F345021
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 232 | 167 | 227 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10653769|Ga0105237_106537691 |
| Length | 253 |
| Sequence | MFAHVRQAFAQRGSHAPAHAVGCATSSKKSRAVAALPIVVLCSRRGSNLQALIDVTAAGALPISIRAVLSDRPGCEALERARDAGIATDAMRPRDFAGRREFDEALFARASDFDPALIVLAGYMRVIDDEVVRAWHGRMINIHPSLLPKHPGLHTHAGALDAGDAQHGASVHYVTPELDGGPVIAQVAMPIHAGDRPDDLAARLLPLEHRLLVASVALLAVGAVRLDGDQVLYRGSALAAPLQMDEHGTLRVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 2 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 3 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 4 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 5 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 39 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 48 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 93 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 95 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 96 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 97 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 98 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 99 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 100 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 101 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 102 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 103 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 104 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 110 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 111 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 112 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 113 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 114 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 115 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 116 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 117 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 118 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 119 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 120 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 121 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 122 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 123 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 124 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 125 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 126 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 127 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 134 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 135 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 136 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 138 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 139 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 140 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 141 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 142 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 143 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 144 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 145 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 146 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.69 |
| Metatranscriptomes | 2.16 |
| Isolates | 2.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 6.03 |
| Rhizosphere | 89.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055526_1000214 | 3300003771 | Bacteria | 50037 |
| 2 | Ga0070683_100597701 | 3300005329 | Bacteria | 1056 |
| 3 | Ga0070670_100153243 | 3300005331 | Bacteria | 1995 |
| 4 | Ga0068869_100049950 | 3300005334 | Bacteria | 3030 |
| 5 | Ga0070666_10002943 | 3300005335 | Bacteria | 10306 |
| 6 | Ga0068868_100049712 | 3300005338 | Bacteria | 3291 |
| 7 | Ga0070661_100064842 | 3300005344 | Bacteria | 2684 |
| 8 | Ga0070661_100099230 | 3300005344 | Bacteria | 2164 |
| 9 | Ga0070671_100096547 | 3300005355 | Bacteria | 2478 |
| 10 | Ga0070671_100339108 | 3300005355 | Bacteria | 1282 |
| 11 | Ga0070709_10232722 | 3300005434 | Bacteria | 1319 |
| 12 | Ga0070714_100015597 | 3300005435 | Bacteria | 6113 |
| 13 | Ga0070713_100338059 | 3300005436 | Bacteria | 1394 |
| 14 | Ga0070711_100001804 | 3300005439 | Bacteria | 11937 |
| 15 | Ga0070711_100103659 | 3300005439 | Bacteria | 2074 |
| 16 | Ga0070663_100006682 | 3300005455 | Bacteria | 6955 |
| 17 | Ga0070663_100070791 | 3300005455 | Bacteria | 2537 |
| 18 | Ga0070663_100114968 | 3300005455 | Bacteria | 2026 |
| 19 | Ga0070662_100009088 | 3300005457 | Bacteria | 6486 |
| 20 | Ga0070681_10005443 | 3300005458 | Bacteria | 12301 |
| 21 | Ga0070681_10015747 | 3300005458 | Bacteria | 7537 |
| 22 | Ga0068867_100028587 | 3300005459 | Bacteria | 4016 |
| 23 | Ga0070685_10036453 | 3300005466 | Bacteria | 2780 |
| 24 | Ga0070679_100352807 | 3300005530 | Bacteria | 1418 |
| 25 | Ga0070684_100233204 | 3300005535 | Bacteria | 1681 |
| 26 | Ga0070684_100477971 | 3300005535 | Bacteria | 1153 |
| 27 | Ga0068853_100707558 | 3300005539 | Bacteria | 961 |
| 28 | Ga0070672_100055147 | 3300005543 | Bacteria | 3113 |
| 29 | Ga0070665_100000618 | 3300005548 | Bacteria | 48757 |
| 30 | Ga0070665_100188396 | 3300005548 | Bacteria | 2064 |
| 31 | Ga0068855_100000430 | 3300005563 | Bacteria | 51996 |
| 32 | Ga0068855_100080191 | 3300005563 | Bacteria | 3785 |
| 33 | Ga0068856_100182204 | 3300005614 | Bacteria | 2114 |
| 34 | Ga0068856_100807826 | 3300005614 | Bacteria | 957 |
| 35 | Ga0068861_100600112 | 3300005719 | Bacteria | 1010 |
| 36 | Ga0068851_10000591 | 3300005834 | Bacteria | 15744 |
| 37 | Ga0068863_100142773 | 3300005841 | Bacteria | 2289 |
| 38 | Ga0068858_100002640 | 3300005842 | Bacteria | 18054 |
| 39 | Ga0070717_10057168 | 3300006028 | Bacteria | 3224 |
| 40 | Ga0070715_10037901 | 3300006163 | Bacteria | 1998 |
| 41 | Ga0070716_100072794 | 3300006173 | Bacteria | 2025 |
| 42 | Ga0070716_100157728 | 3300006173 | Bacteria | 1467 |
| 43 | Ga0070712_100016092 | 3300006175 | Bacteria | 4826 |
| 44 | Ga0075436_100106246 | 3300006914 | Bacteria | 1958 |
| 45 | Ga0075435_100074159 | 3300007076 | Bacteria | 2783 |
| 46 | Ga0105240_10002566 | 3300009093 | Bacteria | 29107 |
| 47 | Ga0105240_10003750 | 3300009093 | Bacteria | 23477 |
| 48 | Ga0105240_10011254 | 3300009093 | Bacteria | 12475 |
| 49 | Ga0105240_10014942 | 3300009093 | Bacteria | 10577 |
| 50 | Ga0105240_10215509 | 3300009093 | Bacteria | 2240 |
| 51 | Ga0105240_10245771 | 3300009093 | Bacteria | 2072 |
| 52 | Ga0105247_10217001 | 3300009101 | Bacteria | 1293 |
| 53 | Ga0105242_10439963 | 3300009176 | Bacteria | 1226 |
| 54 | Ga0105237_10016092 | 3300009545 | Bacteria | 7779 |
| 55 | Ga0105237_10037583 | 3300009545 | Bacteria | 4892 |
| 56 | Ga0105237_10177351 | 3300009545 | Bacteria | 2131 |
| 57 | Ga0105237_10653769 | 3300009545 | Bacteria | 1058 |
| 58 | Ga0105238_10005675 | 3300009551 | Bacteria | 12338 |
| 59 | Ga0105238_10253507 | 3300009551 | Bacteria | 1738 |
| 60 | Ga0105238_10410760 | 3300009551 | Bacteria | 1347 |
| 61 | Ga0105238_11475050 | 3300009551 | Unclassified | 708 |
| 62 | Ga0105249_10077023 | 3300009553 | Bacteria | 3092 |
| 63 | Ga0105249_11325455 | 3300009553 | Bacteria | 791 |
| 64 | Ga0105239_10262063 | 3300010375 | Bacteria | 1943 |
| 65 | Ga0105239_10333427 | 3300010375 | Bacteria | 1712 |
| 66 | Ga0105239_10457688 | 3300010375 | Archaea | 1448 |
| 67 | Ga0105239_10604778 | 3300010375 | Bacteria | 1251 |
| 68 | Ga0157316_1000485 | 3300012510 | Bacteria | 2104 |
| 69 | Ga0157327_1004147 | 3300012512 | Bacteria | 1108 |
| 70 | Ga0157373_10049935 | 3300013100 | Bacteria | 2980 |
| 71 | Ga0157371_10335841 | 3300013102 | Bacteria | 1098 |
| 72 | Ga0157370_10173046 | 3300013104 | Bacteria | 2007 |
| 73 | Ga0157374_10067028 | 3300013296 | Bacteria | 3374 |
| 74 | Ga0157372_10021715 | 3300013307 | Bacteria | 6939 |
| 75 | Ga0157372_10288548 | 3300013307 | Bacteria | 1908 |
| 76 | Ga0157375_10027444 | 3300013308 | Bacteria | 5321 |
| 77 | Ga0206354_11646683 | 3300020081 | Bacteria | 1115 |
| 78 | Ga0207656_10000662 | 3300025321 | Bacteria | 11286 |
| 79 | Ga0207710_10238884 | 3300025900 | Bacteria | 906 |
| 80 | Ga0207647_10000196 | 3300025904 | Bacteria | 49500 |
| 81 | Ga0207647_10000286 | 3300025904 | Bacteria | 41390 |
| 82 | Ga0207699_10035772 | 3300025906 | Bacteria | 2827 |
| 83 | Ga0207707_10000141 | 3300025912 | Bacteria | 74736 |
| 84 | Ga0207707_10103444 | 3300025912 | Bacteria | 2489 |
| 85 | Ga0207707_10348034 | 3300025912 | Bacteria | 1277 |
| 86 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 87 | Ga0207695_10024339 | 3300025913 | Bacteria | 6816 |
| 88 | Ga0207695_10033686 | 3300025913 | Bacteria | 5581 |
| 89 | Ga0207695_10072829 | 3300025913 | Bacteria | 3503 |
| 90 | Ga0207695_10077490 | 3300025913 | Bacteria | 3376 |
| 91 | Ga0207695_10083247 | 3300025913 | Bacteria | 3232 |
| 92 | Ga0207671_10037709 | 3300025914 | Bacteria | 3584 |
| 93 | Ga0207671_10376943 | 3300025914 | Bacteria | 1127 |
| 94 | Ga0207693_10023289 | 3300025915 | Bacteria | 4917 |
| 95 | Ga0207663_10009876 | 3300025916 | Bacteria | 5053 |
| 96 | Ga0207663_10187932 | 3300025916 | Bacteria | 1481 |
| 97 | Ga0207660_10024513 | 3300025917 | Bacteria | 4085 |
| 98 | Ga0207649_10093593 | 3300025920 | Bacteria | 1973 |
| 99 | Ga0207649_10237896 | 3300025920 | Bacteria | 1306 |
| 100 | Ga0207649_10264004 | 3300025920 | Bacteria | 1245 |
| 101 | Ga0207652_10277948 | 3300025921 | Bacteria | 1510 |
| 102 | Ga0207694_10000409 | 3300025924 | Bacteria | 39948 |
| 103 | Ga0207694_10001142 | 3300025924 | Bacteria | 23029 |
| 104 | Ga0207694_10180698 | 3300025924 | Bacteria | 1711 |
| 105 | Ga0207694_10314873 | 3300025924 | Unclassified | 1291 |
| 106 | Ga0207694_10326507 | 3300025924 | Bacteria | 1267 |
| 107 | Ga0207700_10018365 | 3300025928 | Bacteria | 4696 |
| 108 | Ga0207664_10039432 | 3300025929 | Bacteria | 3667 |
| 109 | Ga0207644_10188877 | 3300025931 | Bacteria | 1619 |
| 110 | Ga0207644_10815513 | 3300025931 | Bacteria | 781 |
| 111 | Ga0207706_10002151 | 3300025933 | Bacteria | 19257 |
| 112 | Ga0207704_10225078 | 3300025938 | Bacteria | 1391 |
| 113 | Ga0207665_10005401 | 3300025939 | Bacteria | 8534 |
| 114 | Ga0207665_10386097 | 3300025939 | Bacteria | 1064 |
| 115 | Ga0207691_10024395 | 3300025940 | Bacteria | 5687 |
| 116 | Ga0207689_10120212 | 3300025942 | Bacteria | 2161 |
| 117 | Ga0207661_10588923 | 3300025944 | Bacteria | 1020 |
| 118 | Ga0207667_10001582 | 3300025949 | Bacteria | 28630 |
| 119 | Ga0207667_10161143 | 3300025949 | Bacteria | 2307 |
| 120 | Ga0207651_10038277 | 3300025960 | Bacteria | 3151 |
| 121 | Ga0207712_10000745 | 3300025961 | Bacteria | 24662 |
| 122 | Ga0207640_10004096 | 3300025981 | Bacteria | 7875 |
| 123 | Ga0207658_10032024 | 3300025986 | Bacteria | 3738 |
| 124 | Ga0207658_10086383 | 3300025986 | Bacteria | 2419 |
| 125 | Ga0207703_10002027 | 3300026035 | Bacteria | 17888 |
| 126 | Ga0207639_10004144 | 3300026041 | Bacteria | 9759 |
| 127 | Ga0207678_10005813 | 3300026067 | Bacteria | 10994 |
| 128 | Ga0207678_10204920 | 3300026067 | Bacteria | 1687 |
| 129 | Ga0207702_10061641 | 3300026078 | Bacteria | 3200 |
| 130 | Ga0207702_10170539 | 3300026078 | Bacteria | 1995 |
| 131 | Ga0207641_10084679 | 3300026088 | Bacteria | 2761 |
| 132 | Ga0207648_10043696 | 3300026089 | Bacteria | 3933 |
| 133 | Ga0207676_10478397 | 3300026095 | Bacteria | 1179 |
| 134 | Ga0207675_100484757 | 3300026118 | Bacteria | 1229 |
| 135 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 136 | Ga0268266_10234751 | 3300028379 | Bacteria | 1690 |
| 137 | Ga0265334_10111693 | 3300028573 | Bacteria | 982 |
| 138 | Ga0265762_1040826 | 3300030760 | Bacteria | 908 |
| 139 | Ga0265340_10104002 | 3300031247 | Bacteria | 1318 |
| 140 | Ga0316575_10005667 | 3300031665 | Bacteria | 4458 |
| 141 | Ga0316579_10022095 | 3300031691 | Bacteria | 2842 |
| 142 | Ga0316576_10015862 | 3300031727 | Bacteria | 5069 |
| 143 | Ga0316576_10034070 | 3300031727 | Bacteria | 3629 |
| 144 | Ga0316578_10000604 | 3300031728 | Bacteria | 12544 |
| 145 | Ga0307516_10002541 | 3300031730 | Bacteria | 24287 |
| 146 | Ga0307516_10275875 | 3300031730 | Bacteria | 1365 |
| 147 | Ga0307405_10271333 | 3300031731 | Bacteria | 1272 |
| 148 | Ga0316583_10002467 | 3300032133 | Bacteria | 6427 |
| 149 | Ga0316585_10000415 | 3300032137 | Bacteria | 9913 |
| 150 | Ga0316580_10004657 | 3300032139 | Bacteria | 3983 |
| 151 | Ga0316580_10112038 | 3300032139 | Bacteria | 835 |
| 152 | Ga0316593_10025666 | 3300032168 | Bacteria | 1878 |
| 153 | Ga0316588_1009930 | 3300033528 | Bacteria | 1995 |
| 154 | Ga0316596_1001507 | 3300033541 | Bacteria | 4730 |
| 155 | Ga0373935_0304198 | 3300035692 | Bacteria | 1128 |
| 156 | Ga0373937_0176118 | 3300036401 | Bacteria | 2008 |
| 157 | Ga0316584_0008340 | 3300036712 | Bacteria | 7136 |
| 158 | Ga0316584_0387048 | 3300036712 | Bacteria | 998 |
| 159 | Ga0395899_0210271 | 3300037312 | Bacteria | 1352 |
| 160 | Ga0395900_0003528 | 3300037418 | Bacteria | 16838 |
| 161 | Ga0451841_0667588 | 3300041498 | Bacteria | 3428 |
| 162 | Ga0451849_0657031 | 3300041505 | Bacteria | 3275 |
| 163 | Ga0439448_0003999 | 3300042005 | Bacteria | 4140 |
| 164 | Ga0439450_024310 | 3300042008 | Bacteria | 1320 |
| 165 | Ga0439455_0032388 | 3300042012 | Bacteria | 1306 |
| 166 | Ga0466969_0000302 | 3300044656 | Bacteria | 27101 |
| 167 | Ga0466966_0001828 | 3300044684 | Bacteria | 13811 |
| 168 | Ga0466961_0000614 | 3300044693 | Bacteria | 22481 |
| 169 | Ga0466961_0078434 | 3300044693 | Bacteria | 2092 |
| 170 | Ga0466964_0000095 | 3300044706 | Bacteria | 21226 |
| 171 | Ga0466971_0000759 | 3300044719 | Bacteria | 12963 |
| 172 | Ga0466968_0030072 | 3300044735 | Unclassified | 2249 |
| 173 | Ga0466970_0000954 | 3300044765 | Bacteria | 13948 |
| 174 | Ga0466957_0003506 | 3300044842 | Bacteria | 8623 |
| 175 | Ga0466959_0003773 | 3300045049 | Bacteria | 10037 |
| 176 | Ga0466959_0035574 | 3300045049 | Bacteria | 3682 |
| 177 | Ga0466967_0223106 | 3300045976 | Bacteria | 1792 |
| 178 | Ga0495632_0000008 | 3300046519 | Bacteria | 294056 |
| 179 | Ga0495597_0004524 | 3300046542 | Bacteria | 7605 |
| 180 | Ga0495668_0026055 | 3300046616 | Bacteria | 3320 |
| 181 | Ga0495636_0059937 | 3300047318 | Bacteria | 1607 |
| 182 | Ga0495686_0000033 | 3300047472 | Bacteria | 342031 |
| 183 | Ga0496101_0176475 | 3300048904 | Bacteria | 1644 |
| 184 | Ga0496102_0240269 | 3300048905 | Bacteria | 1708 |
| 185 | Ga0496102_0242900 | 3300048905 | Bacteria | 1698 |
| 186 | Ga0496104_0678529 | 3300048907 | Bacteria | 938 |
| 187 | Ga0496105_0008058 | 3300048908 | Bacteria | 8188 |
| 188 | Ga0496108_0216448 | 3300048911 | Bacteria | 1663 |
| 189 | Ga0496110_0033486 | 3300048913 | Bacteria | 4444 |
| 190 | Ga0496111_0251887 | 3300048914 | Bacteria | 1310 |
| 191 | Ga0496113_0809085 | 3300048916 | Bacteria | 744 |
| 192 | Ga0496114_0003679 | 3300048917 | Bacteria | 11790 |
| 193 | Ga0496114_0324367 | 3300048917 | Bacteria | 1361 |
| 194 | Ga0496115_0004115 | 3300048918 | Bacteria | 10496 |
| 195 | Ga0496115_0246659 | 3300048918 | Bacteria | 1471 |
| 196 | Ga0496115_0311564 | 3300048918 | Bacteria | 1289 |
| 197 | Ga0496117_0152245 | 3300048920 | Bacteria | 1367 |
| 198 | Ga0496118_0003325 | 3300048921 | Bacteria | 20380 |
| 199 | Ga0496118_0017601 | 3300048921 | Bacteria | 6493 |
| 200 | Ga0496122_0163614 | 3300048925 | Bacteria | 1353 |
| 201 | Ga0496126_0649239 | 3300048929 | Bacteria | 826 |
| 202 | Ga0501031_0366105 | 3300049568 | Bacteria | 933 |
| 203 | Ga0501034_0023323 | 3300049571 | Bacteria | 6306 |
| 204 | Ga0501036_0018247 | 3300049572 | Bacteria | 5876 |
| 205 | Ga0501037_0072731 | 3300049573 | Bacteria | 2500 |
| 206 | Ga0501038_0069424 | 3300049574 | Bacteria | 2993 |
| 207 | Ga0501039_0122446 | 3300049575 | Bacteria | 2039 |
| 208 | Ga0501043_0017672 | 3300049579 | Bacteria | 5593 |
| 209 | Ga0501043_0596033 | 3300049579 | Bacteria | 817 |
| 210 | Ga0501046_0099841 | 3300049580 | Bacteria | 2228 |
| 211 | Ga0501046_0379631 | 3300049580 | Bacteria | 1023 |
| 212 | Ga0501047_0030513 | 3300049581 | Bacteria | 5196 |
| 213 | Ga0501067_0035948 | 3300049583 | Bacteria | 2751 |
| 214 | Ga0501070_0007690 | 3300049586 | Bacteria | 9142 |
| 215 | Ga0501073_0002738 | 3300049589 | Bacteria | 13213 |
| 216 | Ga0501074_0107703 | 3300049590 | Bacteria | 1995 |
| 217 | Ga0501079_0249183 | 3300049741 | Bacteria | 1388 |
| 218 | Ga0501080_0021101 | 3300049742 | Bacteria | 6029 |
| 219 | Ga0501035_0007365 | 3300049822 | Bacteria | 10284 |
| 220 | Ga0501035_0287347 | 3300049822 | Bacteria | 1388 |
| 221 | Ga0501044_0171266 | 3300049823 | Bacteria | 2142 |
| 222 | Ga0501044_0287339 | 3300049823 | Bacteria | 1577 |
| 223 | nmdc:mga08x19_86400_c1 | 3300050514 | Bacteria | 2065 |
| 224 | nmdc:mga0a205_449654_c1 | 3300050515 | Bacteria | 1148 |
| 225 | Ga0501084_0144591 | 3300054114 | Bacteria | 2003 |
| 226 | Ga0501082_0433190 | 3300060353 | Bacteria | 1148 |
| 227 | Ga0466962_0000111 | 3300061719 | Bacteria | 33174 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042012 | Ga0439455_0032388 | Ga0439455_0032388_28_597 | 187 |
| 2 | 3300005439 | Ga0070711_100001804 | Ga0070711_10000180412 | 191 |
| 3 | 3300025916 | Ga0207663_10009876 | Ga0207663_100098765 | 191 |
| 4 | 3300025928 | Ga0207700_10018365 | Ga0207700_100183655 | 191 |
| 5 | 3300005344 | Ga0070661_100099230 | Ga0070661_1000992303 | 198 |
| 6 | 3300009093 | Ga0105240_10014942 | Ga0105240_100149426 | 198 |
| 7 | 3300010375 | Ga0105239_10333427 | Ga0105239_103334272 | 198 |
| 8 | 3300025913 | Ga0207695_10083247 | Ga0207695_100832473 | 198 |
| 9 | 3300025920 | Ga0207649_10093593 | Ga0207649_100935932 | 198 |
| 10 | 3300046542 | Ga0495597_0004524 | Ga0495597_0004524_2659_3261 | 198 |
| 11 | 3300031247 | Ga0265340_10104002 | Ga0265340_101040021 | 199 |
| 12 | 3300025920 | Ga0207649_10237896 | Ga0207649_102378963 | 201 |
| 13 | 3300042005 | Ga0439448_0003999 | Ga0439448_0003999_629_1240 | 201 |
| 14 | 3300042008 | Ga0439450_024310 | Ga0439450_024310_97_708 | 201 |
| 15 | 3300009101 | Ga0105247_10217001 | Ga0105247_102170011 | 203 |
| 16 | 3300009551 | Ga0105238_11475050 | Ga0105238_114750501 | 203 |
| 17 | 3300025900 | Ga0207710_10238884 | Ga0207710_102388841 | 203 |
| 18 | 3300031727 | Ga0316576_10015862 | Ga0316576_100158623 | 204 |
| 19 | 3300032133 | Ga0316583_10002467 | Ga0316583_100024675 | 204 |
| 20 | 3300033528 | Ga0316588_1009930 | Ga0316588_10099302 | 204 |
| 21 | 3300005455 | Ga0070663_100006682 | Ga0070663_1000066829 | 205 |
| 22 | 3300025938 | Ga0207704_10225078 | Ga0207704_102250782 | 205 |
| 23 | 3300026067 | Ga0207678_10005813 | Ga0207678_100058136 | 205 |
| 24 | 3300005331 | Ga0070670_100153243 | Ga0070670_1001532433 | 206 |
| 25 | 3300005344 | Ga0070661_100064842 | Ga0070661_1000648423 | 206 |
| 26 | 3300005355 | Ga0070671_100339108 | Ga0070671_1003391081 | 206 |
| 27 | 3300005459 | Ga0068867_100028587 | Ga0068867_1000285874 | 206 |
| 28 | 3300005548 | Ga0070665_100000618 | Ga0070665_10000061834 | 206 |
| 29 | 3300005563 | Ga0068855_100080191 | Ga0068855_1000801912 | 206 |
| 30 | 3300005614 | Ga0068856_100807826 | Ga0068856_1008078261 | 206 |
| 31 | 3300005842 | Ga0068858_100002640 | Ga0068858_10000264011 | 206 |
| 32 | 3300009093 | Ga0105240_10245771 | Ga0105240_102457712 | 206 |
| 33 | 3300009551 | Ga0105238_10005675 | Ga0105238_100056759 | 206 |
| 34 | 3300013104 | Ga0157370_10173046 | Ga0157370_101730462 | 206 |
| 35 | 3300013307 | Ga0157372_10021715 | Ga0157372_100217154 | 206 |
| 36 | 3300025904 | Ga0207647_10000286 | Ga0207647_100002869 | 206 |
| 37 | 3300025913 | Ga0207695_10024339 | Ga0207695_100243396 | 206 |
| 38 | 3300025914 | Ga0207671_10037709 | Ga0207671_100377092 | 206 |
| 39 | 3300025920 | Ga0207649_10264004 | Ga0207649_102640042 | 206 |
| 40 | 3300025924 | Ga0207694_10001142 | Ga0207694_1000114214 | 206 |
| 41 | 3300025931 | Ga0207644_10188877 | Ga0207644_101888773 | 206 |
| 42 | 3300025949 | Ga0207667_10161143 | Ga0207667_101611432 | 206 |
| 43 | 3300026035 | Ga0207703_10002027 | Ga0207703_1000202711 | 206 |
| 44 | 3300026041 | Ga0207639_10004144 | Ga0207639_100041449 | 206 |
| 45 | 3300026078 | Ga0207702_10061641 | Ga0207702_100616414 | 206 |
| 46 | 3300026089 | Ga0207648_10043696 | Ga0207648_100436963 | 206 |
| 47 | 3300028379 | Ga0268266_10000013 | Ga0268266_1000001395 | 206 |
| 48 | 3300046519 | Ga0495632_0000008 | Ga0495632_0000008_229551_230189 | 206 |
| 49 | 3300047472 | Ga0495686_0000033 | Ga0495686_0000033_44324_44959 | 206 |
| 50 | 3300048905 | Ga0496102_0240269 | Ga0496102_0240269_224_859 | 206 |
| 51 | 3300048920 | Ga0496117_0152245 | Ga0496117_0152245_650_1285 | 206 |
| 52 | 3300048921 | Ga0496118_0003325 | Ga0496118_0003325_18860_19495 | 206 |
| 53 | 3300048925 | Ga0496122_0163614 | Ga0496122_0163614_473_1108 | 206 |
| 54 | 3300031665 | Ga0316575_10005667 | Ga0316575_100056672 | 207 |
| 55 | 3300031691 | Ga0316579_10022095 | Ga0316579_100220952 | 207 |
| 56 | 3300031728 | Ga0316578_10000604 | Ga0316578_1000060411 | 207 |
| 57 | 3300032137 | Ga0316585_10000415 | Ga0316585_100004158 | 207 |
| 58 | 3300032139 | Ga0316580_10004657 | Ga0316580_100046573 | 207 |
| 59 | 3300032168 | Ga0316593_10025666 | Ga0316593_100256662 | 207 |
| 60 | 3300033541 | Ga0316596_1001507 | Ga0316596_10015072 | 207 |
| 61 | 3300036712 | Ga0316584_0387048 | Ga0316584_0387048_133_765 | 207 |
| 62 | 3300035692 | Ga0373935_0304198 | Ga0373935_0304198_356_1018 | 209 |
| 63 | 3300036401 | Ga0373937_0176118 | Ga0373937_0176118_844_1506 | 209 |
| 64 | 3300048907 | Ga0496104_0678529 | Ga0496104_0678529_226_888 | 209 |
| 65 | 3300048917 | Ga0496114_0003679 | Ga0496114_0003679_535_1197 | 209 |
| 66 | 3300045976 | Ga0466967_0223106 | Ga0466967_0223106_389_1054 | 210 |
| 67 | 3300048908 | Ga0496105_0008058 | Ga0496105_0008058_7512_8174 | 210 |
| 68 | 3300048918 | Ga0496115_0004115 | Ga0496115_0004115_973_1635 | 210 |
| 69 | 3300036712 | Ga0316584_0008340 | Ga0316584_0008340_3154_3798 | 211 |
| 70 | 3300041498 | Ga0451841_0667588 | Ga0451841_0667588_2030_2692 | 212 |
| 71 | 3300041505 | Ga0451849_0657031 | Ga0451849_0657031_664_1326 | 212 |
| 72 | 3300005434 | Ga0070709_10232722 | Ga0070709_102327222 | 213 |
| 73 | 3300005435 | Ga0070714_100015597 | Ga0070714_1000155972 | 213 |
| 74 | 3300005436 | Ga0070713_100338059 | Ga0070713_1003380592 | 213 |
| 75 | 3300005614 | Ga0068856_100182204 | Ga0068856_1001822042 | 213 |
| 76 | 3300006028 | Ga0070717_10057168 | Ga0070717_100571683 | 213 |
| 77 | 3300006173 | Ga0070716_100157728 | Ga0070716_1001577282 | 213 |
| 78 | 3300006914 | Ga0075436_100106246 | Ga0075436_1001062462 | 213 |
| 79 | 3300007076 | Ga0075435_100074159 | Ga0075435_1000741593 | 213 |
| 80 | 3300025904 | Ga0207647_10000196 | Ga0207647_1000019625 | 213 |
| 81 | 3300025906 | Ga0207699_10035772 | Ga0207699_100357722 | 213 |
| 82 | 3300025929 | Ga0207664_10039432 | Ga0207664_100394322 | 213 |
| 83 | 3300025939 | Ga0207665_10386097 | Ga0207665_103860972 | 213 |
| 84 | 3300026078 | Ga0207702_10170539 | Ga0207702_101705392 | 213 |
| 85 | 3300048904 | Ga0496101_0176475 | Ga0496101_0176475_206_868 | 213 |
| 86 | 3300048918 | Ga0496115_0246659 | Ga0496115_0246659_512_1174 | 213 |
| 87 | 3300050514 | nmdc:mga08x19_86400_c1 | nmdc:mga08x19_86400_c1_809_1471 | 213 |
| 88 | 3300050515 | nmdc:mga0a205_449654_c1 | nmdc:mga0a205_449654_c1_344_1006 | 213 |
| 89 | iso_pu_bacteria | 2818991457 | 2819660676 | 213 |
| 90 | 3300005439 | Ga0070711_100103659 | Ga0070711_1001036592 | 214 |
| 91 | 3300006163 | Ga0070715_10037901 | Ga0070715_100379012 | 214 |
| 92 | 3300006173 | Ga0070716_100072794 | Ga0070716_1000727944 | 214 |
| 93 | 3300006175 | Ga0070712_100016092 | Ga0070712_1000160925 | 214 |
| 94 | 3300025915 | Ga0207693_10023289 | Ga0207693_100232895 | 214 |
| 95 | 3300025916 | Ga0207663_10187932 | Ga0207663_101879322 | 214 |
| 96 | 3300025931 | Ga0207644_10815513 | Ga0207644_108155131 | 214 |
| 97 | 3300025939 | Ga0207665_10005401 | Ga0207665_100054014 | 214 |
| 98 | 3300031727 | Ga0316576_10034070 | Ga0316576_100340702 | 214 |
| 99 | 3300005335 | Ga0070666_10002943 | Ga0070666_100029433 | 215 |
| 100 | 3300005338 | Ga0068868_100049712 | Ga0068868_1000497122 | 215 |
| 101 | 3300005457 | Ga0070662_100009088 | Ga0070662_1000090888 | 215 |
| 102 | 3300005834 | Ga0068851_10000591 | Ga0068851_100005919 | 215 |
| 103 | 3300005841 | Ga0068863_100142773 | Ga0068863_1001427733 | 215 |
| 104 | 3300009176 | Ga0105242_10439963 | Ga0105242_104399632 | 215 |
| 105 | 3300009553 | Ga0105249_10077023 | Ga0105249_100770232 | 215 |
| 106 | 3300010375 | Ga0105239_10262063 | Ga0105239_102620633 | 215 |
| 107 | 3300025321 | Ga0207656_10000662 | Ga0207656_100006628 | 215 |
| 108 | 3300025933 | Ga0207706_10002151 | Ga0207706_1000215111 | 215 |
| 109 | 3300025961 | Ga0207712_10000745 | Ga0207712_1000074523 | 215 |
| 110 | 3300025981 | Ga0207640_10004096 | Ga0207640_1000409610 | 215 |
| 111 | 3300025986 | Ga0207658_10032024 | Ga0207658_100320243 | 215 |
| 112 | 3300025986 | Ga0207658_10086383 | Ga0207658_100863832 | 215 |
| 113 | 3300037312 | Ga0395899_0210271 | Ga0395899_0210271_632_1285 | 215 |
| 114 | 3300049568 | Ga0501031_0366105 | Ga0501031_0366105_194_856 | 215 |
| 115 | 3300049579 | Ga0501043_0596033 | Ga0501043_0596033_64_726 | 215 |
| 116 | 3300049580 | Ga0501046_0379631 | Ga0501046_0379631_37_699 | 215 |
| 117 | 3300049822 | Ga0501035_0287347 | Ga0501035_0287347_650_1312 | 215 |
| 118 | 3300005458 | Ga0070681_10005443 | Ga0070681_100054436 | 216 |
| 119 | 3300025912 | Ga0207707_10000141 | Ga0207707_1000014120 | 216 |
| 120 | 3300032139 | Ga0316580_10112038 | Ga0316580_101120382 | 216 |
| 121 | 3300005329 | Ga0070683_100597701 | Ga0070683_1005977011 | 217 |
| 122 | 3300005355 | Ga0070671_100096547 | Ga0070671_1000965473 | 217 |
| 123 | 3300005455 | Ga0070663_100070791 | Ga0070663_1000707912 | 217 |
| 124 | 3300005458 | Ga0070681_10015747 | Ga0070681_100157477 | 217 |
| 125 | 3300005535 | Ga0070684_100233204 | Ga0070684_1002332041 | 217 |
| 126 | 3300005719 | Ga0068861_100600112 | Ga0068861_1006001122 | 217 |
| 127 | 3300009551 | Ga0105238_10410760 | Ga0105238_104107602 | 217 |
| 128 | 3300009553 | Ga0105249_11325455 | Ga0105249_113254551 | 217 |
| 129 | 3300012510 | Ga0157316_1000485 | Ga0157316_10004852 | 217 |
| 130 | 3300012512 | Ga0157327_1004147 | Ga0157327_10041471 | 217 |
| 131 | 3300013100 | Ga0157373_10049935 | Ga0157373_100499353 | 217 |
| 132 | 3300025912 | Ga0207707_10103444 | Ga0207707_101034442 | 217 |
| 133 | 3300025917 | Ga0207660_10024513 | Ga0207660_100245133 | 217 |
| 134 | 3300025924 | Ga0207694_10180698 | Ga0207694_101806981 | 217 |
| 135 | 3300025924 | Ga0207694_10314873 | Ga0207694_103148732 | 217 |
| 136 | 3300025944 | Ga0207661_10588923 | Ga0207661_105889232 | 217 |
| 137 | 3300025960 | Ga0207651_10038277 | Ga0207651_100382773 | 217 |
| 138 | 3300026067 | Ga0207678_10204920 | Ga0207678_102049202 | 217 |
| 139 | 3300026088 | Ga0207641_10084679 | Ga0207641_100846793 | 217 |
| 140 | 3300026095 | Ga0207676_10478397 | Ga0207676_104783972 | 217 |
| 141 | 3300026118 | Ga0207675_100484757 | Ga0207675_1004847572 | 217 |
| 142 | 3300031730 | Ga0307516_10275875 | Ga0307516_102758751 | 217 |
| 143 | 3300047318 | Ga0495636_0059937 | Ga0495636_0059937_648_1301 | 217 |
| 144 | 3300048905 | Ga0496102_0242900 | Ga0496102_0242900_405_1058 | 217 |
| 145 | 3300048911 | Ga0496108_0216448 | Ga0496108_0216448_56_709 | 217 |
| 146 | 3300048913 | Ga0496110_0033486 | Ga0496110_0033486_522_1175 | 217 |
| 147 | 3300048914 | Ga0496111_0251887 | Ga0496111_0251887_20_673 | 217 |
| 148 | 3300048916 | Ga0496113_0809085 | Ga0496113_0809085_59_712 | 217 |
| 149 | 3300048917 | Ga0496114_0324367 | Ga0496114_0324367_649_1302 | 217 |
| 150 | 3300048918 | Ga0496115_0311564 | Ga0496115_0311564_337_1008 | 217 |
| 151 | 3300049586 | Ga0501070_0007690 | Ga0501070_0007690_3650_4312 | 217 |
| 152 | 3300005539 | Ga0068853_100707558 | Ga0068853_1007075581 | 218 |
| 153 | 3300005548 | Ga0070665_100188396 | Ga0070665_1001883962 | 218 |
| 154 | 3300005563 | Ga0068855_100000430 | Ga0068855_10000043025 | 218 |
| 155 | 3300009093 | Ga0105240_10002566 | Ga0105240_100025665 | 218 |
| 156 | 3300009545 | Ga0105237_10037583 | Ga0105237_100375836 | 218 |
| 157 | 3300009551 | Ga0105238_10253507 | Ga0105238_102535071 | 218 |
| 158 | 3300010375 | Ga0105239_10604778 | Ga0105239_106047782 | 218 |
| 159 | 3300025913 | Ga0207695_10077490 | Ga0207695_100774903 | 218 |
| 160 | 3300025924 | Ga0207694_10326507 | Ga0207694_103265072 | 218 |
| 161 | 3300025949 | Ga0207667_10001582 | Ga0207667_1000158220 | 218 |
| 162 | 3300028379 | Ga0268266_10234751 | Ga0268266_102347512 | 218 |
| 163 | 3300044693 | Ga0466961_0078434 | Ga0466961_0078434_641_1318 | 218 |
| 164 | 3300044735 | Ga0466968_0030072 | Ga0466968_0030072_1237_1914 | 218 |
| 165 | 3300045049 | Ga0466959_0035574 | Ga0466959_0035574_2785_3462 | 218 |
| 166 | 3300005455 | Ga0070663_100114968 | Ga0070663_1001149682 | 219 |
| 167 | 3300005466 | Ga0070685_10036453 | Ga0070685_100364532 | 219 |
| 168 | 3300009093 | Ga0105240_10003750 | Ga0105240_100037502 | 219 |
| 169 | 3300009545 | Ga0105237_10016092 | Ga0105237_100160923 | 219 |
| 170 | 3300025913 | Ga0207695_10000014 | Ga0207695_10000014599 | 219 |
| 171 | 3300030760 | Ga0265762_1040826 | Ga0265762_10408262 | 219 |
| 172 | 3300044656 | Ga0466969_0000302 | Ga0466969_0000302_6580_7260 | 219 |
| 173 | 3300044684 | Ga0466966_0001828 | Ga0466966_0001828_3124_3804 | 219 |
| 174 | 3300044693 | Ga0466961_0000614 | Ga0466961_0000614_11567_12247 | 219 |
| 175 | 3300044706 | Ga0466964_0000095 | Ga0466964_0000095_20264_20944 | 219 |
| 176 | 3300044719 | Ga0466971_0000759 | Ga0466971_0000759_7139_7819 | 219 |
| 177 | 3300044765 | Ga0466970_0000954 | Ga0466970_0000954_7022_7702 | 219 |
| 178 | 3300044842 | Ga0466957_0003506 | Ga0466957_0003506_1026_1706 | 219 |
| 179 | 3300045049 | Ga0466959_0003773 | Ga0466959_0003773_6580_7260 | 219 |
| 180 | 3300046616 | Ga0495668_0026055 | Ga0495668_0026055_1211_1876 | 219 |
| 181 | 3300048921 | Ga0496118_0017601 | Ga0496118_0017601_4355_5047 | 219 |
| 182 | 3300061719 | Ga0466962_0000111 | Ga0466962_0000111_21056_21736 | 219 |
| 183 | 3300025914 | Ga0207671_10376943 | Ga0207671_103769432 | 220 |
| 184 | 3300025924 | Ga0207694_10000409 | Ga0207694_1000040917 | 220 |
| 185 | iso_pu_bacteria | 2895498888 | 2895499077 | 220 |
| 186 | iso_pu_bacteria | 2895511927 | 2895512096 | 220 |
| 187 | iso_pu_bacteria | 2895522137 | 2895523249 | 220 |
| 188 | iso_pu_bacteria | 2895525241 | 2895528042 | 220 |
| 189 | 3300005530 | Ga0070679_100352807 | Ga0070679_1003528071 | 221 |
| 190 | 3300005535 | Ga0070684_100477971 | Ga0070684_1004779712 | 221 |
| 191 | 3300009093 | Ga0105240_10215509 | Ga0105240_102155092 | 221 |
| 192 | 3300009545 | Ga0105237_10177351 | Ga0105237_101773511 | 221 |
| 193 | 3300009545 | Ga0105237_10653769 | Ga0105237_106537691 | 221 |
| 194 | 3300013102 | Ga0157371_10335841 | Ga0157371_103358412 | 221 |
| 195 | 3300013307 | Ga0157372_10288548 | Ga0157372_102885482 | 221 |
| 196 | 3300020081 | Ga0206354_11646683 | Ga0206354_116466832 | 221 |
| 197 | 3300025912 | Ga0207707_10348034 | Ga0207707_103480342 | 221 |
| 198 | 3300025913 | Ga0207695_10072829 | Ga0207695_100728292 | 221 |
| 199 | 3300025921 | Ga0207652_10277948 | Ga0207652_102779482 | 221 |
| 200 | 3300028573 | Ga0265334_10111693 | Ga0265334_101116932 | 221 |
| 201 | 3300037418 | Ga0395900_0003528 | Ga0395900_0003528_7745_8449 | 221 |
| 202 | 3300048929 | Ga0496126_0649239 | Ga0496126_0649239_12_692 | 221 |
| 203 | 3300049823 | Ga0501044_0287339 | Ga0501044_0287339_53_757 | 221 |
| 204 | 3300013296 | Ga0157374_10067028 | Ga0157374_100670282 | 222 |
| 205 | 3300049741 | Ga0501079_0249183 | Ga0501079_0249183_637_1317 | 222 |
| 206 | 3300005334 | Ga0068869_100049950 | Ga0068869_1000499503 | 223 |
| 207 | 3300009093 | Ga0105240_10011254 | Ga0105240_100112546 | 223 |
| 208 | 3300025913 | Ga0207695_10033686 | Ga0207695_100336866 | 223 |
| 209 | 3300025942 | Ga0207689_10120212 | Ga0207689_101202122 | 223 |
| 210 | 3300031730 | Ga0307516_10002541 | Ga0307516_1000254114 | 224 |
| 211 | 3300005543 | Ga0070672_100055147 | Ga0070672_1000551472 | 225 |
| 212 | 3300010375 | Ga0105239_10457688 | Ga0105239_104576882 | 225 |
| 213 | 3300013308 | Ga0157375_10027444 | Ga0157375_100274443 | 225 |
| 214 | 3300025940 | Ga0207691_10024395 | Ga0207691_100243955 | 225 |
| 215 | 3300031731 | Ga0307405_10271333 | Ga0307405_102713332 | 226 |
| 216 | 3300049571 | Ga0501034_0023323 | Ga0501034_0023323_3301_3999 | 226 |
| 217 | 3300049572 | Ga0501036_0018247 | Ga0501036_0018247_840_1538 | 226 |
| 218 | 3300049573 | Ga0501037_0072731 | Ga0501037_0072731_503_1201 | 226 |
| 219 | 3300049574 | Ga0501038_0069424 | Ga0501038_0069424_2012_2710 | 226 |
| 220 | 3300049575 | Ga0501039_0122446 | Ga0501039_0122446_796_1494 | 226 |
| 221 | 3300049579 | Ga0501043_0017672 | Ga0501043_0017672_3785_4483 | 226 |
| 222 | 3300049580 | Ga0501046_0099841 | Ga0501046_0099841_648_1346 | 226 |
| 223 | 3300049581 | Ga0501047_0030513 | Ga0501047_0030513_4072_4770 | 226 |
| 224 | 3300049583 | Ga0501067_0035948 | Ga0501067_0035948_878_1576 | 226 |
| 225 | 3300049589 | Ga0501073_0002738 | Ga0501073_0002738_8128_8826 | 226 |
| 226 | 3300049590 | Ga0501074_0107703 | Ga0501074_0107703_563_1261 | 226 |
| 227 | 3300049742 | Ga0501080_0021101 | Ga0501080_0021101_306_1004 | 226 |
| 228 | 3300049822 | Ga0501035_0007365 | Ga0501035_0007365_620_1318 | 226 |
| 229 | 3300049823 | Ga0501044_0171266 | Ga0501044_0171266_1139_1837 | 226 |
| 230 | 3300054114 | Ga0501084_0144591 | Ga0501084_0144591_786_1484 | 226 |
| 231 | 3300060353 | Ga0501082_0433190 | Ga0501082_0433190_339_1037 | 226 |
| 232 | 3300003771 | Ga0055526_1000214 | Ga0055526_100021429 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c2t-assembly1.cif.gz_A | new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. | 0.9619 | 7 | 207 |
| 3auf-assembly1.cif.gz_A-2 | crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii | 0.9584 | 5 | 201 |
| 3gar-assembly1.cif.gz_A-2 | a ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase | 0.9565 | 7 | 206 |
| 3p9x-assembly1.cif.gz_B | crystal structure of phosphoribosylglycinamide formyltransferase from bacillus halodurans | 0.9496 | 7 | 190 |
| 3av3-assembly1.cif.gz_A | crystal structure of glycinamide ribonucleotide transformylase 1 from geobacillus kaustophilus | 0.9467 | 4 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3aufA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9584 | 5 | 201 | 3.40.50.170 |
| af_Q2FZI7_1_188_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9388 | 5 | 185 | 3.40.50.170 |
| 3av3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9372 | 6 | 186 | 3.40.50.170 |
| af_Q20143_783_975_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9269 | 5 | 188 | 3.40.50.170 |
| 4s1nA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9258 | 7 | 180 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A246F2T8-F1-model_v4 | phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) | 0.9796 | 111 | 201 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A2V6BKH7-F1-model_v4 | phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) | 0.9793 | 86 | 189 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A357KNQ0-F1-model_v4 | phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) | 0.9779 | 103 | 212 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A3A5UVQ9-F1-model_v4 | phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) | 0.9773 | 78 | 190 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A3B8PAS2-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) | 0.9752 | 62 | 206 |
GO:0004644
GO:0005829 GO:0006189 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar