F345300
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 232 | 149 | 232 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0543889|Ga0436365_0543889_346_1479 |
| Length | 377 |
| Sequence | MLSKLSSPKSGDVPVMPFSKKFSRTLSACTLVCLAALLIGCSRQGGGDGAGGSVRLQGAGATFPNPLYQKWLSEYTKLNPNVKIDYQSIGSGGGIKQIKEETVDFGASDAPMSDDDLKSARGGEILHIPTVLGAVVLTYNLQGVSQPLRFSPDVIADIFLGKIKKWDDARIKADNAGAALPAADITVVHRSDGSGTSAVFTEYLSKVSAEWKEKVGKGSSPNWPVGLGGKGNEGVTGTVKQTPNAIGYVELAYAVKNNLPVALIKNKSGNFVEPSLDAVTAAASEALAATPDDLRVSITDGTGASAYPISSYTYILAYKEQKDAAKGKALVDFLWWGIHDGEQYARDLTYAPLPAEIIKRAEAKIRMIASGGKALRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 80 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 81 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 125 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 133 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 134 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 135 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 139 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 140 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 141 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 142 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.43 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.86 |
| Rhizosphere | 96.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000001 | 3300002074 | Bacteria | 444271 |
| 2 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 3 | JGI24751J29686_10000006 | 3300002459 | Bacteria | 134556 |
| 4 | JGI25406J46586_10003759 | 3300003203 | Bacteria | 7099 |
| 5 | Ga0065704_10016105 | 3300005289 | Bacteria | 1592 |
| 6 | Ga0070670_100001299 | 3300005331 | Bacteria | 19892 |
| 7 | Ga0070670_100363454 | 3300005331 | Bacteria | 1273 |
| 8 | Ga0068869_100091550 | 3300005334 | Bacteria | 2288 |
| 9 | Ga0070666_10034059 | 3300005335 | Unclassified | 3375 |
| 10 | Ga0070680_100034160 | 3300005336 | Unclassified | 4101 |
| 11 | Ga0068868_100057457 | 3300005338 | Unclassified | 3074 |
| 12 | Ga0068868_100062687 | 3300005338 | Bacteria | 2948 |
| 13 | Ga0070660_100040792 | 3300005339 | Bacteria | 3535 |
| 14 | Ga0070661_100016994 | 3300005344 | Bacteria | 5154 |
| 15 | Ga0070668_100002227 | 3300005347 | Bacteria | 14250 |
| 16 | Ga0070673_100012172 | 3300005364 | Bacteria | 5897 |
| 17 | Ga0070673_100254085 | 3300005364 | Bacteria | 1533 |
| 18 | Ga0070659_100002910 | 3300005366 | Bacteria | 12198 |
| 19 | Ga0070709_10148671 | 3300005434 | Bacteria | 1617 |
| 20 | Ga0070709_10149879 | 3300005434 | Unclassified | 1611 |
| 21 | Ga0070714_100039938 | 3300005435 | Unclassified | 3954 |
| 22 | Ga0070713_100006011 | 3300005436 | Bacteria | 8358 |
| 23 | Ga0070713_100035502 | 3300005436 | Bacteria | 4014 |
| 24 | Ga0070713_100081478 | 3300005436 | Unclassified | 2762 |
| 25 | Ga0070713_100084405 | 3300005436 | Bacteria | 2717 |
| 26 | Ga0070710_10116379 | 3300005437 | Bacteria | 1612 |
| 27 | Ga0070711_100024748 | 3300005439 | Unclassified | 3921 |
| 28 | Ga0070711_100026974 | 3300005439 | Bacteria | 3767 |
| 29 | Ga0070700_100128137 | 3300005441 | Bacteria | 1709 |
| 30 | Ga0070694_100196682 | 3300005444 | Bacteria | 1500 |
| 31 | Ga0070681_10016366 | 3300005458 | Bacteria | 7402 |
| 32 | Ga0068867_100162985 | 3300005459 | Bacteria | 1759 |
| 33 | Ga0070706_100000410 | 3300005467 | Bacteria | 51662 |
| 34 | Ga0070706_100008810 | 3300005467 | Bacteria | 9401 |
| 35 | Ga0070706_100016174 | 3300005467 | Bacteria | 6890 |
| 36 | Ga0070706_100116075 | 3300005467 | Bacteria | 2493 |
| 37 | Ga0070706_100192577 | 3300005467 | Bacteria | 1905 |
| 38 | Ga0070707_100027976 | 3300005468 | Bacteria | 5363 |
| 39 | Ga0070698_100030895 | 3300005471 | Bacteria | 5554 |
| 40 | Ga0070698_100034824 | 3300005471 | Bacteria | 5209 |
| 41 | Ga0070698_100050623 | 3300005471 | Bacteria | 4234 |
| 42 | Ga0070698_100112982 | 3300005471 | Bacteria | 2681 |
| 43 | Ga0070698_100434581 | 3300005471 | Bacteria | 1247 |
| 44 | Ga0070699_100001635 | 3300005518 | Bacteria | 20447 |
| 45 | Ga0070699_100011249 | 3300005518 | Bacteria | 7730 |
| 46 | Ga0070699_100016326 | 3300005518 | Bacteria | 6376 |
| 47 | Ga0070679_100009434 | 3300005530 | Bacteria | 9230 |
| 48 | Ga0070697_100000054 | 3300005536 | Bacteria | 88022 |
| 49 | Ga0070697_100000336 | 3300005536 | Bacteria | 37001 |
| 50 | Ga0070697_100000466 | 3300005536 | Bacteria | 30951 |
| 51 | Ga0070697_100045605 | 3300005536 | Unclassified | 3552 |
| 52 | Ga0070697_100083938 | 3300005536 | Bacteria | 2627 |
| 53 | Ga0070696_100255398 | 3300005546 | Bacteria | 1327 |
| 54 | Ga0070704_100040301 | 3300005549 | Bacteria | 3214 |
| 55 | Ga0070664_100004142 | 3300005564 | Bacteria | 11650 |
| 56 | Ga0068857_100002169 | 3300005577 | Bacteria | 15952 |
| 57 | Ga0068854_100105859 | 3300005578 | Unclassified | 2115 |
| 58 | Ga0068854_100119855 | 3300005578 | Bacteria | 1996 |
| 59 | Ga0068856_100201378 | 3300005614 | Bacteria | 2005 |
| 60 | Ga0070702_100022948 | 3300005615 | Bacteria | 3309 |
| 61 | Ga0068852_100145054 | 3300005616 | Bacteria | 2201 |
| 62 | Ga0068859_100073174 | 3300005617 | Bacteria | 3465 |
| 63 | Ga0068859_100223565 | 3300005617 | Bacteria | 1970 |
| 64 | Ga0068864_100010153 | 3300005618 | Bacteria | 7774 |
| 65 | Ga0068864_100020804 | 3300005618 | Bacteria | 5490 |
| 66 | Ga0068851_10000522 | 3300005834 | Bacteria | 16803 |
| 67 | Ga0068858_100000051 | 3300005842 | Bacteria | 120692 |
| 68 | Ga0068858_100010751 | 3300005842 | Bacteria | 8654 |
| 69 | Ga0068860_100075308 | 3300005843 | Bacteria | 3210 |
| 70 | Ga0068860_100393755 | 3300005843 | Unclassified | 1369 |
| 71 | Ga0081539_10001299 | 3300005985 | Bacteria | 43815 |
| 72 | Ga0081539_10001310 | 3300005985 | Bacteria | 43539 |
| 73 | Ga0070717_10000415 | 3300006028 | Bacteria | 27295 |
| 74 | Ga0070715_10000006 | 3300006163 | Bacteria | 216296 |
| 75 | Ga0070715_10003398 | 3300006163 | Bacteria | 5054 |
| 76 | Ga0070715_10005306 | 3300006163 | Bacteria | 4289 |
| 77 | Ga0070716_100000013 | 3300006173 | Bacteria | 100600 |
| 78 | Ga0070716_100242998 | 3300006173 | Bacteria | 1222 |
| 79 | Ga0070712_100008636 | 3300006175 | Bacteria | 6414 |
| 80 | Ga0097621_100001104 | 3300006237 | Bacteria | 18848 |
| 81 | Ga0097621_100011912 | 3300006237 | Bacteria | 6432 |
| 82 | Ga0068871_100001486 | 3300006358 | Bacteria | 15714 |
| 83 | Ga0068871_100008721 | 3300006358 | Bacteria | 7294 |
| 84 | Ga0075428_100468001 | 3300006844 | Unclassified | 1349 |
| 85 | Ga0075433_10058460 | 3300006852 | Unclassified | 3372 |
| 86 | Ga0075433_10084257 | 3300006852 | Bacteria | 2806 |
| 87 | Ga0075434_100068804 | 3300006871 | Bacteria | 3528 |
| 88 | Ga0075429_100069492 | 3300006880 | Bacteria | 3067 |
| 89 | Ga0097620_100073177 | 3300006931 | Bacteria | 3465 |
| 90 | Ga0097620_100223561 | 3300006931 | Bacteria | 1970 |
| 91 | Ga0075435_100003512 | 3300007076 | Bacteria | 10644 |
| 92 | Ga0075435_100129510 | 3300007076 | Bacteria | 2111 |
| 93 | Ga0099794_10008154 | 3300007265 | Bacteria | 4340 |
| 94 | Ga0105240_10091039 | 3300009093 | Bacteria | 3727 |
| 95 | Ga0111539_10206686 | 3300009094 | Bacteria | 2288 |
| 96 | Ga0105245_10002664 | 3300009098 | Bacteria | 16075 |
| 97 | Ga0105247_10000004 | 3300009101 | Bacteria | 455497 |
| 98 | Ga0114129_10018348 | 3300009147 | Bacteria | 9965 |
| 99 | Ga0114129_10040166 | 3300009147 | Bacteria | 6596 |
| 100 | Ga0114129_10040634 | 3300009147 | Bacteria | 6555 |
| 101 | Ga0105243_10000446 | 3300009148 | Bacteria | 43049 |
| 102 | Ga0105243_10060445 | 3300009148 | Bacteria | 3027 |
| 103 | Ga0105243_10104732 | 3300009148 | Bacteria | 2355 |
| 104 | Ga0105242_10000928 | 3300009176 | Bacteria | 22787 |
| 105 | Ga0105242_10008678 | 3300009176 | Bacteria | 7801 |
| 106 | Ga0105242_10083372 | 3300009176 | Bacteria | 2677 |
| 107 | Ga0105242_10098338 | 3300009176 | Bacteria | 2475 |
| 108 | Ga0105248_10038007 | 3300009177 | Bacteria | 5385 |
| 109 | Ga0105237_10001434 | 3300009545 | Bacteria | 31525 |
| 110 | Ga0105249_10000369 | 3300009553 | Bacteria | 44503 |
| 111 | Ga0105239_10018354 | 3300010375 | Bacteria | 7733 |
| 112 | Ga0157373_10008902 | 3300013100 | Bacteria | 7428 |
| 113 | Ga0157373_10013253 | 3300013100 | Bacteria | 6052 |
| 114 | Ga0157374_10009225 | 3300013296 | Bacteria | 8458 |
| 115 | Ga0157374_10281273 | 3300013296 | Bacteria | 1643 |
| 116 | Ga0157378_10000004 | 3300013297 | Bacteria | 201051 |
| 117 | Ga0157378_10000144 | 3300013297 | Bacteria | 67006 |
| 118 | Ga0163162_10000019 | 3300013306 | Bacteria | 220603 |
| 119 | Ga0163162_10089127 | 3300013306 | Unclassified | 3165 |
| 120 | Ga0157372_10036346 | 3300013307 | Bacteria | 5429 |
| 121 | Ga0157372_10040596 | 3300013307 | Bacteria | 5140 |
| 122 | Ga0157372_10118792 | 3300013307 | Unclassified | 3034 |
| 123 | Ga0157372_10303292 | 3300013307 | Bacteria | 1858 |
| 124 | Ga0157375_10003976 | 3300013308 | Bacteria | 12822 |
| 125 | Ga0157375_10052563 | 3300013308 | Bacteria | 4005 |
| 126 | Ga0157375_10333797 | 3300013308 | Bacteria | 1681 |
| 127 | Ga0157375_10340607 | 3300013308 | Bacteria | 1665 |
| 128 | Ga0163163_10001375 | 3300014325 | Bacteria | 20531 |
| 129 | Ga0163163_10003120 | 3300014325 | Bacteria | 14042 |
| 130 | Ga0157380_10037083 | 3300014326 | Bacteria | 3776 |
| 131 | Ga0157380_10141361 | 3300014326 | Unclassified | 2069 |
| 132 | Ga0157379_10150951 | 3300014968 | Bacteria | 2096 |
| 133 | Ga0157376_10159990 | 3300014969 | Unclassified | 2040 |
| 134 | Ga0213876_10000246 | 3300021384 | Bacteria | 51765 |
| 135 | Ga0213876_10080200 | 3300021384 | Bacteria | 1725 |
| 136 | Ga0224572_1000402 | 3300024225 | Unclassified | 4904 |
| 137 | Ga0228598_1003132 | 3300024227 | Bacteria | 3579 |
| 138 | Ga0207692_10012476 | 3300025898 | Bacteria | 3651 |
| 139 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 140 | Ga0207685_10000010 | 3300025905 | Bacteria | 216792 |
| 141 | Ga0207685_10009744 | 3300025905 | Bacteria | 2803 |
| 142 | Ga0207699_10023029 | 3300025906 | Bacteria | 3384 |
| 143 | Ga0207699_10086839 | 3300025906 | Bacteria | 1954 |
| 144 | Ga0207684_10007383 | 3300025910 | Bacteria | 9905 |
| 145 | Ga0207684_10008827 | 3300025910 | Bacteria | 8948 |
| 146 | Ga0207684_10048803 | 3300025910 | Unclassified | 3591 |
| 147 | Ga0207684_10190999 | 3300025910 | Bacteria | 1767 |
| 148 | Ga0207654_10280572 | 3300025911 | Bacteria | 1127 |
| 149 | Ga0207707_10002505 | 3300025912 | Bacteria | 16535 |
| 150 | Ga0207695_10075557 | 3300025913 | Bacteria | 3428 |
| 151 | Ga0207695_10108016 | 3300025913 | Bacteria | 2767 |
| 152 | Ga0207671_10000811 | 3300025914 | Bacteria | 39493 |
| 153 | Ga0207693_10000152 | 3300025915 | Bacteria | 63967 |
| 154 | Ga0207663_10002477 | 3300025916 | Bacteria | 8894 |
| 155 | Ga0207663_10027968 | 3300025916 | Bacteria | 3294 |
| 156 | Ga0207660_10014078 | 3300025917 | Bacteria | 5251 |
| 157 | Ga0207652_10027592 | 3300025921 | Unclassified | 4732 |
| 158 | Ga0207646_10137138 | 3300025922 | Bacteria | 2203 |
| 159 | Ga0207646_10251519 | 3300025922 | Unclassified | 1597 |
| 160 | Ga0207694_10080683 | 3300025924 | Bacteria | 2554 |
| 161 | Ga0207650_10000028 | 3300025925 | Bacteria | 236867 |
| 162 | Ga0207687_10002906 | 3300025927 | Bacteria | 11625 |
| 163 | Ga0207700_10041215 | 3300025928 | Unclassified | 3377 |
| 164 | Ga0207700_10050630 | 3300025928 | Bacteria | 3096 |
| 165 | Ga0207700_10138079 | 3300025928 | Bacteria | 1999 |
| 166 | Ga0207700_10189500 | 3300025928 | Bacteria | 1728 |
| 167 | Ga0207644_10001949 | 3300025931 | Bacteria | 13370 |
| 168 | Ga0207644_10104170 | 3300025931 | Bacteria | 2136 |
| 169 | Ga0207690_10005263 | 3300025932 | Bacteria | 7624 |
| 170 | Ga0207706_10040184 | 3300025933 | Unclassified | 4145 |
| 171 | Ga0207686_10003763 | 3300025934 | Bacteria | 8141 |
| 172 | Ga0207709_10000718 | 3300025935 | Bacteria | 26589 |
| 173 | Ga0207704_10097466 | 3300025938 | Bacteria | 1950 |
| 174 | Ga0207665_10000025 | 3300025939 | Bacteria | 100584 |
| 175 | Ga0207665_10000125 | 3300025939 | Bacteria | 50974 |
| 176 | Ga0207665_10101114 | 3300025939 | Bacteria | 2013 |
| 177 | Ga0207665_10121617 | 3300025939 | Unclassified | 1845 |
| 178 | Ga0207665_10331618 | 3300025939 | Bacteria | 1144 |
| 179 | Ga0207711_10047534 | 3300025941 | Unclassified | 3669 |
| 180 | Ga0207689_10039881 | 3300025942 | Bacteria | 3887 |
| 181 | Ga0207679_10001272 | 3300025945 | Bacteria | 15982 |
| 182 | Ga0207651_10171607 | 3300025960 | Bacteria | 1711 |
| 183 | Ga0207651_10223929 | 3300025960 | Unclassified | 1522 |
| 184 | Ga0207712_10000544 | 3300025961 | Bacteria | 30557 |
| 185 | Ga0207668_10002854 | 3300025972 | Bacteria | 10126 |
| 186 | Ga0207640_10106117 | 3300025981 | Bacteria | 1981 |
| 187 | Ga0207640_10241155 | 3300025981 | Unclassified | 1397 |
| 188 | Ga0207677_10004099 | 3300026023 | Bacteria | 7792 |
| 189 | Ga0207703_10000114 | 3300026035 | Bacteria | 96051 |
| 190 | Ga0207708_10007551 | 3300026075 | Bacteria | 8041 |
| 191 | Ga0207708_10030991 | 3300026075 | Bacteria | 4058 |
| 192 | Ga0207702_10156539 | 3300026078 | Bacteria | 2077 |
| 193 | Ga0207676_10073404 | 3300026095 | Bacteria | 2753 |
| 194 | Ga0207674_10000790 | 3300026116 | Bacteria | 41276 |
| 195 | Ga0207675_100015493 | 3300026118 | Bacteria | 7111 |
| 196 | Ga0207675_100335387 | 3300026118 | Bacteria | 1479 |
| 197 | Ga0207675_100449940 | 3300026118 | Bacteria | 1276 |
| 198 | Ga0268265_10242093 | 3300028380 | Bacteria | 1593 |
| 199 | Ga0268264_10386406 | 3300028381 | Unclassified | 1341 |
| 200 | Ga0265762_1000387 | 3300030760 | Bacteria | 7554 |
| 201 | Ga0307513_10001475 | 3300031456 | Bacteria | 33811 |
| 202 | Ga0307405_10129856 | 3300031731 | Bacteria | 1739 |
| 203 | Ga0307407_10058953 | 3300031903 | Bacteria | 2234 |
| 204 | Ga0307416_100171628 | 3300032002 | Unclassified | 2020 |
| 205 | Ga0373934_0041758 | 3300035086 | Bacteria | 1811 |
| 206 | Ga0373933_0033745 | 3300035724 | Bacteria | 2979 |
| 207 | Ga0373937_0053049 | 3300036401 | Bacteria | 3719 |
| 208 | Ga0436365_0213934 | 3300039437 | Bacteria | 51788 |
| 209 | Ga0436365_0543889 | 3300039437 | Bacteria | 17802 |
| 210 | Ga0439445_0008770 | 3300042004 | Bacteria | 2373 |
| 211 | Ga0439449_0070127 | 3300042007 | Bacteria | 1292 |
| 212 | Ga0451576_0063464 | 3300045051 | Unclassified | 3850 |
| 213 | Ga0495580_0003701 | 3300046472 | Bacteria | 12962 |
| 214 | Ga0495580_0096405 | 3300046472 | Bacteria | 2057 |
| 215 | Ga0495580_0146112 | 3300046472 | Bacteria | 1639 |
| 216 | Ga0495584_0100529 | 3300046491 | Bacteria | 1462 |
| 217 | Ga0495594_0165159 | 3300046499 | Unclassified | 1259 |
| 218 | Ga0496102_0197344 | 3300048905 | Unclassified | 1897 |
| 219 | Ga0496106_0012966 | 3300048909 | Bacteria | 6150 |
| 220 | Ga0501291_003420 | 3300049514 | Bacteria | 1972 |
| 221 | Ga0501298_007647 | 3300049521 | Bacteria | 1796 |
| 222 | nmdc:mga05p37_5656_c1 | 3300050507 | Bacteria | 14697 |
| 223 | nmdc:mga09592_195339_c1 | 3300050508 | Bacteria | 1752 |
| 224 | nmdc:mga08y16_43825_c1 | 3300050511 | Bacteria | 4688 |
| 225 | nmdc:mga0n895_61999_c1 | 3300050512 | Bacteria | 3694 |
| 226 | nmdc:mga0rr50_10892_c1 | 3300050513 | Bacteria | 5797 |
| 227 | nmdc:mga0rr50_117639_c1 | 3300050513 | Bacteria | 2111 |
| 228 | nmdc:mga0rr50_320949_c1 | 3300050513 | Unclassified | 1298 |
| 229 | nmdc:mga08x19_40577_c1 | 3300050514 | Unclassified | 2962 |
| 230 | nmdc:mga0a205_18770_c1 | 3300050515 | Bacteria | 6509 |
| 231 | nmdc:mga0a205_43157_c1 | 3300050515 | Bacteria | 4348 |
| 232 | Ga0495655_0002356 | 3300053083 | Bacteria | 2989 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10089127 | Ga0163162_100891271 | 283 |
| 2 | 3300046472 | Ga0495580_0003701 | Ga0495580_0003701_4590_5495 | 283 |
| 3 | 3300046472 | Ga0495580_0096405 | Ga0495580_0096405_1111_2016 | 283 |
| 4 | 3300046472 | Ga0495580_0146112 | Ga0495580_0146112_403_1308 | 283 |
| 5 | 3300046499 | Ga0495594_0165159 | Ga0495594_0165159_100_1005 | 283 |
| 6 | 3300050508 | nmdc:mga09592_195339_c1 | nmdc:mga09592_195339_c1_45_1013 | 291 |
| 7 | 3300005834 | Ga0068851_10000522 | Ga0068851_100005223 | 293 |
| 8 | 3300046491 | Ga0495584_0100529 | Ga0495584_0100529_460_1395 | 293 |
| 9 | 3300049514 | Ga0501291_003420 | Ga0501291_003420_924_1892 | 298 |
| 10 | 3300049521 | Ga0501298_007647 | Ga0501298_007647_635_1603 | 298 |
| 11 | 3300009148 | Ga0105243_10060445 | Ga0105243_100604452 | 299 |
| 12 | 3300005435 | Ga0070714_100039938 | Ga0070714_1000399382 | 302 |
| 13 | 3300005444 | Ga0070694_100196682 | Ga0070694_1001966822 | 302 |
| 14 | 3300005546 | Ga0070696_100255398 | Ga0070696_1002553981 | 302 |
| 15 | 3300005615 | Ga0070702_100022948 | Ga0070702_1000229483 | 302 |
| 16 | 3300005616 | Ga0068852_100145054 | Ga0068852_1001450542 | 302 |
| 17 | 3300026075 | Ga0207708_10007551 | Ga0207708_100075512 | 302 |
| 18 | 3300050514 | nmdc:mga08x19_40577_c1 | nmdc:mga08x19_40577_c1_965_1948 | 302 |
| 19 | 3300005617 | Ga0068859_100073174 | Ga0068859_1000731743 | 303 |
| 20 | 3300005985 | Ga0081539_10001299 | Ga0081539_1000129922 | 303 |
| 21 | 3300006931 | Ga0097620_100073177 | Ga0097620_1000731773 | 303 |
| 22 | 3300009545 | Ga0105237_10001434 | Ga0105237_1000143429 | 303 |
| 23 | 3300025914 | Ga0207671_10000811 | Ga0207671_1000081113 | 303 |
| 24 | 3300009177 | Ga0105248_10038007 | Ga0105248_100380074 | 304 |
| 25 | 3300014968 | Ga0157379_10150951 | Ga0157379_101509511 | 304 |
| 26 | 3300013307 | Ga0157372_10036346 | Ga0157372_100363463 | 309 |
| 27 | 3300030760 | Ga0265762_1000387 | Ga0265762_10003873 | 309 |
| 28 | 3300005467 | Ga0070706_100008810 | Ga0070706_1000088103 | 310 |
| 29 | 3300025910 | Ga0207684_10008827 | Ga0207684_100088276 | 310 |
| 30 | 3300005471 | Ga0070698_100434581 | Ga0070698_1004345811 | 311 |
| 31 | 3300013100 | Ga0157373_10008902 | Ga0157373_100089026 | 311 |
| 32 | 3300013308 | Ga0157375_10340607 | Ga0157375_103406071 | 311 |
| 33 | 3300005335 | Ga0070666_10034059 | Ga0070666_100340592 | 312 |
| 34 | 3300005338 | Ga0068868_100057457 | Ga0068868_1000574572 | 312 |
| 35 | 3300005436 | Ga0070713_100035502 | Ga0070713_1000355022 | 312 |
| 36 | 3300005439 | Ga0070711_100026974 | Ga0070711_1000269742 | 312 |
| 37 | 3300005467 | Ga0070706_100000410 | Ga0070706_10000041043 | 312 |
| 38 | 3300005536 | Ga0070697_100000054 | Ga0070697_10000005450 | 312 |
| 39 | 3300005536 | Ga0070697_100000336 | Ga0070697_10000033614 | 312 |
| 40 | 3300005578 | Ga0068854_100105859 | Ga0068854_1001058592 | 312 |
| 41 | 3300006163 | Ga0070715_10005306 | Ga0070715_100053063 | 312 |
| 42 | 3300006237 | Ga0097621_100001104 | Ga0097621_10000110415 | 312 |
| 43 | 3300006237 | Ga0097621_100011912 | Ga0097621_1000119126 | 312 |
| 44 | 3300006358 | Ga0068871_100001486 | Ga0068871_1000014867 | 312 |
| 45 | 3300006358 | Ga0068871_100008721 | Ga0068871_1000087214 | 312 |
| 46 | 3300009098 | Ga0105245_10002664 | Ga0105245_1000266411 | 312 |
| 47 | 3300009147 | Ga0114129_10040634 | Ga0114129_100406343 | 312 |
| 48 | 3300009176 | Ga0105242_10008678 | Ga0105242_100086782 | 312 |
| 49 | 3300010375 | Ga0105239_10018354 | Ga0105239_100183543 | 312 |
| 50 | 3300013296 | Ga0157374_10009225 | Ga0157374_100092253 | 312 |
| 51 | 3300013297 | Ga0157378_10000144 | Ga0157378_1000014417 | 312 |
| 52 | 3300013307 | Ga0157372_10118792 | Ga0157372_101187923 | 312 |
| 53 | 3300024225 | Ga0224572_1000402 | Ga0224572_10004024 | 312 |
| 54 | 3300024227 | Ga0228598_1003132 | Ga0228598_10031323 | 312 |
| 55 | 3300025906 | Ga0207699_10086839 | Ga0207699_100868391 | 312 |
| 56 | 3300025910 | Ga0207684_10007383 | Ga0207684_100073833 | 312 |
| 57 | 3300025913 | Ga0207695_10108016 | Ga0207695_101080162 | 312 |
| 58 | 3300025915 | Ga0207693_10000152 | Ga0207693_1000015247 | 312 |
| 59 | 3300025916 | Ga0207663_10002477 | Ga0207663_100024772 | 312 |
| 60 | 3300025922 | Ga0207646_10251519 | Ga0207646_102515192 | 312 |
| 61 | 3300025924 | Ga0207694_10080683 | Ga0207694_100806833 | 312 |
| 62 | 3300025927 | Ga0207687_10002906 | Ga0207687_100029064 | 312 |
| 63 | 3300025928 | Ga0207700_10189500 | Ga0207700_101895001 | 312 |
| 64 | 3300025939 | Ga0207665_10121617 | Ga0207665_101216172 | 312 |
| 65 | 3300025939 | Ga0207665_10331618 | Ga0207665_103316181 | 312 |
| 66 | 3300025941 | Ga0207711_10047534 | Ga0207711_100475343 | 312 |
| 67 | 3300025981 | Ga0207640_10241155 | Ga0207640_102411552 | 312 |
| 68 | 3300026023 | Ga0207677_10004099 | Ga0207677_100040993 | 312 |
| 69 | 3300035086 | Ga0373934_0041758 | Ga0373934_0041758_518_1519 | 312 |
| 70 | 3300035724 | Ga0373933_0033745 | Ga0373933_0033745_479_1480 | 312 |
| 71 | 3300036401 | Ga0373937_0053049 | Ga0373937_0053049_2682_3683 | 312 |
| 72 | 3300005439 | Ga0070711_100024748 | Ga0070711_1000247481 | 313 |
| 73 | 3300005467 | Ga0070706_100116075 | Ga0070706_1001160751 | 313 |
| 74 | 3300005467 | Ga0070706_100192577 | Ga0070706_1001925772 | 313 |
| 75 | 3300005471 | Ga0070698_100050623 | Ga0070698_1000506232 | 313 |
| 76 | 3300005618 | Ga0068864_100020804 | Ga0068864_1000208043 | 313 |
| 77 | 3300005843 | Ga0068860_100075308 | Ga0068860_1000753084 | 313 |
| 78 | 3300006028 | Ga0070717_10000415 | Ga0070717_100004155 | 313 |
| 79 | 3300006163 | Ga0070715_10003398 | Ga0070715_100033982 | 313 |
| 80 | 3300006175 | Ga0070712_100008636 | Ga0070712_1000086362 | 313 |
| 81 | 3300009094 | Ga0111539_10206686 | Ga0111539_102066862 | 313 |
| 82 | 3300013308 | Ga0157375_10333797 | Ga0157375_103337972 | 313 |
| 83 | 3300025905 | Ga0207685_10009744 | Ga0207685_100097442 | 313 |
| 84 | 3300025906 | Ga0207699_10023029 | Ga0207699_100230295 | 313 |
| 85 | 3300025910 | Ga0207684_10048803 | Ga0207684_100488033 | 313 |
| 86 | 3300025910 | Ga0207684_10190999 | Ga0207684_101909992 | 313 |
| 87 | 3300025916 | Ga0207663_10027968 | Ga0207663_100279682 | 313 |
| 88 | 3300025939 | Ga0207665_10000125 | Ga0207665_100001259 | 313 |
| 89 | 3300026095 | Ga0207676_10073404 | Ga0207676_100734042 | 313 |
| 90 | 3300028380 | Ga0268265_10242093 | Ga0268265_102420932 | 313 |
| 91 | 3300048905 | Ga0496102_0197344 | Ga0496102_0197344_692_1696 | 313 |
| 92 | 3300005434 | Ga0070709_10148671 | Ga0070709_101486712 | 314 |
| 93 | 3300005434 | Ga0070709_10149879 | Ga0070709_101498792 | 314 |
| 94 | 3300005436 | Ga0070713_100006011 | Ga0070713_1000060115 | 314 |
| 95 | 3300005436 | Ga0070713_100081478 | Ga0070713_1000814782 | 314 |
| 96 | 3300005436 | Ga0070713_100084405 | Ga0070713_1000844052 | 314 |
| 97 | 3300005437 | Ga0070710_10116379 | Ga0070710_101163792 | 314 |
| 98 | 3300006173 | Ga0070716_100242998 | Ga0070716_1002429981 | 314 |
| 99 | 3300006871 | Ga0075434_100068804 | Ga0075434_1000688042 | 314 |
| 100 | 3300007076 | Ga0075435_100129510 | Ga0075435_1001295101 | 314 |
| 101 | 3300013307 | Ga0157372_10040596 | Ga0157372_100405964 | 314 |
| 102 | 3300025898 | Ga0207692_10012476 | Ga0207692_100124762 | 314 |
| 103 | 3300025928 | Ga0207700_10041215 | Ga0207700_100412153 | 314 |
| 104 | 3300025928 | Ga0207700_10050630 | Ga0207700_100506302 | 314 |
| 105 | 3300025928 | Ga0207700_10138079 | Ga0207700_101380792 | 314 |
| 106 | 3300025938 | Ga0207704_10097466 | Ga0207704_100974662 | 314 |
| 107 | 3300050512 | nmdc:mga0n895_61999_c1 | nmdc:mga0n895_61999_c1_2300_3307 | 314 |
| 108 | 3300050513 | nmdc:mga0rr50_117639_c1 | nmdc:mga0rr50_117639_c1_193_1200 | 314 |
| 109 | 3300005441 | Ga0070700_100128137 | Ga0070700_1001281371 | 315 |
| 110 | 3300026075 | Ga0207708_10030991 | Ga0207708_100309915 | 315 |
| 111 | 3300005459 | Ga0068867_100162985 | Ga0068867_1001629852 | 317 |
| 112 | 3300005617 | Ga0068859_100223565 | Ga0068859_1002235652 | 317 |
| 113 | 3300006931 | Ga0097620_100223561 | Ga0097620_1002235612 | 317 |
| 114 | 3300007265 | Ga0099794_10008154 | Ga0099794_100081543 | 317 |
| 115 | 3300014326 | Ga0157380_10141361 | Ga0157380_101413612 | 317 |
| 116 | 3300028381 | Ga0268264_10386406 | Ga0268264_103864062 | 317 |
| 117 | 3300005578 | Ga0068854_100119855 | Ga0068854_1001198552 | 318 |
| 118 | 3300025911 | Ga0207654_10280572 | Ga0207654_102805721 | 318 |
| 119 | 3300025981 | Ga0207640_10106117 | Ga0207640_101061172 | 318 |
| 120 | 3300050513 | nmdc:mga0rr50_320949_c1 | nmdc:mga0rr50_320949_c1_166_1236 | 319 |
| 121 | 3300006880 | Ga0075429_100069492 | Ga0075429_1000694923 | 320 |
| 122 | 3300005471 | Ga0070698_100112982 | Ga0070698_1001129822 | 321 |
| 123 | 3300009176 | Ga0105242_10083372 | Ga0105242_100833722 | 321 |
| 124 | 3300005289 | Ga0065704_10016105 | Ga0065704_100161051 | 322 |
| 125 | 3300009148 | Ga0105243_10104732 | Ga0105243_101047322 | 322 |
| 126 | 3300021384 | Ga0213876_10000246 | Ga0213876_1000024618 | 322 |
| 127 | 3300025939 | Ga0207665_10101114 | Ga0207665_101011142 | 322 |
| 128 | 3300039437 | Ga0436365_0213934 | Ga0436365_0213934_23124_24218 | 322 |
| 129 | 3300005468 | Ga0070707_100027976 | Ga0070707_1000279763 | 323 |
| 130 | 3300005471 | Ga0070698_100034824 | Ga0070698_1000348243 | 323 |
| 131 | 3300005518 | Ga0070699_100016326 | Ga0070699_1000163262 | 323 |
| 132 | 3300005536 | Ga0070697_100083938 | Ga0070697_1000839382 | 323 |
| 133 | 3300025922 | Ga0207646_10137138 | Ga0207646_101371382 | 323 |
| 134 | 3300005843 | Ga0068860_100393755 | Ga0068860_1003937552 | 324 |
| 135 | 3300002459 | JGI24751J29686_10000006 | JGI24751J29686_1000000613 | 325 |
| 136 | 3300005331 | Ga0070670_100001299 | Ga0070670_10000129910 | 325 |
| 137 | 3300005331 | Ga0070670_100363454 | Ga0070670_1003634541 | 325 |
| 138 | 3300009093 | Ga0105240_10091039 | Ga0105240_100910393 | 325 |
| 139 | 3300014325 | Ga0163163_10001375 | Ga0163163_100013756 | 325 |
| 140 | 3300025913 | Ga0207695_10075557 | Ga0207695_100755573 | 325 |
| 141 | 3300025925 | Ga0207650_10000028 | Ga0207650_1000002898 | 325 |
| 142 | 3300005364 | Ga0070673_100254085 | Ga0070673_1002540852 | 326 |
| 143 | 3300007076 | Ga0075435_100003512 | Ga0075435_1000035128 | 326 |
| 144 | 3300013296 | Ga0157374_10281273 | Ga0157374_102812732 | 326 |
| 145 | 3300013308 | Ga0157375_10052563 | Ga0157375_100525633 | 326 |
| 146 | 3300014325 | Ga0163163_10003120 | Ga0163163_100031208 | 326 |
| 147 | 3300014969 | Ga0157376_10159990 | Ga0157376_101599902 | 326 |
| 148 | 3300025931 | Ga0207644_10104170 | Ga0207644_101041702 | 326 |
| 149 | 3300025960 | Ga0207651_10171607 | Ga0207651_101716072 | 326 |
| 150 | 3300050513 | nmdc:mga0rr50_10892_c1 | nmdc:mga0rr50_10892_c1_3660_4751 | 326 |
| 151 | 3300005336 | Ga0070680_100034160 | Ga0070680_1000341603 | 327 |
| 152 | 3300005339 | Ga0070660_100040792 | Ga0070660_1000407921 | 327 |
| 153 | 3300005344 | Ga0070661_100016994 | Ga0070661_1000169942 | 327 |
| 154 | 3300005366 | Ga0070659_100002910 | Ga0070659_1000029103 | 327 |
| 155 | 3300005458 | Ga0070681_10016366 | Ga0070681_100163666 | 327 |
| 156 | 3300005530 | Ga0070679_100009434 | Ga0070679_1000094344 | 327 |
| 157 | 3300005564 | Ga0070664_100004142 | Ga0070664_1000041427 | 327 |
| 158 | 3300005577 | Ga0068857_100002169 | Ga0068857_1000021696 | 327 |
| 159 | 3300005618 | Ga0068864_100010153 | Ga0068864_1000101533 | 327 |
| 160 | 3300013100 | Ga0157373_10013253 | Ga0157373_100132533 | 327 |
| 161 | 3300013307 | Ga0157372_10303292 | Ga0157372_103032922 | 327 |
| 162 | 3300025912 | Ga0207707_10002505 | Ga0207707_1000250511 | 327 |
| 163 | 3300025917 | Ga0207660_10014078 | Ga0207660_100140783 | 327 |
| 164 | 3300025921 | Ga0207652_10027592 | Ga0207652_100275922 | 327 |
| 165 | 3300025932 | Ga0207690_10005263 | Ga0207690_100052633 | 327 |
| 166 | 3300025933 | Ga0207706_10040184 | Ga0207706_100401843 | 327 |
| 167 | 3300025945 | Ga0207679_10001272 | Ga0207679_100012723 | 327 |
| 168 | 3300026116 | Ga0207674_10000790 | Ga0207674_1000079036 | 327 |
| 169 | 3300042004 | Ga0439445_0008770 | Ga0439445_0008770_1170_2279 | 327 |
| 170 | 3300042007 | Ga0439449_0070127 | Ga0439449_0070127_91_1200 | 327 |
| 171 | 3300050515 | nmdc:mga0a205_43157_c1 | nmdc:mga0a205_43157_c1_1504_2574 | 327 |
| 172 | 3300053083 | Ga0495655_0002356 | Ga0495655_0002356_742_1800 | 328 |
| 173 | 3300005518 | Ga0070699_100011249 | Ga0070699_1000112498 | 329 |
| 174 | 3300006173 | Ga0070716_100000013 | Ga0070716_10000001338 | 329 |
| 175 | 3300006844 | Ga0075428_100468001 | Ga0075428_1004680011 | 329 |
| 176 | 3300009176 | Ga0105242_10098338 | Ga0105242_100983383 | 329 |
| 177 | 3300025939 | Ga0207665_10000025 | Ga0207665_1000002538 | 329 |
| 178 | 3300050511 | nmdc:mga08y16_43825_c1 | nmdc:mga08y16_43825_c1_2950_4038 | 329 |
| 179 | 3300009147 | Ga0114129_10040166 | Ga0114129_100401664 | 330 |
| 180 | 3300005614 | Ga0068856_100201378 | Ga0068856_1002013782 | 331 |
| 181 | 3300026078 | Ga0207702_10156539 | Ga0207702_101565392 | 331 |
| 182 | 3300031731 | Ga0307405_10129856 | Ga0307405_101298561 | 332 |
| 183 | 3300031903 | Ga0307407_10058953 | Ga0307407_100589532 | 332 |
| 184 | 3300005536 | Ga0070697_100000466 | Ga0070697_1000004664 | 333 |
| 185 | 3300005549 | Ga0070704_100040301 | Ga0070704_1000403013 | 334 |
| 186 | 3300005347 | Ga0070668_100002227 | Ga0070668_1000022277 | 335 |
| 187 | 3300009553 | Ga0105249_10000369 | Ga0105249_1000036936 | 335 |
| 188 | 3300013306 | Ga0163162_10000019 | Ga0163162_10000019126 | 335 |
| 189 | 3300014326 | Ga0157380_10037083 | Ga0157380_100370833 | 335 |
| 190 | 3300025961 | Ga0207712_10000544 | Ga0207712_100005446 | 335 |
| 191 | 3300025972 | Ga0207668_10002854 | Ga0207668_100028549 | 335 |
| 192 | 3300026118 | Ga0207675_100335387 | Ga0207675_1003353871 | 335 |
| 193 | 3300003203 | JGI25406J46586_10003759 | JGI25406J46586_100037594 | 337 |
| 194 | 3300005334 | Ga0068869_100091550 | Ga0068869_1000915502 | 337 |
| 195 | 3300005985 | Ga0081539_10001310 | Ga0081539_100013109 | 337 |
| 196 | 3300006852 | Ga0075433_10058460 | Ga0075433_100584602 | 337 |
| 197 | 3300025942 | Ga0207689_10039881 | Ga0207689_100398814 | 337 |
| 198 | 3300045051 | Ga0451576_0063464 | Ga0451576_0063464_1138_2208 | 337 |
| 199 | 3300050515 | nmdc:mga0a205_18770_c1 | nmdc:mga0a205_18770_c1_2406_3476 | 337 |
| 200 | 3300005338 | Ga0068868_100062687 | Ga0068868_1000626874 | 338 |
| 201 | 3300005364 | Ga0070673_100012172 | Ga0070673_1000121725 | 338 |
| 202 | 3300005467 | Ga0070706_100016174 | Ga0070706_1000161744 | 338 |
| 203 | 3300005471 | Ga0070698_100030895 | Ga0070698_1000308953 | 338 |
| 204 | 3300005518 | Ga0070699_100001635 | Ga0070699_10000163510 | 338 |
| 205 | 3300005536 | Ga0070697_100045605 | Ga0070697_1000456053 | 338 |
| 206 | 3300005842 | Ga0068858_100010751 | Ga0068858_1000107511 | 338 |
| 207 | 3300006163 | Ga0070715_10000006 | Ga0070715_10000006143 | 338 |
| 208 | 3300006852 | Ga0075433_10084257 | Ga0075433_100842574 | 338 |
| 209 | 3300009147 | Ga0114129_10018348 | Ga0114129_100183484 | 338 |
| 210 | 3300009148 | Ga0105243_10000446 | Ga0105243_1000044623 | 338 |
| 211 | 3300009176 | Ga0105242_10000928 | Ga0105242_1000092811 | 338 |
| 212 | 3300013297 | Ga0157378_10000004 | Ga0157378_10000004123 | 338 |
| 213 | 3300013308 | Ga0157375_10003976 | Ga0157375_1000397610 | 338 |
| 214 | 3300025905 | Ga0207685_10000010 | Ga0207685_1000001048 | 338 |
| 215 | 3300025934 | Ga0207686_10003763 | Ga0207686_100037635 | 338 |
| 216 | 3300025935 | Ga0207709_10000718 | Ga0207709_1000071810 | 338 |
| 217 | 3300025960 | Ga0207651_10223929 | Ga0207651_102239291 | 338 |
| 218 | 3300026118 | Ga0207675_100015493 | Ga0207675_1000154938 | 338 |
| 219 | 3300026118 | Ga0207675_100449940 | Ga0207675_1004499401 | 338 |
| 220 | 3300032002 | Ga0307416_100171628 | Ga0307416_1001716282 | 338 |
| 221 | 3300048909 | Ga0496106_0012966 | Ga0496106_0012966_4887_5960 | 338 |
| 222 | 3300050507 | nmdc:mga05p37_5656_c1 | nmdc:mga05p37_5656_c1_7303_8376 | 338 |
| 223 | 3300002074 | JGI24748J21848_1000001 | JGI24748J21848_1000001306 | 339 |
| 224 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_10000001111 | 339 |
| 225 | 3300005842 | Ga0068858_100000051 | Ga0068858_10000005164 | 339 |
| 226 | 3300009101 | Ga0105247_10000004 | Ga0105247_10000004153 | 339 |
| 227 | 3300021384 | Ga0213876_10080200 | Ga0213876_100802002 | 339 |
| 228 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002860 | 339 |
| 229 | 3300025931 | Ga0207644_10001949 | Ga0207644_100019496 | 339 |
| 230 | 3300026035 | Ga0207703_10000114 | Ga0207703_1000011410 | 339 |
| 231 | 3300031456 | Ga0307513_10001475 | Ga0307513_100014758 | 339 |
| 232 | 3300039437 | Ga0436365_0543889 | Ga0436365_0543889_346_1479 | 339 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pc3-assembly1.cif.gz_A | crystal structure of the extracellular phosphate abc transport receptor (psts-1) and immunodominant antigen of m. tuberculosis. | 0.9459 | 32 | 333 |
| 5i84-assembly3.cif.gz_C | structure of the xanthomonas citri phosphate-binding protein phox | 0.9294 | 37 | 331 |
| 8ods-assembly1.cif.gz_A | phosphate-binding protein (psts) from xanthomonas citri pv. citri a306 bound to phosphate | 0.9287 | 36 | 331 |
| 5i84-assembly5.cif.gz_E | structure of the xanthomonas citri phosphate-binding protein phox | 0.927 | 37 | 331 |
| 1quj-assembly1.cif.gz_A | phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate | 0.9195 | 35 | 338 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYP6_33_111_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.932 | 36 | 100 | 3.40.190.10 |
| 4gd5B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9275 | 36 | 111 | 3.40.190.10 |
| af_P0AG82_103_278_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9248 | 115 | 271 | 3.40.190.10 |
| 1pc3B02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.923 | 114 | 271 | 3.40.190.10 |
| 1pc3B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9188 | 35 | 333 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8IH43-F1-model_v4 | Phosphate ABC transporter substrate-binding protein PstS | 0.9771 | 209 | 331 |
|
| AF-A0A1Q6YN43-F1-model_v4 | Phosphate ABC transporter substrate-binding protein PstS | 0.9738 | 35 | 331 |
GO:0035435
GO:0042301 GO:0043190 |
| AF-A0A3C1JPN0-F1-model_v4 | Phosphate ABC transporter substrate-binding protein PstS | 0.9718 | 73 | 339 |
GO:0035435
GO:0042301 GO:0043190 |
| AF-A0A3D3ZIF6-F1-model_v4 | Phosphate ABC transporter substrate-binding protein PstS | 0.9715 | 36 | 339 |
GO:0035435
GO:0042301 GO:0043190 |
| AF-A0A3L7YJ45-F1-model_v4 | Phosphate ABC transporter substrate-binding protein PstS | 0.9678 | 111 | 339 |
GO:0035435
GO:0042301 GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar