F344767

General Info

Members Datasets Scaffolds Average Seq Length
232 117 464 178

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100047110|Ga0070659_1000471102
Length 184
Sequence MTIVGGMQFNLVPHPTTPPGISDLKVWATVEHAASLAAVATTNIWFGIGAPAARFVIPEPAEPGRADELWKTTCFEAFLRPLGEQSYREWNFAPSGEWAAYDFTSTRSGMTEGEAADPYVRMEDNFTWWALGASIAVPADTNWELGLSAVLEEKDGTKSYWALAHPNPEKPDFHDPGCFVARLP

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
117 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.31
Rhizosphere 95.26
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100047110 3300005366 Bacteria 3380
2 JGI24735J21928_10028799 3300002067 Bacteria 1657
3 rootH1_10358718 3300003323 Bacteria 1320
4 Ga0070658_10015514 3300005327 Bacteria 6093
5 Ga0070658_10107106 3300005327 Bacteria 2313
6 Ga0070658_10123691 3300005327 Bacteria 2151
7 Ga0070658_10312111 3300005327 Bacteria 1342
8 Ga0070658_10604038 3300005327 Bacteria 951
9 Ga0070676_10772514 3300005328 Bacteria 707
10 Ga0070690_100512478 3300005330 Bacteria 899
11 Ga0070677_10225490 3300005333 Bacteria 918
12 Ga0068869_100069511 3300005334 Bacteria 2604
13 Ga0070666_10291946 3300005335 Unclassified 1160
14 Ga0070660_100069321 3300005339 Bacteria 2750
15 Ga0070660_100094854 3300005339 Bacteria 2357
16 Ga0070660_100378959 3300005339 Bacteria 1168
17 Ga0070660_101266817 3300005339 Unclassified 625
18 Ga0070689_101122809 3300005340 Bacteria 703
19 Ga0070661_100142503 3300005344 Bacteria 1807
20 Ga0070661_100220040 3300005344 Bacteria 1456
21 Ga0070661_100679040 3300005344 Bacteria 838
22 Ga0070669_100011709 3300005353 Bacteria 6221
23 Ga0070671_100004930 3300005355 Bacteria 10617
24 Ga0070671_100022302 3300005355 Bacteria 5171
25 Ga0070671_100079398 3300005355 Bacteria 2743
26 Ga0070671_100898202 3300005355 Bacteria 774
27 Ga0070673_100015982 3300005364 Bacteria 5290
28 Ga0070659_100103756 3300005366 Bacteria 2290
29 Ga0070659_100184511 3300005366 Bacteria 1713
30 Ga0070667_100002351 3300005367 Bacteria 16564
31 Ga0070667_100125154 3300005367 Bacteria 2240
32 Ga0070667_100520529 3300005367 Bacteria 1091
33 Ga0070714_100382222 3300005435 Bacteria 1328
34 Ga0070663_100245362 3300005455 Bacteria 1415
35 Ga0070663_100334727 3300005455 Bacteria 1221
36 Ga0070662_100762115 3300005457 Bacteria 821
37 Ga0070681_10735563 3300005458 Bacteria 903
38 Ga0068867_100713964 3300005459 Bacteria 886
39 Ga0070665_100225621 3300005548 Bacteria 1874
40 Ga0070665_100515922 3300005548 Bacteria 1207
41 Ga0068855_100337395 3300005563 Bacteria 1663
42 Ga0070664_100140289 3300005564 Bacteria 2128
43 Ga0070664_100161888 3300005564 Bacteria 1980
44 Ga0070664_100399263 3300005564 Bacteria 1257
45 Ga0068857_100066747 3300005577 Bacteria 3202
46 Ga0068856_100343173 3300005614 Bacteria 1512
47 Ga0068852_100034942 3300005616 Bacteria 4187
48 Ga0068852_100150594 3300005616 Bacteria 2163
49 Ga0068852_100504937 3300005616 Bacteria 1205
50 Ga0068859_100000377 3300005617 Bacteria 44438
51 Ga0068859_100286543 3300005617 Bacteria 1740
52 Ga0068864_100000074 3300005618 Bacteria 109458
53 Ga0068864_100340084 3300005618 Bacteria 1414
54 Ga0068864_100694146 3300005618 Bacteria 994
55 Ga0068863_100001194 3300005841 Bacteria 25934
56 Ga0068863_100092125 3300005841 Bacteria 2875
57 Ga0068863_100453685 3300005841 Bacteria 1258
58 Ga0068858_100002501 3300005842 Bacteria 18543
59 Ga0068860_100005052 3300005843 Bacteria 13425
60 Ga0068860_100087120 3300005843 Bacteria 2972
61 Ga0068862_100018747 3300005844 Bacteria 5765
62 Ga0068862_100057454 3300005844 Bacteria 3337
63 Ga0068862_100474021 3300005844 Bacteria 1184
64 Ga0070712_100052143 3300006175 Bacteria 2852
65 Ga0097620_100000377 3300006931 Bacteria 44438
66 Ga0097620_100286545 3300006931 Bacteria 1740
67 Ga0105250_10007906 3300009092 Bacteria 4544
68 Ga0105248_10001134 3300009177 Bacteria 29643
69 Ga0105248_10063297 3300009177 Bacteria 4152
70 Ga0105248_10368578 3300009177 Bacteria 1617
71 Ga0105248_11221334 3300009177 Bacteria 850
72 Ga0105238_10060518 3300009551 Bacteria 3791
73 Ga0105249_10105961 3300009553 Bacteria 2651
74 Ga0105249_10706377 3300009553 Bacteria 1069
75 Ga0105032_103211 3300009979 Bacteria 1428
76 Ga0157373_10554178 3300013100 Unclassified 834
77 Ga0157371_10338312 3300013102 Bacteria 1094
78 Ga0157374_10053643 3300013296 Bacteria 3759
79 Ga0157378_10444285 3300013297 Bacteria 1286
80 Ga0163162_10180284 3300013306 Bacteria 2238
81 Ga0157372_10170384 3300013307 Bacteria 2519
82 Ga0157375_10349365 3300013308 Bacteria 1645
83 Ga0163163_10000219 3300014325 Bacteria 59481
84 Ga0157379_10002142 3300014968 Bacteria 16378
85 Ga0207696_1018079 3300025711 Bacteria 2321
86 Ga0207680_10592952 3300025903 Unclassified 792
87 Ga0207647_10245039 3300025904 Bacteria 1029
88 Ga0207645_10265053 3300025907 Bacteria 1138
89 Ga0207645_10363648 3300025907 Bacteria 969
90 Ga0207705_10018553 3300025909 Bacteria 4973
91 Ga0207705_10034338 3300025909 Bacteria 3626
92 Ga0207705_10043500 3300025909 Bacteria 3227
93 Ga0207705_10325654 3300025909 Bacteria 1181
94 Ga0207705_10562617 3300025909 Bacteria 886
95 Ga0207705_10646974 3300025909 Bacteria 822
96 Ga0207707_10338842 3300025912 Bacteria 1297
97 Ga0207660_10818550 3300025917 Bacteria 760
98 Ga0207657_10037110 3300025919 Bacteria 4357
99 Ga0207657_10142925 3300025919 Bacteria 1954
100 Ga0207657_10201629 3300025919 Bacteria 1600
101 Ga0207657_10202510 3300025919 Bacteria 1596
102 Ga0207657_10346371 3300025919 Bacteria 1172
103 Ga0207649_10433478 3300025920 Bacteria 989
104 Ga0207649_10589557 3300025920 Bacteria 854
105 Ga0207681_10025061 3300025923 Bacteria 3833
106 Ga0207650_10603032 3300025925 Bacteria 923
107 Ga0207664_10336991 3300025929 Bacteria 1333
108 Ga0207644_10409105 3300025931 Bacteria 1110
109 Ga0207690_10025831 3300025932 Bacteria 3692
110 Ga0207690_10308049 3300025932 Bacteria 1241
111 Ga0207690_10383262 3300025932 Unclassified 1118
112 Ga0207711_10000450 3300025941 Bacteria 42929
113 Ga0207711_10289686 3300025941 Bacteria 1509
114 Ga0207689_10077167 3300025942 Bacteria 2739
115 Ga0207689_10255398 3300025942 Bacteria 1450
116 Ga0207667_10266906 3300025949 Bacteria 1750
117 Ga0207651_10003831 3300025960 Bacteria 7457
118 Ga0207651_10139756 3300025960 Bacteria 1869
119 Ga0207712_10073355 3300025961 Bacteria 2468
120 Ga0207712_10363461 3300025961 Bacteria 1206
121 Ga0207668_10008257 3300025972 Bacteria 6203
122 Ga0207640_10205356 3300025981 Bacteria 1496
123 Ga0207658_10002626 3300025986 Bacteria 13045
124 Ga0207658_10008637 3300025986 Bacteria 6927
125 Ga0207658_10182653 3300025986 Bacteria 1737
126 Ga0207658_11043088 3300025986 Bacteria 746
127 Ga0207703_10001242 3300026035 Bacteria 23876
128 Ga0207703_10034880 3300026035 Bacteria 3995
129 Ga0207678_10220139 3300026067 Bacteria 1625
130 Ga0207702_10287354 3300026078 Bacteria 1557
131 Ga0207641_10000188 3300026088 Bacteria 86532
132 Ga0207641_10062051 3300026088 Bacteria 3188
133 Ga0207676_10001887 3300026095 Bacteria 15321
134 Ga0207676_10428073 3300026095 Bacteria 1243
135 Ga0207674_10277816 3300026116 Bacteria 1622
136 Ga0207675_101025467 3300026118 Bacteria 844
137 Ga0207698_10015776 3300026142 Bacteria 5073
138 Ga0268266_10409482 3300028379 Bacteria 1283
139 Ga0268266_10613612 3300028379 Bacteria 1045
140 Ga0268265_10019797 3300028380 Bacteria 4685
141 Ga0268265_10040453 3300028380 Bacteria 3443
142 Ga0268265_10526231 3300028380 Bacteria 1118
143 Ga0268264_10007437 3300028381 Bacteria 9143
144 Ga0268264_10199274 3300028381 Bacteria 1830
145 Ga0268264_10753187 3300028381 Bacteria 970
146 Ga0307411_10210217 3300032005 Bacteria 1502
147 Ga0395899_0019896 3300037312 Bacteria 5092
148 Ga0395899_0057414 3300037312 Bacteria 2873
149 Ga0395899_0159598 3300037312 Bacteria 1594
150 Ga0395899_0267228 3300037312 Bacteria 1167
151 Ga0395900_0028291 3300037418 Bacteria 5741
152 Ga0395900_0054700 3300037418 Bacteria 4109
153 Ga0395900_0057577 3300037418 Bacteria 4001
154 Ga0395900_0140676 3300037418 Bacteria 2471
155 Ga0395900_0197339 3300037418 Bacteria 2038
156 Ga0395900_0247651 3300037418 Bacteria 1784
157 Ga0395900_0309729 3300037418 Bacteria 1562
158 Ga0395900_0415231 3300037418 Bacteria 1307
159 Ga0395900_0496573 3300037418 Bacteria 1171
160 Ga0395900_0746866 3300037418 Bacteria 909
161 Ga0395898_0051491 3300037466 Bacteria 4026
162 Ga0395898_0070587 3300037466 Bacteria 3376
163 Ga0395898_0155635 3300037466 Bacteria 2186
164 Ga0395898_0248476 3300037466 Bacteria 1696
165 Ga0395898_0455298 3300037466 Bacteria 1218
166 Ga0395905_0009329 3300037471 Bacteria 9598
167 Ga0395905_0027001 3300037471 Bacteria 5414
168 Ga0395905_0040850 3300037471 Bacteria 4351
169 Ga0395905_0043167 3300037471 Bacteria 4230
170 Ga0395905_0176780 3300037471 Bacteria 2004
171 Ga0395905_0326269 3300037471 Bacteria 1425
172 Ga0395905_0519402 3300037471 Bacteria 1091
173 Ga0395905_0586587 3300037471 Bacteria 1016
174 Ga0395905_0646962 3300037471 Bacteria 959
175 Ga0395905_0958619 3300037471 Bacteria 758
176 Ga0395905_1093618 3300037471 Unclassified 700
177 Ga0395901_0020664 3300038443 Bacteria 6738
178 Ga0395901_0060985 3300038443 Bacteria 3925
179 Ga0395901_0072253 3300038443 Bacteria 3596
180 Ga0395901_0190053 3300038443 Bacteria 2153
181 Ga0395901_0249882 3300038443 Bacteria 1848
182 Ga0395901_0311029 3300038443 Bacteria 1631
183 Ga0395901_0324499 3300038443 Bacteria 1592
184 Ga0395901_0445782 3300038443 Bacteria 1324
185 Ga0395901_0890989 3300038443 Bacteria 872
186 Ga0395901_1144964 3300038443 Bacteria 746
187 Ga0439464_0000723 3300042439 Bacteria 7174
188 Ga0466969_0308369 3300044656 Unclassified 716
189 Ga0466966_0139992 3300044684 Bacteria 1479
190 Ga0466963_0043734 3300044694 Bacteria 2946
191 Ga0466963_0065477 3300044694 Bacteria 2436
192 Ga0466963_0323754 3300044694 Bacteria 1085
193 Ga0466964_0284150 3300044706 Bacteria 828
194 Ga0466971_0108748 3300044719 Bacteria 1278
195 Ga0466957_0016853 3300044842 Bacteria 4275
196 Ga0466957_0023946 3300044842 Bacteria 3612
197 Ga0466957_0081795 3300044842 Bacteria 2012
198 Ga0466957_0249717 3300044842 Bacteria 1179
199 Ga0466958_0057651 3300045836 Bacteria 2360
200 Ga0466967_0007458 3300045976 Bacteria 7892
201 Ga0466967_0058618 3300045976 Bacteria 3404
202 Ga0466967_0346745 3300045976 Bacteria 1437
203 Ga0466967_1953167 3300045976 Bacteria 583
204 Ga0495620_0372629 3300046515 Bacteria 541
205 Ga0495663_0152567 3300046525 Bacteria 789
206 Ga0495668_0007770 3300046616 Bacteria 6801
207 Ga0495668_0033221 3300046616 Bacteria 2899
208 Ga0495669_0000881 3300046684 Bacteria 12642
209 Ga0495669_0001211 3300046684 Bacteria 10738
210 Ga0495669_0013492 3300046684 Bacteria 3483
211 Ga0495669_0085906 3300046684 Bacteria 1448
212 Ga0495669_0114673 3300046684 Bacteria 1260
213 Ga0495669_0142862 3300046684 Bacteria 1130
214 Ga0495669_0146792 3300046684 Bacteria 1115
215 Ga0495683_0344497 3300047323 Bacteria 630
216 Ga0496100_0906948 3300048903 Bacteria 692
217 Ga0496101_0709728 3300048904 Bacteria 794
218 Ga0496108_0058649 3300048911 Bacteria 3236
219 Ga0496109_0023809 3300048912 Bacteria 5435
220 Ga0496110_0043900 3300048913 Bacteria 3903
221 Ga0496111_0019691 3300048914 Bacteria 4692
222 Ga0496112_0027389 3300048915 Bacteria 5493
223 Ga0496113_0130098 3300048916 Bacteria 1974
224 Ga0496114_0031423 3300048917 Bacteria 4370
225 Ga0496115_0000865 3300048918 Bacteria 22016
226 Ga0501074_0171645 3300049590 Bacteria 1548
227 Ga0501202_076479 3300049652 Bacteria 780
228 Ga0501080_0404206 3300049742 Bacteria 1228
229 Ga0495655_0016622 3300053083 Bacteria 1588
230 Ga0466962_0144770 3300061719 Bacteria 1152
231 Ga0466962_0156488 3300061719 Bacteria 1107
232 Ga0466962_0270199 3300061719 Bacteria 838
233 Ga0070659_100047110
234 JGI24735J21928_10028799
235 rootH1_10358718
236 Ga0070658_10015514
237 Ga0070658_10107106
238 Ga0070658_10123691
239 Ga0070658_10312111
240 Ga0070658_10604038
241 Ga0070676_10772514
242 Ga0070690_100512478
243 Ga0070677_10225490
244 Ga0068869_100069511
245 Ga0070666_10291946
246 Ga0070660_100069321
247 Ga0070660_100094854
248 Ga0070660_100378959
249 Ga0070660_101266817
250 Ga0070689_101122809
251 Ga0070661_100142503
252 Ga0070661_100220040
253 Ga0070661_100679040
254 Ga0070669_100011709
255 Ga0070671_100004930
256 Ga0070671_100022302
257 Ga0070671_100079398
258 Ga0070671_100898202
259 Ga0070673_100015982
260 Ga0070659_100103756
261 Ga0070659_100184511
262 Ga0070667_100002351
263 Ga0070667_100125154
264 Ga0070667_100520529
265 Ga0070714_100382222
266 Ga0070663_100245362
267 Ga0070663_100334727
268 Ga0070662_100762115
269 Ga0070681_10735563
270 Ga0068867_100713964
271 Ga0070665_100225621
272 Ga0070665_100515922
273 Ga0068855_100337395
274 Ga0070664_100140289
275 Ga0070664_100161888
276 Ga0070664_100399263
277 Ga0068857_100066747
278 Ga0068856_100343173
279 Ga0068852_100034942
280 Ga0068852_100150594
281 Ga0068852_100504937
282 Ga0068859_100000377
283 Ga0068859_100286543
284 Ga0068864_100000074
285 Ga0068864_100340084
286 Ga0068864_100694146
287 Ga0068863_100001194
288 Ga0068863_100092125
289 Ga0068863_100453685
290 Ga0068858_100002501
291 Ga0068860_100005052
292 Ga0068860_100087120
293 Ga0068862_100018747
294 Ga0068862_100057454
295 Ga0068862_100474021
296 Ga0070712_100052143
297 Ga0097620_100000377
298 Ga0097620_100286545
299 Ga0105250_10007906
300 Ga0105248_10001134
301 Ga0105248_10063297
302 Ga0105248_10368578
303 Ga0105248_11221334
304 Ga0105238_10060518
305 Ga0105249_10105961
306 Ga0105249_10706377
307 Ga0105032_103211
308 Ga0157373_10554178
309 Ga0157371_10338312
310 Ga0157374_10053643
311 Ga0157378_10444285
312 Ga0163162_10180284
313 Ga0157372_10170384
314 Ga0157375_10349365
315 Ga0163163_10000219
316 Ga0157379_10002142
317 Ga0207696_1018079
318 Ga0207680_10592952
319 Ga0207647_10245039
320 Ga0207645_10265053
321 Ga0207645_10363648
322 Ga0207705_10018553
323 Ga0207705_10034338
324 Ga0207705_10043500
325 Ga0207705_10325654
326 Ga0207705_10562617
327 Ga0207705_10646974
328 Ga0207707_10338842
329 Ga0207660_10818550
330 Ga0207657_10037110
331 Ga0207657_10142925
332 Ga0207657_10201629
333 Ga0207657_10202510
334 Ga0207657_10346371
335 Ga0207649_10433478
336 Ga0207649_10589557
337 Ga0207681_10025061
338 Ga0207650_10603032
339 Ga0207664_10336991
340 Ga0207644_10409105
341 Ga0207690_10025831
342 Ga0207690_10308049
343 Ga0207690_10383262
344 Ga0207711_10000450
345 Ga0207711_10289686
346 Ga0207689_10077167
347 Ga0207689_10255398
348 Ga0207667_10266906
349 Ga0207651_10003831
350 Ga0207651_10139756
351 Ga0207712_10073355
352 Ga0207712_10363461
353 Ga0207668_10008257
354 Ga0207640_10205356
355 Ga0207658_10002626
356 Ga0207658_10008637
357 Ga0207658_10182653
358 Ga0207658_11043088
359 Ga0207703_10001242
360 Ga0207703_10034880
361 Ga0207678_10220139
362 Ga0207702_10287354
363 Ga0207641_10000188
364 Ga0207641_10062051
365 Ga0207676_10001887
366 Ga0207676_10428073
367 Ga0207674_10277816
368 Ga0207675_101025467
369 Ga0207698_10015776
370 Ga0268266_10409482
371 Ga0268266_10613612
372 Ga0268265_10019797
373 Ga0268265_10040453
374 Ga0268265_10526231
375 Ga0268264_10007437
376 Ga0268264_10199274
377 Ga0268264_10753187
378 Ga0307411_10210217
379 Ga0395899_0019896
380 Ga0395899_0057414
381 Ga0395899_0159598
382 Ga0395899_0267228
383 Ga0395900_0028291
384 Ga0395900_0054700
385 Ga0395900_0057577
386 Ga0395900_0140676
387 Ga0395900_0197339
388 Ga0395900_0247651
389 Ga0395900_0309729
390 Ga0395900_0415231
391 Ga0395900_0496573
392 Ga0395900_0746866
393 Ga0395898_0051491
394 Ga0395898_0070587
395 Ga0395898_0155635
396 Ga0395898_0248476
397 Ga0395898_0455298
398 Ga0395905_0009329
399 Ga0395905_0027001
400 Ga0395905_0040850
401 Ga0395905_0043167
402 Ga0395905_0176780
403 Ga0395905_0326269
404 Ga0395905_0519402
405 Ga0395905_0586587
406 Ga0395905_0646962
407 Ga0395905_0958619
408 Ga0395905_1093618
409 Ga0395901_0020664
410 Ga0395901_0060985
411 Ga0395901_0072253
412 Ga0395901_0190053
413 Ga0395901_0249882
414 Ga0395901_0311029
415 Ga0395901_0324499
416 Ga0395901_0445782
417 Ga0395901_0890989
418 Ga0395901_1144964
419 Ga0439464_0000723
420 Ga0466969_0308369
421 Ga0466966_0139992
422 Ga0466963_0043734
423 Ga0466963_0065477
424 Ga0466963_0323754
425 Ga0466964_0284150
426 Ga0466971_0108748
427 Ga0466957_0016853
428 Ga0466957_0023946
429 Ga0466957_0081795
430 Ga0466957_0249717
431 Ga0466958_0057651
432 Ga0466967_0007458
433 Ga0466967_0058618
434 Ga0466967_0346745
435 Ga0466967_1953167
436 Ga0495620_0372629
437 Ga0495663_0152567
438 Ga0495668_0007770
439 Ga0495668_0033221
440 Ga0495669_0000881
441 Ga0495669_0001211
442 Ga0495669_0013492
443 Ga0495669_0085906
444 Ga0495669_0114673
445 Ga0495669_0142862
446 Ga0495669_0146792
447 Ga0495683_0344497
448 Ga0496100_0906948
449 Ga0496101_0709728
450 Ga0496108_0058649
451 Ga0496109_0023809
452 Ga0496110_0043900
453 Ga0496111_0019691
454 Ga0496112_0027389
455 Ga0496113_0130098
456 Ga0496114_0031423
457 Ga0496115_0000865
458 Ga0501074_0171645
459 Ga0501202_076479
460 Ga0501080_0404206
461 Ga0495655_0016622
462 Ga0466962_0144770
463 Ga0466962_0156488
464 Ga0466962_0270199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nwq-assembly1.cif.gz_AAA a carbohydrate binding module family 9 (cbm9) from caldicellulosiruptor kristjanssonii in complex with cellotriose 0.7031 1 158
7nwo-assembly1.cif.gz_AAA a carbohydrate binding module family 9 (cbm9) from caldicellulosiruptor kristjanssonii in complex with glucose 0.6207 18 158
4jpq-assembly2.cif.gz_B crystal structure of a putative carbohydrate-binding protein (bacuni_03838) from bacteroides uniformis atcc 8492 at 2.70 a resolution 0.6177 3 173
4jpq-assembly2.cif.gz_B crystal structure of a putative carbohydrate-binding protein (bacuni_03838) from bacteroides uniformis atcc 8492 at 2.70 a resolution 0.5972 3 173
1ftf-assembly1.cif.gz_C crystal structure of streptococcus pneumoniae acyl carrier protein synthase (native 2) 0.5894 95 130
ID Description Score Start End Superfamily
3dipB01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.7584 67 99 3.30.390.10
af_Q18357_79_204_2.60.40.1190 Mainly Beta;Sandwich;Immunoglobulin-like; 0.74 59 178 2.60.40.1190
af_Q8N1A6_40_177_2.60.40.1190 Mainly Beta;Sandwich;Immunoglobulin-like; 0.739 48 178 2.60.40.1190
af_Q18357_79_204_2.60.40.1190 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7037 59 178 2.60.40.1190
af_Q8N1A6_40_177_2.60.40.1190 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7019 48 178 2.60.40.1190
ID Description Score Start End GO Terms
AF-A0A6G7YSJ8-F1-model_v4 DOMON-like domain-containing protein 0.9717 1 178
AF-A0A6G7YSJ8-F1-model_v4 DOMON-like domain-containing protein 0.9663 1 178
AF-A0A2N3DYU7-F1-model_v4 DOMON-like domain-containing protein 0.9566 35 177
AF-A0A7X5Y6Z0-F1-model_v4 DOMON-like domain-containing protein 0.9564 1 178
AF-A0A7G9SFC7-F1-model_v4 DOMON-like domain-containing protein 0.9549 46 178

Map