553981 302
15 3300005615 Ga0070702_100022948 Ga0070702_1000229483 302
16 3300005616 Ga0068852_100145054 Ga0068852_1001450542 302
17 3300026075 Ga0207708_10007551 Ga0207708_100075512 302
18 3300050514 nmdc:mga08x19_40577_c1 nmdc:mga08x19_40577_c1_965_1948 302
19 3300005617 Ga0068859_100073174 Ga0068859_1000731743 303
20 3300005985 Ga0081539_10001299 Ga0081539_1000129922 303
21 3300006931 Ga0097620_100073177 Ga0097620_1000731773 303
22 3300009545 Ga0105237_10001434 Ga0105237_1000143429 303
23 3300025914 Ga0207671_10000811 Ga0207671_1000081113 303
24 3300009177 Ga0105248_10038007 Ga0105248_100380074 304
25 3300014968 Ga0157379_10150951 Ga0157379_101509511 304
26 3300013307 Ga0157372_10036346 Ga0157372_100363463 309
27 3300030760 Ga0265762_1000387 Ga0265762_10003873 309
28 3300005467 Ga0070706_100008810 Ga0070706_1000088103 310
29 3300025910 Ga0207684_10008827 Ga0207684_100088276 310
30 3300005471 Ga0070698_100434581 Ga0070698_1004345811 311
31 3300013100 Ga0157373_10008902 Ga0157373_100089026 311
32 3300013308 Ga0157375_10340607 Ga0157375_103406071 311
33 3300005335 Ga0070666_10034059 Ga0070666_100340592 312
34 3300005338 Ga0068868_100057457 Ga0068868_1000574572 312
35 3300005436 Ga0070713_100035502 Ga0070713_1000355022 312
36 3300005439 Ga0070711_100026974 Ga0070711_1000269742 312
37 3300005467 Ga0070706_100000410 Ga0070706_10000041043 312
38 3300005536 Ga0070697_100000054 Ga0070697_10000005450 312
39 3300005536 Ga0070697_100000336 Ga0070697_10000033614 312
40 3300005578 Ga0068854_100105859 Ga0068854_1001058592 312
41 3300006163 Ga0070715_10005306 Ga0070715_100053063 312
42 3300006237 Ga0097621_100001104 Ga0097621_10000110415 312
43 3300006237 Ga0097621_100011912 Ga0097621_1000119126 312
44 3300006358 Ga0068871_100001486 Ga0068871_1000014867 312
45 3300006358 Ga0068871_100008721 Ga0068871_1000087214 312
46 3300009098 Ga0105245_10002664 Ga0105245_1000266411 312
47 3300009147 Ga0114129_10040634 Ga0114129_100406343 312
48 3300009176 Ga0105242_10008678 Ga0105242_100086782 312
49 3300010375 Ga0105239_10018354 Ga0105239_100183543 312
50 3300013296 Ga0157374_10009225 Ga0157374_100092253 312
51 3300013297 Ga0157378_10000144 Ga0157378_1000014417 312
52 3300013307 Ga0157372_10118792 Ga0157372_101187923 312
53 3300024225 Ga0224572_1000402 Ga0224572_10004024 312
54 3300024227 Ga0228598_1003132 Ga0228598_10031323 312
55 3300025906 Ga0207699_10086839 Ga0207699_100868391 312
56 3300025910 Ga0207684_10007383 Ga0207684_100073833 312
57 3300025913 Ga0207695_10108016 Ga0207695_101080162 312
58 3300025915 Ga0207693_10000152 Ga0207693_1000015247 312
59 3300025916 Ga0207663_10002477 Ga0207663_100024772 312
60 3300025922 Ga0207646_10251519 Ga0207646_102515192 312
61 3300025924 Ga0207694_10080683 Ga0207694_100806833 312
62 3300025927 Ga0207687_10002906 Ga0207687_100029064 312
63 3300025928 Ga0207700_10189500 Ga0207700_101895001 312
64 3300025939 Ga0207665_10121617 Ga0207665_101216172 312
65 3300025939 Ga0207665_10331618 Ga0207665_103316181 312
66 3300025941 Ga0207711_10047534 Ga0207711_100475343 312
67 3300025981 Ga0207640_10241155 Ga0207640_102411552 312
68 3300026023 Ga0207677_10004099 Ga0207677_100040993 312
69 3300035086 Ga0373934_0041758 Ga0373934_0041758_518_1519 312
70 3300035724 Ga0373933_0033745 Ga0373933_0033745_479_1480 312
71 3300036401 Ga0373937_0053049 Ga0373937_0053049_2682_3683 312
72 3300005439 Ga0070711_100024748 Ga0070711_1000247481 313
73 3300005467 Ga0070706_100116075 Ga0070706_1001160751 313
74 3300005467 Ga0070706_100192577 Ga0070706_1001925772 313
75 3300005471 Ga0070698_100050623 Ga0070698_1000506232 313
76 3300005618 Ga0068864_100020804 Ga0068864_1000208043 313
77 3300005843 Ga0068860_100075308 Ga0068860_1000753084 313
78 3300006028 Ga0070717_10000415 Ga0070717_100004155 313
79 3300006163 Ga0070715_10003398 Ga0070715_100033982 313
80 3300006175 Ga0070712_100008636 Ga0070712_1000086362 313
81 3300009094 Ga0111539_10206686 Ga0111539_102066862 313
82 3300013308 Ga0157375_10333797 Ga0157375_103337972 313
83 3300025905 Ga0207685_10009744 Ga0207685_100097442 313
84 3300025906 Ga0207699_10023029 Ga0207699_100230295 313
85 3300025910 Ga0207684_10048803 Ga0207684_100488033 313
86 3300025910 Ga0207684_10190999 Ga0207684_101909992 313
87 3300025916 Ga0207663_10027968 Ga0207663_100279682 313
88 3300025939 Ga0207665_10000125 Ga0207665_100001259 313
89 3300026095 Ga0207676_10073404 Ga0207676_100734042 313
90 3300028380 Ga0268265_10242093 Ga0268265_102420932 313
91 3300048905 Ga0496102_0197344 Ga0496102_0197344_692_1696 313
92 3300005434 Ga0070709_10148671 Ga0070709_101486712 314
93 3300005434 Ga0070709_10149879 Ga0070709_101498792 314
94 3300005436 Ga0070713_100006011 Ga0070713_1000060115 314
95 3300005436 Ga0070713_100081478 Ga0070713_1000814782 314
96 3300005436 Ga0070713_100084405 Ga0070713_1000844052 314
97 3300005437 Ga0070710_10116379 Ga0070710_101163792 314
98 3300006173 Ga0070716_100242998 Ga0070716_1002429981 314
99 3300006871 Ga0075434_100068804 Ga0075434_1000688042 314
100 3300007076 Ga0075435_100129510 Ga0075435_1001295101 314
101 3300013307 Ga0157372_10040596 Ga0157372_100405964 314
102 3300025898 Ga0207692_10012476 Ga0207692_100124762 314
103 3300025928 Ga0207700_10041215 Ga0207700_100412153 314
104 3300025928 Ga0207700_10050630 Ga0207700_100506302 314
105 3300025928 Ga0207700_10138079 Ga0207700_101380792 314
106 3300025938 Ga0207704_10097466 Ga0207704_100974662 314
107 3300050512 nmdc:mga0n895_61999_c1 nmdc:mga0n895_61999_c1_2300_3307 314
108 3300050513 nmdc:mga0rr50_117639_c1 nmdc:mga0rr50_117639_c1_193_1200 314
109 3300005441 Ga0070700_100128137 Ga0070700_1001281371 315
110 3300026075 Ga0207708_10030991 Ga0207708_100309915 315
111 3300005459 Ga0068867_100162985 Ga0068867_1001629852 317
112 3300005617 Ga0068859_100223565 Ga0068859_1002235652 317
113 3300006931 Ga0097620_100223561 Ga0097620_1002235612 317
114 3300007265 Ga0099794_10008154 Ga0099794_100081543 317
115 3300014326 Ga0157380_10141361 Ga0157380_101413612 317
116 3300028381 Ga0268264_10386406 Ga0268264_103864062 317
117 3300005578 Ga0068854_100119855 Ga0068854_1001198552 318
118 3300025911 Ga0207654_10280572 Ga0207654_102805721 318
119 3300025981 Ga0207640_10106117 Ga0207640_101061172 318
120 3300050513 nmdc:mga0rr50_320949_c1 nmdc:mga0rr50_320949_c1_166_1236 319
121 3300006880 Ga0075429_100069492 Ga0075429_1000694923 320
122 3300005471 Ga0070698_100112982 Ga0070698_1001129822 321
123 3300009176 Ga0105242_10083372 Ga0105242_100833722 321
124 3300005289 Ga0065704_10016105 Ga0065704_100161051 322
125 3300009148 Ga0105243_10104732 Ga0105243_101047322 322
126 3300021384 Ga0213876_10000246 Ga0213876_1000024618 322
127 3300025939 Ga0207665_10101114 Ga0207665_101011142 322
128 3300039437 Ga0436365_0213934 Ga0436365_0213934_23124_24218 322
129 3300005468 Ga0070707_100027976 Ga0070707_1000279763 323
130 3300005471 Ga0070698_100034824 Ga0070698_1000348243 323
131 3300005518 Ga0070699_100016326 Ga0070699_1000163262 323
132 3300005536 Ga0070697_100083938 Ga0070697_1000839382 323
133 3300025922 Ga0207646_10137138 Ga0207646_101371382 323
134 3300005843 Ga0068860_100393755 Ga0068860_1003937552 324
135 3300002459 JGI24751J29686_10000006 JGI24751J29686_1000000613 325
136 3300005331 Ga0070670_100001299 Ga0070670_10000129910 325
137 3300005331 Ga0070670_100363454 Ga0070670_1003634541 325
138 3300009093 Ga0105240_10091039 Ga0105240_100910393 325
139 3300014325 Ga0163163_10001375 Ga0163163_100013756 325
140 3300025913 Ga0207695_10075557 Ga0207695_100755573 325
141 3300025925 Ga0207650_10000028 Ga0207650_1000002898 325
142 3300005364 Ga0070673_100254085 Ga0070673_1002540852 326
143 3300007076 Ga0075435_100003512 Ga0075435_1000035128 326
144 3300013296 Ga0157374_10281273 Ga0157374_102812732 326
145 3300013308 Ga0157375_10052563 Ga0157375_100525633 326
146 3300014325 Ga0163163_10003120 Ga0163163_100031208 326
147 3300014969 Ga0157376_10159990 Ga0157376_101599902 326
148 3300025931 Ga0207644_10104170 Ga0207644_101041702 326
149 3300025960 Ga0207651_10171607 Ga0207651_101716072 326
150 3300050513 nmdc:mga0rr50_10892_c1 nmdc:mga0rr50_10892_c1_3660_4751 326
151 3300005336 Ga0070680_100034160 Ga0070680_1000341603 327
152 3300005339 Ga0070660_100040792 Ga0070660_1000407921 327
153 3300005344 Ga0070661_100016994 Ga0070661_1000169942 327
154 3300005366 Ga0070659_100002910 Ga0070659_1000029103 327
155 3300005458 Ga0070681_10016366 Ga0070681_100163666 327
156 3300005530 Ga0070679_100009434 Ga0070679_1000094344 327
157 3300005564 Ga0070664_100004142 Ga0070664_1000041427 327
158 3300005577 Ga0068857_100002169 Ga0068857_1000021696 327
159 3300005618 Ga0068864_100010153 Ga0068864_1000101533 327
160 3300013100 Ga0157373_10013253 Ga0157373_100132533 327
161 3300013307 Ga0157372_10303292 Ga0157372_103032922 327
162 3300025912 Ga0207707_10002505 Ga0207707_1000250511 327
163 3300025917 Ga0207660_10014078 Ga0207660_100140783 327
164 3300025921 Ga0207652_10027592 Ga0207652_100275922 327
165 3300025932 Ga0207690_10005263 Ga0207690_100052633 327
166 3300025933 Ga0207706_10040184 Ga0207706_100401843 327
167 3300025945 Ga0207679_10001272 Ga0207679_100012723 327
168 3300026116 Ga0207674_10000790 Ga0207674_1000079036 327
169 3300042004 Ga0439445_0008770 Ga0439445_0008770_1170_2279 327
170 3300042007 Ga0439449_0070127 Ga0439449_0070127_91_1200 327
171 3300050515 nmdc:mga0a205_43157_c1 nmdc:mga0a205_43157_c1_1504_2574 327
172 3300053083 Ga0495655_0002356 Ga0495655_0002356_742_1800 328
173 3300005518 Ga0070699_100011249 Ga0070699_1000112498 329
174 3300006173 Ga0070716_100000013 Ga0070716_10000001338 329
175 3300006844 Ga0075428_100468001 Ga0075428_1004680011 329
176 3300009176 Ga0105242_10098338 Ga0105242_100983383 329
177 3300025939 Ga0207665_10000025 Ga0207665_1000002538 329
178 3300050511 nmdc:mga08y16_43825_c1 nmdc:mga08y16_43825_c1_2950_4038 329
179 3300009147 Ga0114129_10040166 Ga0114129_100401664 330
180 3300005614 Ga0068856_100201378 Ga0068856_1002013782 331
181 3300026078 Ga0207702_10156539 Ga0207702_101565392 331
182 3300031731 Ga0307405_10129856 Ga0307405_101298561 332
183 3300031903 Ga0307407_10058953 Ga0307407_100589532 332
184 3300005536 Ga0070697_100000466 Ga0070697_1000004664 333
185 3300005549 Ga0070704_100040301 Ga0070704_1000403013 334
186 3300005347 Ga0070668_100002227 Ga0070668_1000022277 335
187 3300009553 Ga0105249_10000369 Ga0105249_1000036936 335
188 3300013306 Ga0163162_10000019 Ga0163162_10000019126 335
189 3300014326 Ga0157380_10037083 Ga0157380_100370833 335
190 3300025961 Ga0207712_10000544 Ga0207712_100005446 335
191 3300025972 Ga0207668_10002854 Ga0207668_100028549 335
192 3300026118 Ga0207675_100335387 Ga0207675_1003353871 335
193 3300003203 JGI25406J46586_10003759 JGI25406J46586_100037594 337
194 3300005334 Ga0068869_100091550 Ga0068869_1000915502 337
195 3300005985 Ga0081539_10001310 Ga0081539_100013109 337
196 3300006852 Ga0075433_10058460 Ga0075433_100584602 337
197 3300025942 Ga0207689_10039881 Ga0207689_100398814 337
198 3300045051 Ga0451576_0063464 Ga0451576_0063464_1138_2208 337
199 3300050515 nmdc:mga0a205_18770_c1 nmdc:mga0a205_18770_c1_2406_3476 337
200 3300005338 Ga0068868_100062687 Ga0068868_1000626874 338
201 3300005364 Ga0070673_100012172 Ga0070673_1000121725 338
202 3300005467 Ga0070706_100016174 Ga0070706_1000161744 338
203 3300005471 Ga0070698_100030895 Ga0070698_1000308953 338
204 3300005518 Ga0070699_100001635 Ga0070699_10000163510 338
205 3300005536 Ga0070697_100045605 Ga0070697_1000456053 338
206 3300005842 Ga0068858_100010751 Ga0068858_1000107511 338
207 3300006163 Ga0070715_10000006 Ga0070715_10000006143 338
208 3300006852 Ga0075433_10084257 Ga0075433_100842574 338
209 3300009147 Ga0114129_10018348 Ga0114129_100183484 338
210 3300009148 Ga0105243_10000446 Ga0105243_1000044623 338
211 3300009176 Ga0105242_10000928 Ga0105242_1000092811 338
212 3300013297 Ga0157378_10000004 Ga0157378_10000004123 338
213 3300013308 Ga0157375_10003976 Ga0157375_1000397610 338
214 3300025905 Ga0207685_10000010 Ga0207685_1000001048 338
215 3300025934 Ga0207686_10003763 Ga0207686_100037635 338
216 3300025935 Ga0207709_10000718 Ga0207709_1000071810 338
217 3300025960 Ga0207651_10223929 Ga0207651_102239291 338
218 3300026118 Ga0207675_100015493 Ga0207675_1000154938 338
219 3300026118 Ga0207675_100449940 Ga0207675_1004499401 338
220 3300032002 Ga0307416_100171628 Ga0307416_1001716282 338
221 3300048909 Ga0496106_0012966 Ga0496106_0012966_4887_5960 338
222 3300050507 nmdc:mga05p37_5656_c1 nmdc:mga05p37_5656_c1_7303_8376 338
223 3300002074 JGI24748J21848_1000001 JGI24748J21848_1000001306 339
224 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001111 339
225 3300005842 Ga0068858_100000051 Ga0068858_10000005164 339
226 3300009101 Ga0105247_10000004 Ga0105247_10000004153 339
227 3300021384 Ga0213876_10080200 Ga0213876_100802002 339
228 3300025900 Ga0207710_10000002 Ga0207710_10000002860 339
229 3300025931 Ga0207644_10001949 Ga0207644_100019496 339
230 3300026035 Ga0207703_10000114 Ga0207703_1000011410 339
231 3300031456 Ga0307513_10001475 Ga0307513_100014758 339
232 3300039437 Ga0436365_0543889 Ga0436365_0543889_346_1479 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

56

334

0.89

PF12849

PBP_like_2

PBP superfamily domain

47

335

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pc3-assembly1.cif.gz_A crystal structure of the extracellular phosphate abc transport receptor (psts-1) and immunodominant antigen of m. tuberculosis. 0.9459 32 333
5i84-assembly3.cif.gz_C structure of the xanthomonas citri phosphate-binding protein phox 0.9294 37 331
8ods-assembly1.cif.gz_A phosphate-binding protein (psts) from xanthomonas citri pv. citri a306 bound to phosphate 0.9287 36 331
5i84-assembly5.cif.gz_E structure of the xanthomonas citri phosphate-binding protein phox 0.927 37 331
1quj-assembly1.cif.gz_A phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate 0.9195 35 338
ID Description Score Start End Superfamily
af_Q2FYP6_33_111_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.932 36 100 3.40.190.10
4gd5B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9275 36 111 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9248 115 271 3.40.190.10
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.923 114 271 3.40.190.10
1pc3B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9188 35 333 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2V8IH43-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9771 209 331
AF-A0A1Q6YN43-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9738 35 331 GO:0035435
GO:0042301
GO:0043190
AF-A0A3C1JPN0-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9718 73 339 GO:0035435
GO:0042301
GO:0043190
AF-A0A3D3ZIF6-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9715 36 339 GO:0035435
GO:0042301
GO:0043190
AF-A0A3L7YJ45-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9678 111 339 GO:0035435
GO:0042301
GO:0043190

Feature Viewer

pLDDT pTM Quality
89.01 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map