F345021

General Info

Members Datasets Scaffolds Average Seq Length
232 167 227 220

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10653769|Ga0105237_106537691
Length 253
Sequence MFAHVRQAFAQRGSHAPAHAVGCATSSKKSRAVAALPIVVLCSRRGSNLQALIDVTAAGALPISIRAVLSDRPGCEALERARDAGIATDAMRPRDFAGRREFDEALFARASDFDPALIVLAGYMRVIDDEVVRAWHGRMINIHPSLLPKHPGLHTHAGALDAGDAQHGASVHYVTPELDGGPVIAQVAMPIHAGDRPDDLAARLLPLEHRLLVASVALLAVGAVRLDGDQVLYRGSALAAPLQMDEHGTLRVG

Samples

Sample ID Description Type Environment
1 2818991457 Xanthomonas translucens 569 Isolate Unclassified
2 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
3 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
4 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
5 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
48 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
102 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
103 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
104 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
113 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
116 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.69
Metatranscriptomes 2.16
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 6.03
Rhizosphere 89.22
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1000214 3300003771 Bacteria 50037
2 Ga0070683_100597701 3300005329 Bacteria 1056
3 Ga0070670_100153243 3300005331 Bacteria 1995
4 Ga0068869_100049950 3300005334 Bacteria 3030
5 Ga0070666_10002943 3300005335 Bacteria 10306
6 Ga0068868_100049712 3300005338 Bacteria 3291
7 Ga0070661_100064842 3300005344 Bacteria 2684
8 Ga0070661_100099230 3300005344 Bacteria 2164
9 Ga0070671_100096547 3300005355 Bacteria 2478
10 Ga0070671_100339108 3300005355 Bacteria 1282
11 Ga0070709_10232722 3300005434 Bacteria 1319
12 Ga0070714_100015597 3300005435 Bacteria 6113
13 Ga0070713_100338059 3300005436 Bacteria 1394
14 Ga0070711_100001804 3300005439 Bacteria 11937
15 Ga0070711_100103659 3300005439 Bacteria 2074
16 Ga0070663_100006682 3300005455 Bacteria 6955
17 Ga0070663_100070791 3300005455 Bacteria 2537
18 Ga0070663_100114968 3300005455 Bacteria 2026
19 Ga0070662_100009088 3300005457 Bacteria 6486
20 Ga0070681_10005443 3300005458 Bacteria 12301
21 Ga0070681_10015747 3300005458 Bacteria 7537
22 Ga0068867_100028587 3300005459 Bacteria 4016
23 Ga0070685_10036453 3300005466 Bacteria 2780
24 Ga0070679_100352807 3300005530 Bacteria 1418
25 Ga0070684_100233204 3300005535 Bacteria 1681
26 Ga0070684_100477971 3300005535 Bacteria 1153
27 Ga0068853_100707558 3300005539 Bacteria 961
28 Ga0070672_100055147 3300005543 Bacteria 3113
29 Ga0070665_100000618 3300005548 Bacteria 48757
30 Ga0070665_100188396 3300005548 Bacteria 2064
31 Ga0068855_100000430 3300005563 Bacteria 51996
32 Ga0068855_100080191 3300005563 Bacteria 3785
33 Ga0068856_100182204 3300005614 Bacteria 2114
34 Ga0068856_100807826 3300005614 Bacteria 957
35 Ga0068861_100600112 3300005719 Bacteria 1010
36 Ga0068851_10000591 3300005834 Bacteria 15744
37 Ga0068863_100142773 3300005841 Bacteria 2289
38 Ga0068858_100002640 3300005842 Bacteria 18054
39 Ga0070717_10057168 3300006028 Bacteria 3224
40 Ga0070715_10037901 3300006163 Bacteria 1998
41 Ga0070716_100072794 3300006173 Bacteria 2025
42 Ga0070716_100157728 3300006173 Bacteria 1467
43 Ga0070712_100016092 3300006175 Bacteria 4826
44 Ga0075436_100106246 3300006914 Bacteria 1958
45 Ga0075435_100074159 3300007076 Bacteria 2783
46 Ga0105240_10002566 3300009093 Bacteria 29107
47 Ga0105240_10003750 3300009093 Bacteria 23477
48 Ga0105240_10011254 3300009093 Bacteria 12475
49 Ga0105240_10014942 3300009093 Bacteria 10577
50 Ga0105240_10215509 3300009093 Bacteria 2240
51 Ga0105240_10245771 3300009093 Bacteria 2072
52 Ga0105247_10217001 3300009101 Bacteria 1293
53 Ga0105242_10439963 3300009176 Bacteria 1226
54 Ga0105237_10016092 3300009545 Bacteria 7779
55 Ga0105237_10037583 3300009545 Bacteria 4892
56 Ga0105237_10177351 3300009545 Bacteria 2131
57 Ga0105237_10653769 3300009545 Bacteria 1058
58 Ga0105238_10005675 3300009551 Bacteria 12338
59 Ga0105238_10253507 3300009551 Bacteria 1738
60 Ga0105238_10410760 3300009551 Bacteria 1347
61 Ga0105238_11475050 3300009551 Unclassified 708
62 Ga0105249_10077023 3300009553 Bacteria 3092
63 Ga0105249_11325455 3300009553 Bacteria 791
64 Ga0105239_10262063 3300010375 Bacteria 1943
65 Ga0105239_10333427 3300010375 Bacteria 1712
66 Ga0105239_10457688 3300010375 Archaea 1448
67 Ga0105239_10604778 3300010375 Bacteria 1251
68 Ga0157316_1000485 3300012510 Bacteria 2104
69 Ga0157327_1004147 3300012512 Bacteria 1108
70 Ga0157373_10049935 3300013100 Bacteria 2980
71 Ga0157371_10335841 3300013102 Bacteria 1098
72 Ga0157370_10173046 3300013104 Bacteria 2007
73 Ga0157374_10067028 3300013296 Bacteria 3374
74 Ga0157372_10021715 3300013307 Bacteria 6939
75 Ga0157372_10288548 3300013307 Bacteria 1908
76 Ga0157375_10027444 3300013308 Bacteria 5321
77 Ga0206354_11646683 3300020081 Bacteria 1115
78 Ga0207656_10000662 3300025321 Bacteria 11286
79 Ga0207710_10238884 3300025900 Bacteria 906
80 Ga0207647_10000196 3300025904 Bacteria 49500
81 Ga0207647_10000286 3300025904 Bacteria 41390
82 Ga0207699_10035772 3300025906 Bacteria 2827
83 Ga0207707_10000141 3300025912 Bacteria 74736
84 Ga0207707_10103444 3300025912 Bacteria 2489
85 Ga0207707_10348034 3300025912 Bacteria 1277
86 Ga0207695_10000014 3300025913 Bacteria 812599
87 Ga0207695_10024339 3300025913 Bacteria 6816
88 Ga0207695_10033686 3300025913 Bacteria 5581
89 Ga0207695_10072829 3300025913 Bacteria 3503
90 Ga0207695_10077490 3300025913 Bacteria 3376
91 Ga0207695_10083247 3300025913 Bacteria 3232
92 Ga0207671_10037709 3300025914 Bacteria 3584
93 Ga0207671_10376943 3300025914 Bacteria 1127
94 Ga0207693_10023289 3300025915 Bacteria 4917
95 Ga0207663_10009876 3300025916 Bacteria 5053
96 Ga0207663_10187932 3300025916 Bacteria 1481
97 Ga0207660_10024513 3300025917 Bacteria 4085
98 Ga0207649_10093593 3300025920 Bacteria 1973
99 Ga0207649_10237896 3300025920 Bacteria 1306
100 Ga0207649_10264004 3300025920 Bacteria 1245
101 Ga0207652_10277948 3300025921 Bacteria 1510
102 Ga0207694_10000409 3300025924 Bacteria 39948
103 Ga0207694_10001142 3300025924 Bacteria 23029
104 Ga0207694_10180698 3300025924 Bacteria 1711
105 Ga0207694_10314873 3300025924 Unclassified 1291
106 Ga0207694_10326507 3300025924 Bacteria 1267
107 Ga0207700_10018365 3300025928 Bacteria 4696
108 Ga0207664_10039432 3300025929 Bacteria 3667
109 Ga0207644_10188877 3300025931 Bacteria 1619
110 Ga0207644_10815513 3300025931 Bacteria 781
111 Ga0207706_10002151 3300025933 Bacteria 19257
112 Ga0207704_10225078 3300025938 Bacteria 1391
113 Ga0207665_10005401 3300025939 Bacteria 8534
114 Ga0207665_10386097 3300025939 Bacteria 1064
115 Ga0207691_10024395 3300025940 Bacteria 5687
116 Ga0207689_10120212 3300025942 Bacteria 2161
117 Ga0207661_10588923 3300025944 Bacteria 1020
118 Ga0207667_10001582 3300025949 Bacteria 28630
119 Ga0207667_10161143 3300025949 Bacteria 2307
120 Ga0207651_10038277 3300025960 Bacteria 3151
121 Ga0207712_10000745 3300025961 Bacteria 24662
122 Ga0207640_10004096 3300025981 Bacteria 7875
123 Ga0207658_10032024 3300025986 Bacteria 3738
124 Ga0207658_10086383 3300025986 Bacteria 2419
125 Ga0207703_10002027 3300026035 Bacteria 17888
126 Ga0207639_10004144 3300026041 Bacteria 9759
127 Ga0207678_10005813 3300026067 Bacteria 10994
128 Ga0207678_10204920 3300026067 Bacteria 1687
129 Ga0207702_10061641 3300026078 Bacteria 3200
130 Ga0207702_10170539 3300026078 Bacteria 1995
131 Ga0207641_10084679 3300026088 Bacteria 2761
132 Ga0207648_10043696 3300026089 Bacteria 3933
133 Ga0207676_10478397 3300026095 Bacteria 1179
134 Ga0207675_100484757 3300026118 Bacteria 1229
135 Ga0268266_10000013 3300028379 Bacteria 649715
136 Ga0268266_10234751 3300028379 Bacteria 1690
137 Ga0265334_10111693 3300028573 Bacteria 982
138 Ga0265762_1040826 3300030760 Bacteria 908
139 Ga0265340_10104002 3300031247 Bacteria 1318
140 Ga0316575_10005667 3300031665 Bacteria 4458
141 Ga0316579_10022095 3300031691 Bacteria 2842
142 Ga0316576_10015862 3300031727 Bacteria 5069
143 Ga0316576_10034070 3300031727 Bacteria 3629
144 Ga0316578_10000604 3300031728 Bacteria 12544
145 Ga0307516_10002541 3300031730 Bacteria 24287
146 Ga0307516_10275875 3300031730 Bacteria 1365
147 Ga0307405_10271333 3300031731 Bacteria 1272
148 Ga0316583_10002467 3300032133 Bacteria 6427
149 Ga0316585_10000415 3300032137 Bacteria 9913
150 Ga0316580_10004657 3300032139 Bacteria 3983
151 Ga0316580_10112038 3300032139 Bacteria 835
152 Ga0316593_10025666 3300032168 Bacteria 1878
153 Ga0316588_1009930 3300033528 Bacteria 1995
154 Ga0316596_1001507 3300033541 Bacteria 4730
155 Ga0373935_0304198 3300035692 Bacteria 1128
156 Ga0373937_0176118 3300036401 Bacteria 2008
157 Ga0316584_0008340 3300036712 Bacteria 7136
158 Ga0316584_0387048 3300036712 Bacteria 998
159 Ga0395899_0210271 3300037312 Bacteria 1352
160 Ga0395900_0003528 3300037418 Bacteria 16838
161 Ga0451841_0667588 3300041498 Bacteria 3428
162 Ga0451849_0657031 3300041505 Bacteria 3275
163 Ga0439448_0003999 3300042005 Bacteria 4140
164 Ga0439450_024310 3300042008 Bacteria 1320
165 Ga0439455_0032388 3300042012 Bacteria 1306
166 Ga0466969_0000302 3300044656 Bacteria 27101
167 Ga0466966_0001828 3300044684 Bacteria 13811
168 Ga0466961_0000614 3300044693 Bacteria 22481
169 Ga0466961_0078434 3300044693 Bacteria 2092
170 Ga0466964_0000095 3300044706 Bacteria 21226
171 Ga0466971_0000759 3300044719 Bacteria 12963
172 Ga0466968_0030072 3300044735 Unclassified 2249
173 Ga0466970_0000954 3300044765 Bacteria 13948
174 Ga0466957_0003506 3300044842 Bacteria 8623
175 Ga0466959_0003773 3300045049 Bacteria 10037
176 Ga0466959_0035574 3300045049 Bacteria 3682
177 Ga0466967_0223106 3300045976 Bacteria 1792
178 Ga0495632_0000008 3300046519 Bacteria 294056
179 Ga0495597_0004524 3300046542 Bacteria 7605
180 Ga0495668_0026055 3300046616 Bacteria 3320
181 Ga0495636_0059937 3300047318 Bacteria 1607
182 Ga0495686_0000033 3300047472 Bacteria 342031
183 Ga0496101_0176475 3300048904 Bacteria 1644
184 Ga0496102_0240269 3300048905 Bacteria 1708
185 Ga0496102_0242900 3300048905 Bacteria 1698
186 Ga0496104_0678529 3300048907 Bacteria 938
187 Ga0496105_0008058 3300048908 Bacteria 8188
188 Ga0496108_0216448 3300048911 Bacteria 1663
189 Ga0496110_0033486 3300048913 Bacteria 4444
190 Ga0496111_0251887 3300048914 Bacteria 1310
191 Ga0496113_0809085 3300048916 Bacteria 744
192 Ga0496114_0003679 3300048917 Bacteria 11790
193 Ga0496114_0324367 3300048917 Bacteria 1361
194 Ga0496115_0004115 3300048918 Bacteria 10496
195 Ga0496115_0246659 3300048918 Bacteria 1471
196 Ga0496115_0311564 3300048918 Bacteria 1289
197 Ga0496117_0152245 3300048920 Bacteria 1367
198 Ga0496118_0003325 3300048921 Bacteria 20380
199 Ga0496118_0017601 3300048921 Bacteria 6493
200 Ga0496122_0163614 3300048925 Bacteria 1353
201 Ga0496126_0649239 3300048929 Bacteria 826
202 Ga0501031_0366105 3300049568 Bacteria 933
203 Ga0501034_0023323 3300049571 Bacteria 6306
204 Ga0501036_0018247 3300049572 Bacteria 5876
205 Ga0501037_0072731 3300049573 Bacteria 2500
206 Ga0501038_0069424 3300049574 Bacteria 2993
207 Ga0501039_0122446 3300049575 Bacteria 2039
208 Ga0501043_0017672 3300049579 Bacteria 5593
209 Ga0501043_0596033 3300049579 Bacteria 817
210 Ga0501046_0099841 3300049580 Bacteria 2228
211 Ga0501046_0379631 3300049580 Bacteria 1023
212 Ga0501047_0030513 3300049581 Bacteria 5196
213 Ga0501067_0035948 3300049583 Bacteria 2751
214 Ga0501070_0007690 3300049586 Bacteria 9142
215 Ga0501073_0002738 3300049589 Bacteria 13213
216 Ga0501074_0107703 3300049590 Bacteria 1995
217 Ga0501079_0249183 3300049741 Bacteria 1388
218 Ga0501080_0021101 3300049742 Bacteria 6029
219 Ga0501035_0007365 3300049822 Bacteria 10284
220 Ga0501035_0287347 3300049822 Bacteria 1388
221 Ga0501044_0171266 3300049823 Bacteria 2142
222 Ga0501044_0287339 3300049823 Bacteria 1577
223 nmdc:mga08x19_86400_c1 3300050514 Bacteria 2065
224 nmdc:mga0a205_449654_c1 3300050515 Bacteria 1148
225 Ga0501084_0144591 3300054114 Bacteria 2003
226 Ga0501082_0433190 3300060353 Bacteria 1148
227 Ga0466962_0000111 3300061719 Bacteria 33174

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042012 Ga0439455_0032388 Ga0439455_0032388_28_597 187
2 3300005439 Ga0070711_100001804 Ga0070711_10000180412 191
3 3300025916 Ga0207663_10009876 Ga0207663_100098765 191
4 3300025928 Ga0207700_10018365 Ga0207700_100183655 191
5 3300005344 Ga0070661_100099230 Ga0070661_1000992303 198
6 3300009093 Ga0105240_10014942 Ga0105240_100149426 198
7 3300010375 Ga0105239_10333427 Ga0105239_103334272 198
8 3300025913 Ga0207695_10083247 Ga0207695_100832473 198
9 3300025920 Ga0207649_10093593 Ga0207649_100935932 198
10 3300046542 Ga0495597_0004524 Ga0495597_0004524_2659_3261 198
11 3300031247 Ga0265340_10104002 Ga0265340_101040021 199
12 3300025920 Ga0207649_10237896 Ga0207649_102378963 201
13 3300042005 Ga0439448_0003999 Ga0439448_0003999_629_1240 201
14 3300042008 Ga0439450_024310 Ga0439450_024310_97_708 201
15 3300009101 Ga0105247_10217001 Ga0105247_102170011 203
16 3300009551 Ga0105238_11475050 Ga0105238_114750501 203
17 3300025900 Ga0207710_10238884 Ga0207710_102388841 203
18 3300031727 Ga0316576_10015862 Ga0316576_100158623 204
19 3300032133 Ga0316583_10002467 Ga0316583_100024675 204
20 3300033528 Ga0316588_1009930 Ga0316588_10099302 204
21 3300005455 Ga0070663_100006682 Ga0070663_1000066829 205
22 3300025938 Ga0207704_10225078 Ga0207704_102250782 205
23 3300026067 Ga0207678_10005813 Ga0207678_100058136 205
24 3300005331 Ga0070670_100153243 Ga0070670_1001532433 206
25 3300005344 Ga0070661_100064842 Ga0070661_1000648423 206
26 3300005355 Ga0070671_100339108 Ga0070671_1003391081 206
27 3300005459 Ga0068867_100028587 Ga0068867_1000285874 206
28 3300005548 Ga0070665_100000618 Ga0070665_10000061834 206
29 3300005563 Ga0068855_100080191 Ga0068855_1000801912 206
30 3300005614 Ga0068856_100807826 Ga0068856_1008078261 206
31 3300005842 Ga0068858_100002640 Ga0068858_10000264011 206
32 3300009093 Ga0105240_10245771 Ga0105240_102457712 206
33 3300009551 Ga0105238_10005675 Ga0105238_100056759 206
34 3300013104 Ga0157370_10173046 Ga0157370_101730462 206
35 3300013307 Ga0157372_10021715 Ga0157372_100217154 206
36 3300025904 Ga0207647_10000286 Ga0207647_100002869 206
37 3300025913 Ga0207695_10024339 Ga0207695_100243396 206
38 3300025914 Ga0207671_10037709 Ga0207671_100377092 206
39 3300025920 Ga0207649_10264004 Ga0207649_102640042 206
40 3300025924 Ga0207694_10001142 Ga0207694_1000114214 206
41 3300025931 Ga0207644_10188877 Ga0207644_101888773 206
42 3300025949 Ga0207667_10161143 Ga0207667_101611432 206
43 3300026035 Ga0207703_10002027 Ga0207703_1000202711 206
44 3300026041 Ga0207639_10004144 Ga0207639_100041449 206
45 3300026078 Ga0207702_10061641 Ga0207702_100616414 206
46 3300026089 Ga0207648_10043696 Ga0207648_100436963 206
47 3300028379 Ga0268266_10000013 Ga0268266_1000001395 206
48 3300046519 Ga0495632_0000008 Ga0495632_0000008_229551_230189 206
49 3300047472 Ga0495686_0000033 Ga0495686_0000033_44324_44959 206
50 3300048905 Ga0496102_0240269 Ga0496102_0240269_224_859 206
51 3300048920 Ga0496117_0152245 Ga0496117_0152245_650_1285 206
52 3300048921 Ga0496118_0003325 Ga0496118_0003325_18860_19495 206
53 3300048925 Ga0496122_0163614 Ga0496122_0163614_473_1108 206
54 3300031665 Ga0316575_10005667 Ga0316575_100056672 207
55 3300031691 Ga0316579_10022095 Ga0316579_100220952 207
56 3300031728 Ga0316578_10000604 Ga0316578_1000060411 207
57 3300032137 Ga0316585_10000415 Ga0316585_100004158 207
58 3300032139 Ga0316580_10004657 Ga0316580_100046573 207
59 3300032168 Ga0316593_10025666 Ga0316593_100256662 207
60 3300033541 Ga0316596_1001507 Ga0316596_10015072 207
61 3300036712 Ga0316584_0387048 Ga0316584_0387048_133_765 207
62 3300035692 Ga0373935_0304198 Ga0373935_0304198_356_1018 209
63 3300036401 Ga0373937_0176118 Ga0373937_0176118_844_1506 209
64 3300048907 Ga0496104_0678529 Ga0496104_0678529_226_888 209
65 3300048917 Ga0496114_0003679 Ga0496114_0003679_535_1197 209
66 3300045976 Ga0466967_0223106 Ga0466967_0223106_389_1054 210
67 3300048908 Ga0496105_0008058 Ga0496105_0008058_7512_8174 210
68 3300048918 Ga0496115_0004115 Ga0496115_0004115_973_1635 210
69 3300036712 Ga0316584_0008340 Ga0316584_0008340_3154_3798 211
70 3300041498 Ga0451841_0667588 Ga0451841_0667588_2030_2692 212
71 3300041505 Ga0451849_0657031 Ga0451849_0657031_664_1326 212
72 3300005434 Ga0070709_10232722 Ga0070709_102327222 213
73 3300005435 Ga0070714_100015597 Ga0070714_1000155972 213
74 3300005436 Ga0070713_100338059 Ga0070713_1003380592 213
75 3300005614 Ga0068856_100182204 Ga0068856_1001822042 213
76 3300006028 Ga0070717_10057168 Ga0070717_100571683 213
77 3300006173 Ga0070716_100157728 Ga0070716_1001577282 213
78 3300006914 Ga0075436_100106246 Ga0075436_1001062462 213
79 3300007076 Ga0075435_100074159 Ga0075435_1000741593 213
80 3300025904 Ga0207647_10000196 Ga0207647_1000019625 213
81 3300025906 Ga0207699_10035772 Ga0207699_100357722 213
82 3300025929 Ga0207664_10039432 Ga0207664_100394322 213
83 3300025939 Ga0207665_10386097 Ga0207665_103860972 213
84 3300026078 Ga0207702_10170539 Ga0207702_101705392 213
85 3300048904 Ga0496101_0176475 Ga0496101_0176475_206_868 213
86 3300048918 Ga0496115_0246659 Ga0496115_0246659_512_1174 213
87 3300050514 nmdc:mga08x19_86400_c1 nmdc:mga08x19_86400_c1_809_1471 213
88 3300050515 nmdc:mga0a205_449654_c1 nmdc:mga0a205_449654_c1_344_1006 213
89 iso_pu_bacteria 2818991457 2819660676 213
90 3300005439 Ga0070711_100103659 Ga0070711_1001036592 214
91 3300006163 Ga0070715_10037901 Ga0070715_100379012 214
92 3300006173 Ga0070716_100072794 Ga0070716_1000727944 214
93 3300006175 Ga0070712_100016092 Ga0070712_1000160925 214
94 3300025915 Ga0207693_10023289 Ga0207693_100232895 214
95 3300025916 Ga0207663_10187932 Ga0207663_101879322 214
96 3300025931 Ga0207644_10815513 Ga0207644_108155131 214
97 3300025939 Ga0207665_10005401 Ga0207665_100054014 214
98 3300031727 Ga0316576_10034070 Ga0316576_100340702 214
99 3300005335 Ga0070666_10002943 Ga0070666_100029433 215
100 3300005338 Ga0068868_100049712 Ga0068868_1000497122 215
101 3300005457 Ga0070662_100009088 Ga0070662_1000090888 215
102 3300005834 Ga0068851_10000591 Ga0068851_100005919 215
103 3300005841 Ga0068863_100142773 Ga0068863_1001427733 215
104 3300009176 Ga0105242_10439963 Ga0105242_104399632 215
105 3300009553 Ga0105249_10077023 Ga0105249_100770232 215
106 3300010375 Ga0105239_10262063 Ga0105239_102620633 215
107 3300025321 Ga0207656_10000662 Ga0207656_100006628 215
108 3300025933 Ga0207706_10002151 Ga0207706_1000215111 215
109 3300025961 Ga0207712_10000745 Ga0207712_1000074523 215
110 3300025981 Ga0207640_10004096 Ga0207640_1000409610 215
111 3300025986 Ga0207658_10032024 Ga0207658_100320243 215
112 3300025986 Ga0207658_10086383 Ga0207658_100863832 215
113 3300037312 Ga0395899_0210271 Ga0395899_0210271_632_1285 215
114 3300049568 Ga0501031_0366105 Ga0501031_0366105_194_856 215
115 3300049579 Ga0501043_0596033 Ga0501043_0596033_64_726 215
116 3300049580 Ga0501046_0379631 Ga0501046_0379631_37_699 215
117 3300049822 Ga0501035_0287347 Ga0501035_0287347_650_1312 215
118 3300005458 Ga0070681_10005443 Ga0070681_100054436 216
119 3300025912 Ga0207707_10000141 Ga0207707_1000014120 216
120 3300032139 Ga0316580_10112038 Ga0316580_101120382 216
121 3300005329 Ga0070683_100597701 Ga0070683_1005977011 217
122 3300005355 Ga0070671_100096547 Ga0070671_1000965473 217
123 3300005455 Ga0070663_100070791 Ga0070663_1000707912 217
124 3300005458 Ga0070681_10015747 Ga0070681_100157477 217
125 3300005535 Ga0070684_100233204 Ga0070684_1002332041 217
126 3300005719 Ga0068861_100600112 Ga0068861_1006001122 217
127 3300009551 Ga0105238_10410760 Ga0105238_104107602 217
128 3300009553 Ga0105249_11325455 Ga0105249_113254551 217
129 3300012510 Ga0157316_1000485 Ga0157316_10004852 217
130 3300012512 Ga0157327_1004147 Ga0157327_10041471 217
131 3300013100 Ga0157373_10049935 Ga0157373_100499353 217
132 3300025912 Ga0207707_10103444 Ga0207707_101034442 217
133 3300025917 Ga0207660_10024513 Ga0207660_100245133 217
134 3300025924 Ga0207694_10180698 Ga0207694_101806981 217
135 3300025924 Ga0207694_10314873 Ga0207694_103148732 217
136 3300025944 Ga0207661_10588923 Ga0207661_105889232 217
137 3300025960 Ga0207651_10038277 Ga0207651_100382773 217
138 3300026067 Ga0207678_10204920 Ga0207678_102049202 217
139 3300026088 Ga0207641_10084679 Ga0207641_100846793 217
140 3300026095 Ga0207676_10478397 Ga0207676_104783972 217
141 3300026118 Ga0207675_100484757 Ga0207675_1004847572 217
142 3300031730 Ga0307516_10275875 Ga0307516_102758751 217
143 3300047318 Ga0495636_0059937 Ga0495636_0059937_648_1301 217
144 3300048905 Ga0496102_0242900 Ga0496102_0242900_405_1058 217
145 3300048911 Ga0496108_0216448 Ga0496108_0216448_56_709 217
146 3300048913 Ga0496110_0033486 Ga0496110_0033486_522_1175 217
147 3300048914 Ga0496111_0251887 Ga0496111_0251887_20_673 217
148 3300048916 Ga0496113_0809085 Ga0496113_0809085_59_712 217
149 3300048917 Ga0496114_0324367 Ga0496114_0324367_649_1302 217
150 3300048918 Ga0496115_0311564 Ga0496115_0311564_337_1008 217
151 3300049586 Ga0501070_0007690 Ga0501070_0007690_3650_4312 217
152 3300005539 Ga0068853_100707558 Ga0068853_1007075581 218
153 3300005548 Ga0070665_100188396 Ga0070665_1001883962 218
154 3300005563 Ga0068855_100000430 Ga0068855_10000043025 218
155 3300009093 Ga0105240_10002566 Ga0105240_100025665 218
156 3300009545 Ga0105237_10037583 Ga0105237_100375836 218
157 3300009551 Ga0105238_10253507 Ga0105238_102535071 218
158 3300010375 Ga0105239_10604778 Ga0105239_106047782 218
159 3300025913 Ga0207695_10077490 Ga0207695_100774903 218
160 3300025924 Ga0207694_10326507 Ga0207694_103265072 218
161 3300025949 Ga0207667_10001582 Ga0207667_1000158220 218
162 3300028379 Ga0268266_10234751 Ga0268266_102347512 218
163 3300044693 Ga0466961_0078434 Ga0466961_0078434_641_1318 218
164 3300044735 Ga0466968_0030072 Ga0466968_0030072_1237_1914 218
165 3300045049 Ga0466959_0035574 Ga0466959_0035574_2785_3462 218
166 3300005455 Ga0070663_100114968 Ga0070663_1001149682 219
167 3300005466 Ga0070685_10036453 Ga0070685_100364532 219
168 3300009093 Ga0105240_10003750 Ga0105240_100037502 219
169 3300009545 Ga0105237_10016092 Ga0105237_100160923 219
170 3300025913 Ga0207695_10000014 Ga0207695_10000014599 219
171 3300030760 Ga0265762_1040826 Ga0265762_10408262 219
172 3300044656 Ga0466969_0000302 Ga0466969_0000302_6580_7260 219
173 3300044684 Ga0466966_0001828 Ga0466966_0001828_3124_3804 219
174 3300044693 Ga0466961_0000614 Ga0466961_0000614_11567_12247 219
175 3300044706 Ga0466964_0000095 Ga0466964_0000095_20264_20944 219
176 3300044719 Ga0466971_0000759 Ga0466971_0000759_7139_7819 219
177 3300044765 Ga0466970_0000954 Ga0466970_0000954_7022_7702 219
178 3300044842 Ga0466957_0003506 Ga0466957_0003506_1026_1706 219
179 3300045049 Ga0466959_0003773 Ga0466959_0003773_6580_7260 219
180 3300046616 Ga0495668_0026055 Ga0495668_0026055_1211_1876 219
181 3300048921 Ga0496118_0017601 Ga0496118_0017601_4355_5047 219
182 3300061719 Ga0466962_0000111 Ga0466962_0000111_21056_21736 219
183 3300025914 Ga0207671_10376943 Ga0207671_103769432 220
184 3300025924 Ga0207694_10000409 Ga0207694_1000040917 220
185 iso_pu_bacteria 2895498888 2895499077 220
186 iso_pu_bacteria 2895511927 2895512096 220
187 iso_pu_bacteria 2895522137 2895523249 220
188 iso_pu_bacteria 2895525241 2895528042 220
189 3300005530 Ga0070679_100352807 Ga0070679_1003528071 221
190 3300005535 Ga0070684_100477971 Ga0070684_1004779712 221
191 3300009093 Ga0105240_10215509 Ga0105240_102155092 221
192 3300009545 Ga0105237_10177351 Ga0105237_101773511 221
193 3300009545 Ga0105237_10653769 Ga0105237_106537691 221
194 3300013102 Ga0157371_10335841 Ga0157371_103358412 221
195 3300013307 Ga0157372_10288548 Ga0157372_102885482 221
196 3300020081 Ga0206354_11646683 Ga0206354_116466832 221
197 3300025912 Ga0207707_10348034 Ga0207707_103480342 221
198 3300025913 Ga0207695_10072829 Ga0207695_100728292 221
199 3300025921 Ga0207652_10277948 Ga0207652_102779482 221
200 3300028573 Ga0265334_10111693 Ga0265334_101116932 221
201 3300037418 Ga0395900_0003528 Ga0395900_0003528_7745_8449 221
202 3300048929 Ga0496126_0649239 Ga0496126_0649239_12_692 221
203 3300049823 Ga0501044_0287339 Ga0501044_0287339_53_757 221
204 3300013296 Ga0157374_10067028 Ga0157374_100670282 222
205 3300049741 Ga0501079_0249183 Ga0501079_0249183_637_1317 222
206 3300005334 Ga0068869_100049950 Ga0068869_1000499503 223
207 3300009093 Ga0105240_10011254 Ga0105240_100112546 223
208 3300025913 Ga0207695_10033686 Ga0207695_100336866 223
209 3300025942 Ga0207689_10120212 Ga0207689_101202122 223
210 3300031730 Ga0307516_10002541 Ga0307516_1000254114 224
211 3300005543 Ga0070672_100055147 Ga0070672_1000551472 225
212 3300010375 Ga0105239_10457688 Ga0105239_104576882 225
213 3300013308 Ga0157375_10027444 Ga0157375_100274443 225
214 3300025940 Ga0207691_10024395 Ga0207691_100243955 225
215 3300031731 Ga0307405_10271333 Ga0307405_102713332 226
216 3300049571 Ga0501034_0023323 Ga0501034_0023323_3301_3999 226
217 3300049572 Ga0501036_0018247 Ga0501036_0018247_840_1538 226
218 3300049573 Ga0501037_0072731 Ga0501037_0072731_503_1201 226
219 3300049574 Ga0501038_0069424 Ga0501038_0069424_2012_2710 226
220 3300049575 Ga0501039_0122446 Ga0501039_0122446_796_1494 226
221 3300049579 Ga0501043_0017672 Ga0501043_0017672_3785_4483 226
222 3300049580 Ga0501046_0099841 Ga0501046_0099841_648_1346 226
223 3300049581 Ga0501047_0030513 Ga0501047_0030513_4072_4770 226
224 3300049583 Ga0501067_0035948 Ga0501067_0035948_878_1576 226
225 3300049589 Ga0501073_0002738 Ga0501073_0002738_8128_8826 226
226 3300049590 Ga0501074_0107703 Ga0501074_0107703_563_1261 226
227 3300049742 Ga0501080_0021101 Ga0501080_0021101_306_1004 226
228 3300049822 Ga0501035_0007365 Ga0501035_0007365_620_1318 226
229 3300049823 Ga0501044_0171266 Ga0501044_0171266_1139_1837 226
230 3300054114 Ga0501084_0144591 Ga0501084_0144591_786_1484 226
231 3300060353 Ga0501082_0433190 Ga0501082_0433190_339_1037 226
232 3300003771 Ga0055526_1000214 Ga0055526_100021429 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

36

216

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c2t-assembly1.cif.gz_A new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. 0.9619 7 207
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9584 5 201
3gar-assembly1.cif.gz_A-2 a ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase 0.9565 7 206
3p9x-assembly1.cif.gz_B crystal structure of phosphoribosylglycinamide formyltransferase from bacillus halodurans 0.9496 7 190
3av3-assembly1.cif.gz_A crystal structure of glycinamide ribonucleotide transformylase 1 from geobacillus kaustophilus 0.9467 4 188
ID Description Score Start End Superfamily
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9584 5 201 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9388 5 185 3.40.50.170
3av3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9372 6 186 3.40.50.170
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9269 5 188 3.40.50.170
4s1nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9258 7 180 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A246F2T8-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9796 111 201 GO:0004644
GO:0005829
GO:0006189
AF-A0A2V6BKH7-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9793 86 189 GO:0004644
GO:0005829
GO:0006189
AF-A0A357KNQ0-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9779 103 212 GO:0004644
GO:0005829
GO:0006189
AF-A0A3A5UVQ9-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9773 78 190 GO:0004644
GO:0005829
GO:0006189
AF-A0A3B8PAS2-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) 0.9752 62 206 GO:0004644
GO:0005829
GO:0006189

Feature Viewer

pLDDT pTM Quality
95.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map