F344640

General Info

Members Datasets Scaffolds Average Seq Length
232 186 465 189

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1003669|JGI25159J45721_10036692
Length 215
Sequence MENRDNIKNVLIDRITQLVIFGGEDVAVDRKRSIIEAATKSFSAFGYKATTMDQVAKLANVGKGTIYTFFKNKEELFGEIISNLITEMKQVAKEAIRPDVSFFENVHRALYNILEFRKEHQLMIKLIQEERDMGTKEVQDVMQQVDVEIVSVIQSYLEIAIEKGEISKCDPEITAFIMLRLYVSLIFDWEKNHEPLEKERIAELFELYLLKGLSN

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
20 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
21 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
24 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
32 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
37 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
38 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
39 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
40 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
41 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
42 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
43 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
44 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
45 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
46 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
47 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
48 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
49 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
50 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
51 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
52 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
53 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
54 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
55 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
56 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
57 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
58 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
59 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
60 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
61 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
62 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
63 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
64 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
65 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
66 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
67 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
78 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
79 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
80 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
81 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
82 2554235283 Bacillus safensis VK Isolate Rhizosphere
83 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
84 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
85 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
86 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
87 2643221729 Bacillus sp. Root11 Isolate Unclassified
88 2643221730 Bacillus sp. Root131 Isolate Unclassified
89 2643221731 Bacillus sp. Root147 Isolate Unclassified
90 2643221732 Bacillus sp. Root239 Isolate Unclassified
91 2643221735 Bacillus sp. Root920 Isolate Unclassified
92 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
93 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
94 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
95 2684622632 Bacillus cereus 905 Isolate Unclassified
96 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
97 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
98 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
99 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
100 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
101 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
102 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
103 2738541295 Bacillus sp. OK085 Isolate Unclassified
104 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
105 2738541358 Bacillus sp. OV752 Isolate Unclassified
106 2738543006 Bacillus sp. OK077 Isolate Unclassified
107 2738543010 Bacillus sp. YR335 Isolate Unclassified
108 2738543017 Bacillus sp. OV186 Isolate Unclassified
109 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
110 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
111 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
112 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
113 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
114 2811994870 Bacillus sp. JB4 Isolate Unclassified
115 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
116 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
117 2818991441 Niallia circulans 3243 Isolate Rhizosphere
118 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
119 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
120 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
121 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
122 2842682962 Bacillus sp. R-72492 Isolate Unclassified
123 2842882022 Bacillus sp. R-71893 Isolate Unclassified
124 2849139964 Bacillus sp. R-71875 Isolate Unclassified
125 2857581216 Bacillus sp. R-71922 Isolate Unclassified
126 2857586860 Bacillus sp. R-71935 Isolate Unclassified
127 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
128 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
129 2860837431 Bacillus sp. WR11 Isolate Unclassified
130 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
131 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
132 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
133 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
134 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
135 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
136 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
137 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
138 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
139 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
140 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
141 2919720352 Priestia megaterium 4340 Isolate Unclassified
142 2919726948 Bacillus pumilus 4489 Isolate Unclassified
143 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
144 2929004312 Priestia megaterium 1104 Isolate Unclassified
145 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
146 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
147 2938917290 Bacillus sp. CR71 Isolate Unclassified
148 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
149 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
150 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
151 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
152 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
153 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
154 2965761152 Bacillus sp. COPE52 Isolate Unclassified
155 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
156 2969141011 Bacillus velezensis MH25 Isolate Unclassified
157 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
158 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
159 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
160 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
161 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
162 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
163 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
164 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
165 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
166 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
167 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
168 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
169 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
170 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
171 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
172 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
173 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
174 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
175 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
176 8022653035 Bacillus sp. Rc4 Isolate Unclassified
177 8022792930 Bacillus sp. Xin Isolate Rhizosphere
178 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
179 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
180 8023438354 Bacillus sp. BH2 Isolate Unclassified
181 8023444577 Bacillus sp. BH32 Isolate Unclassified
182 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
183 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
184 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
185 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
186 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 46.55
Metatranscriptomes 5.6
Isolates 47.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.79
Nodule 0
Rhizoplane 6.47
Rhizosphere 48.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1003669 3300002987 Bacteria 5335
2 JGI25159J45721_1001908 3300002987 Bacteria 8335
3 JGI25151J46595_10000009 3300003187 Bacteria 296412
4 JGI25151J46595_10003259 3300003187 Bacteria 9027
5 JGI25151J46595_10003379 3300003187 Bacteria 8835
6 JGI25151J46595_10004796 3300003187 Bacteria 7085
7 JGI25151J46595_10008841 3300003187 Bacteria 4815
8 JGI25151J46595_10009214 3300003187 Bacteria 4693
9 JGI25151J46595_10012203 3300003187 Bacteria 3915
10 JGI25151J46595_10020988 3300003187 Bacteria 2741
11 rootH1_10004972 3300003316 Bacteria 34087
12 rootH1_10004972 3300003323 Bacteria 2958
13 rootH2_10223247 3300003320 Bacteria 2561
14 rootL2_10223568 3300003322 Bacteria 1490
15 rootH1_10209909 3300003323 Bacteria 1230
16 Ga0055532_1000078 3300003758 Bacteria 121493
17 Ga0055536_1028266 3300003781 Bacteria 1531
18 Ga0055528_1030390 3300003790 Bacteria 1434
19 Ga0070669_101339689 3300005353 Bacteria 620
20 Ga0070671_100225346 3300005355 Bacteria 1591
21 Ga0105251_10048550 3300009011 Bacteria 2034
22 Ga0105251_10071362 3300009011 Bacteria 1616
23 Ga0105251_10114135 3300009011 Bacteria 1229
24 Ga0105244_10008581 3300009036 Bacteria 6374
25 Ga0105244_10047057 3300009036 Bacteria 2214
26 Ga0105244_10162898 3300009036 Bacteria 1064
27 Ga0105250_10001715 3300009092 Bacteria 11573
28 Ga0105250_10091286 3300009092 Bacteria 1239
29 Ga0105247_10015446 3300009101 Bacteria 4574
30 Ga0105243_10002585 3300009148 Bacteria 15110
31 Ga0105242_10048349 3300009176 Bacteria 3458
32 Ga0105246_10173510 3300011119 Bacteria 1653
33 Ga0105246_10804932 3300011119 Bacteria 834
34 Ga0157378_10282114 3300013297 Bacteria 1601
35 Ga0157376_10373893 3300014969 Bacteria 1371
36 Ga0209147_100114 3300025229 Bacteria 144205
37 Ga0209147_100938 3300025229 Bacteria 12902
38 Ga0209147_105370 3300025229 Bacteria 1926
39 Ga0209130_1000901 3300025284 Bacteria 23968
40 Ga0209130_1003251 3300025284 Bacteria 7122
41 Ga0209675_1039290 3300025291 Bacteria 1048
42 Ga0209676_1000967 3300025292 Bacteria 34644
43 Ga0209025_1000001 3300025294 Bacteria 1888151
44 Ga0209025_1000209 3300025294 Bacteria 140401
45 Ga0209025_1000219 3300025294 Bacteria 137235
46 Ga0209025_1000449 3300025294 Bacteria 80562
47 Ga0209025_1003365 3300025294 Bacteria 15297
48 Ga0209025_1003612 3300025294 Bacteria 14404
49 Ga0209025_1003644 3300025294 Bacteria 14292
50 Ga0209025_1006391 3300025294 Bacteria 9171
51 Ga0209025_1013710 3300025294 Bacteria 5065
52 Ga0209025_1016315 3300025294 Bacteria 4398
53 Ga0209025_1018655 3300025294 Bacteria 3912
54 Ga0209025_1053582 3300025294 Bacteria 1580
55 Ga0207696_1001688 3300025711 Bacteria 11474
56 Ga0207696_1005493 3300025711 Bacteria 5253
57 Ga0207696_1042591 3300025711 Bacteria 1323
58 Ga0207655_1002136 3300025728 Bacteria 16474
59 Ga0207655_1022467 3300025728 Bacteria 3161
60 Ga0207655_1031883 3300025728 Bacteria 2419
61 Ga0207713_1003043 3300025735 Bacteria 11684
62 Ga0207659_10515225 3300025926 Bacteria 1014
63 Ga0207709_10012134 3300025935 Bacteria 4749
64 Ga0210000_1018737 3300027462 Bacteria 1052
65 Ga0237817_10062 3300030083 Bacteria 36795
66 Ga0307408_100128742 3300031548 Bacteria 1972
67 Ga0307408_100751590 3300031548 Bacteria 881
68 Ga0307408_100810039 3300031548 Bacteria 851
69 Ga0307409_101487724 3300031995 Bacteria 704
70 Ga0307416_100798552 3300032002 Bacteria 1039
71 Ga0395898_0444051 3300037466 Bacteria 1236
72 Ga0237819_00096 3300038705 Bacteria 32528
73 Ga0237819_01480 3300038705 Bacteria 6025
74 Ga0466967_0003630 3300045976 Bacteria 10139
75 Ga0466967_1553118 3300045976 Bacteria 659
76 Ga0495603_0048022 3300046455 Bacteria 2541
77 Ga0495590_0021200 3300046457 Bacteria 2305
78 Ga0495584_0022512 3300046491 Bacteria 3197
79 Ga0495585_0166176 3300046492 Bacteria 1142
80 Ga0495622_0115272 3300046557 Bacteria 1229
81 Ga0495633_0022345 3300046558 Bacteria 3150
82 Ga0495649_0034568 3300046694 Bacteria 2781
83 Ga0495660_0081830 3300046810 Bacteria 1692
84 Ga0495676_0170755 3300047321 Bacteria 1531
85 Ga0495683_0014097 3300047323 Bacteria 4165
86 Ga0495626_0117961 3300048091 Bacteria 1144
87 Ga0496100_0000490 3300048903 Bacteria 19068
88 Ga0496101_0079131 3300048904 Bacteria 2426
89 Ga0496102_0002365 3300048905 Bacteria 16091
90 Ga0496102_0035720 3300048905 Bacteria 4475
91 Ga0496103_0064421 3300048906 Bacteria 2285
92 Ga0496104_0085172 3300048907 Bacteria 3016
93 Ga0496105_0004512 3300048908 Bacteria 10482
94 Ga0496107_0000379 3300048910 Bacteria 24154
95 Ga0496108_0001851 3300048911 Bacteria 16912
96 Ga0496110_0019033 3300048913 Bacteria 5770
97 Ga0496111_0046118 3300048914 Bacteria 3137
98 Ga0496111_0738293 3300048914 Bacteria 715
99 Ga0496113_0008850 3300048916 Bacteria 6580
100 Ga0496116_0002965 3300048919 Bacteria 17270
101 Ga0496119_0004574 3300048922 Bacteria 13672
102 Ga0496120_0280880 3300048923 Bacteria 770
103 Ga0496121_0281344 3300048924 Bacteria 1138
104 Ga0496122_0005451 3300048925 Bacteria 15140
105 Ga0496122_0008165 3300048925 Bacteria 11385
106 Ga0496122_0183820 3300048925 Bacteria 1243
107 Ga0496122_0418473 3300048925 Bacteria 674
108 Ga0496126_0331962 3300048929 Bacteria 1248
109 Ga0501305_055426 3300049161 Bacteria 673
110 Ga0501312_030212 3300049528 Bacteria 847
111 Ga0501312_038307 3300049528 Bacteria 776
112 Ga0501313_019872 3300049529 Bacteria 823
113 Ga0501313_021604 3300049529 Bacteria 798
114 Ga0501314_024912 3300049530 Bacteria 641
115 Ga0501317_028262 3300049533 Bacteria 801
116 Ga0501317_055340 3300049533 Bacteria 640
117 Ga0501321_010667 3300049537 Bacteria 1013
118 Ga0501327_06053 3300049543 Bacteria 726
119 Ga0501330_009544 3300049546 Bacteria 679
120 Ga0501334_06582 3300049550 Bacteria 787
121 Ga0501335_014914 3300049551 Bacteria 789
122 Ga0501227_103168 3300049665 Bacteria 760
123 2511698944 2511231119 Bacteria 4019861
124 2540606152 2540341094 Bacteria 4061186
125 2545558157 2545555800 Bacteria 4222588
126 2553396108 2551306519 Bacteria 5465154
127 2555470718 2554235283 Bacteria 3683090
128 2578932579 2576861599 Bacteria 4217202
129 2595089867 2593339131 Bacteria 5116855
130 2601639622 2600255286 Bacteria 5390125
131 2631985603 2630968484 Bacteria 3876276
132 2644707844 2643221729 Bacteria 6621700
133 2644712126 2643221730 Bacteria 6523787
134 2644721062 2643221731 Bacteria 5623886
135 2644722534 2643221732 Bacteria 5756404
136 2644739350 2643221735 Bacteria 3676263
137 2651530141 2648501850 Bacteria 3975476
138 2672334660 2671180330 Bacteria 5521719
139 2674420249 2671180844 Bacteria 4164150
140 2685149000 2684622632 Bacteria 5380049
141 2686996232 2684623153 Bacteria 3878815
142 2687497482 2687453109 Bacteria 3860091
143 2695626866 2695420354 Bacteria 3922431
144 2698324165 2695420987 Bacteria 6152737
145 2705993044 2703719227 Bacteria 5631989
146 2717917318 2716884898 Bacteria 3928789
147 2721504405 2718218445 Bacteria 5113413
148 2738813720 2738541295 Bacteria 5730091
149 2738838167 2738541299 Bacteria 4020721
150 2739156659 2738541358 Bacteria 5932299
151 2739210260 2738543006 Bacteria 5904091
152 2739231934 2738543010 Bacteria 5583595
153 2739270856 2738543017 Bacteria 4271950
154 2757568244 2757320391 Bacteria 4746095
155 2777762680 2775507177 Bacteria 4384303
156 2777836874 2775507192 Bacteria 4622234
157 2777839868 2775507192 Bacteria 4622234
158 2808868158 2808606364 Bacteria 4465927
159 2809054354 2808606399 Bacteria 4021018
160 2812315355 2811994870 Bacteria 3776934
161 2816863515 2816332186 Bacteria 5331395
162 2817479220 2816332295 Bacteria 4352468
163 2819570069 2818991441 Bacteria 5062707
164 2819582822 2818991443 Bacteria 6598732
165 2819711638 2818991465 Bacteria 5388835
166 2819725215 2818991468 Bacteria 3723169
167 2823527334 2823526263 Bacteria 3765752
168 2842685582 2842682962 Bacteria 5589973
169 2842887202 2842882022 Bacteria 6158489
170 2849140417 2849139964 Bacteria 5613304
171 2857584823 2857581216 Bacteria 5522813
172 2857590906 2857586860 Bacteria 4354574
173 2857607725 2857604169 Bacteria 5111450
174 2857612418 2857609550 Bacteria 3753890
175 2860838527 2860837431 Bacteria 4202080
176 2877769685 2877768649 Bacteria 3957164
177 2880170683 2880169592 Bacteria 3900066
178 2881649713 2881644220 Bacteria 5302661
179 2881649842 2881644220 Bacteria 5302661
180 2897110666 2897109615 Bacteria 4009619
181 2904529633 2904524088 Bacteria 5887454
182 2904562967 2904560550 Bacteria 4029838
183 2908666447 2908665501 Bacteria 3678115
184 2919093439 2919093281 Bacteria 3660974
185 2919148855 2919143609 Bacteria 6219228
186 2919418819 2919414237 Bacteria 5429133
187 2919522321 2919517244 Bacteria 5858162
188 2919725506 2919720352 Bacteria 5986006
189 2919729652 2919726948 Bacteria 3696050
190 2928099201 2928093941 Bacteria 5965005
191 2929009189 2929004312 Bacteria 5678476
192 2929234270 2929233124 Bacteria 5948380
193 2936340809 2936340661 Bacteria 5139038
194 2938918451 2938917290 Bacteria 5914775
195 2947427799 2947426588 Bacteria 5357194
196 2954775159 2954773129 Bacteria 3741715
197 2956900651 2956897341 Bacteria 5447711
198 2960324704 2960319331 Bacteria 5502575
199 2960378137 2960375949 Bacteria 5361395
200 2962291888 2962290636 Bacteria 4072939
201 2965762309 2965761152 Bacteria 5806513
202 2969137934 2969136845 Bacteria 3923176
203 2969142137 2969141011 Bacteria 4118468
204 2969768282 2969765954 Bacteria 4216713
205 2969771718 2969770375 Bacteria 4271280
206 2971894433 2971893375 Bacteria 3929648
207 2977254605 2977254563 Bacteria 4828420
208 2979084719 2979083700 Bacteria 5894929
209 2980493709 2980492589 Bacteria 4072961
210 2990275618 2990275345 Bacteria 4887158
211 3001267166 3001267043 Bacteria 4823521
212 3001272640 3001272096 Bacteria 4729684
213 3001898626 3001892409 Bacteria 6328293
214 3006829421 3006826541 Bacteria 4678913
215 3006859544 3006858327 Bacteria 4317835
216 3006880176 3006879489 Bacteria 4064221
217 3006970937 3006969106 Bacteria 4739423
218 3006974262 3006973921 Bacteria 4423788
219 3006978747 3006978542 Bacteria 5328100
220 3006985924 3006984091 Bacteria 4207523
221 3006990003 3006988479 Bacteria 4767936
222 8022633895 8022630665 Bacteria 3886130
223 8022655099 8022653035 Bacteria 4035078
224 8022798722 8022792930 Bacteria 5693794
225 8022894684 8022893055 Bacteria 5300455
226 8022915154 8022914991 Bacteria 5584517
227 8023443400 8023438354 Bacteria 5779374
228 8023449301 8023444577 Bacteria 5661597
229 8051953496 8051952484 Bacteria 3926774
230 8052177083 8052174270 Bacteria 3881265
231 8054282175 8054280661 Bacteria 4232245
232 8057583809 8057582654 Bacteria 5218944
233 8057633762 8057632132 Bacteria 4726859
234 JGI25159J45721_1003669
235 JGI25159J45721_1001908
236 JGI25151J46595_10000009
237 JGI25151J46595_10003259
238 JGI25151J46595_10003379
239 JGI25151J46595_10004796
240 JGI25151J46595_10008841
241 JGI25151J46595_10009214
242 JGI25151J46595_10012203
243 JGI25151J46595_10020988
244 rootH1_10004972
245 rootH2_10223247
246 rootL2_10223568
247 rootH1_10209909
248 Ga0055532_1000078
249 Ga0055536_1028266
250 Ga0055528_1030390
251 Ga0070669_101339689
252 Ga0070671_100225346
253 Ga0105251_10048550
254 Ga0105251_10071362
255 Ga0105251_10114135
256 Ga0105244_10008581
257 Ga0105244_10047057
258 Ga0105244_10162898
259 Ga0105250_10001715
260 Ga0105250_10091286
261 Ga0105247_10015446
262 Ga0105243_10002585
263 Ga0105242_10048349
264 Ga0105246_10173510
265 Ga0105246_10804932
266 Ga0157378_10282114
267 Ga0157376_10373893
268 Ga0209147_100114
269 Ga0209147_100938
270 Ga0209147_105370
271 Ga0209130_1000901
272 Ga0209130_1003251
273 Ga0209675_1039290
274 Ga0209676_1000967
275 Ga0209025_1000001
276 Ga0209025_1000209
277 Ga0209025_1000219
278 Ga0209025_1000449
279 Ga0209025_1003365
280 Ga0209025_1003612
281 Ga0209025_1003644
282 Ga0209025_1006391
283 Ga0209025_1013710
284 Ga0209025_1016315
285 Ga0209025_1018655
286 Ga0209025_1053582
287 Ga0207696_1001688
288 Ga0207696_1005493
289 Ga0207696_1042591
290 Ga0207655_1002136
291 Ga0207655_1022467
292 Ga0207655_1031883
293 Ga0207713_1003043
294 Ga0207659_10515225
295 Ga0207709_10012134
296 Ga0210000_1018737
297 Ga0237817_10062
298 Ga0307408_100128742
299 Ga0307408_100751590
300 Ga0307408_100810039
301 Ga0307409_101487724
302 Ga0307416_100798552
303 Ga0395898_0444051
304 Ga0237819_00096
305 Ga0237819_01480
306 Ga0466967_0003630
307 Ga0466967_1553118
308 Ga0495603_0048022
309 Ga0495590_0021200
310 Ga0495584_0022512
311 Ga0495585_0166176
312 Ga0495622_0115272
313 Ga0495633_0022345
314 Ga0495649_0034568
315 Ga0495660_0081830
316 Ga0495676_0170755
317 Ga0495683_0014097
318 Ga0495626_0117961
319 Ga0496100_0000490
320 Ga0496101_0079131
321 Ga0496102_0002365
322 Ga0496102_0035720
323 Ga0496103_0064421
324 Ga0496104_0085172
325 Ga0496105_0004512
326 Ga0496107_0000379
327 Ga0496108_0001851
328 Ga0496110_0019033
329 Ga0496111_0046118
330 Ga0496111_0738293
331 Ga0496113_0008850
332 Ga0496116_0002965
333 Ga0496119_0004574
334 Ga0496120_0280880
335 Ga0496121_0281344
336 Ga0496122_0005451
337 Ga0496122_0008165
338 Ga0496122_0183820
339 Ga0496122_0418473
340 Ga0496126_0331962
341 Ga0501305_055426
342 Ga0501312_030212
343 Ga0501312_038307
344 Ga0501313_019872
345 Ga0501313_021604
346 Ga0501314_024912
347 Ga0501317_028262
348 Ga0501317_055340
349 Ga0501321_010667
350 Ga0501327_06053
351 Ga0501330_009544
352 Ga0501334_06582
353 Ga0501335_014914
354 Ga0501227_103168
355 2511698944
356 2540606152
357 2545558157
358 2553396108
359 2555470718
360 2578932579
361 2595089867
362 2601639622
363 2631985603
364 2644707844
365 2644712126
366 2644721062
367 2644722534
368 2644739350
369 2651530141
370 2672334660
371 2674420249
372 2685149000
373 2686996232
374 2687497482
375 2695626866
376 2698324165
377 2705993044
378 2717917318
379 2721504405
380 2738813720
381 2738838167
382 2739156659
383 2739210260
384 2739231934
385 2739270856
386 2757568244
387 2777762680
388 2777836874
389 2777839868
390 2808868158
391 2809054354
392 2812315355
393 2816863515
394 2817479220
395 2819570069
396 2819582822
397 2819711638
398 2819725215
399 2823527334
400 2842685582
401 2842887202
402 2849140417
403 2857584823
404 2857590906
405 2857607725
406 2857612418
407 2860838527
408 2877769685
409 2880170683
410 2881649713
411 2881649842
412 2897110666
413 2904529633
414 2904562967
415 2908666447
416 2919093439
417 2919148855
418 2919418819
419 2919522321
420 2919725506
421 2919729652
422 2928099201
423 2929009189
424 2929234270
425 2936340809
426 2938918451
427 2947427799
428 2954775159
429 2956900651
430 2960324704
431 2960378137
432 2962291888
433 2965762309
434 2969137934
435 2969142137
436 2969768282
437 2969771718
438 2971894433
439 2977254605
440 2979084719
441 2980493709
442 2990275618
443 3001267166
444 3001272640
445 3001898626
446 3006829421
447 3006859544
448 3006880176
449 3006970937
450 3006974262
451 3006978747
452 3006985924
453 3006990003
454 8022633895
455 8022655099
456 8022798722
457 8022894684
458 8022915154
459 8023443400
460 8023449301
461 8051953496
462 8052177083
463 8054282175
464 8057583809
465 8057633762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

34

80

0.98

PF17932

TetR_C_24

Tetracyclin repressor-like, C-terminal domain

99

213

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8245 5 82
3br6-assembly1.cif.gz_A crystal structure of the complex of rhodamine 6g bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor 0.7989 5 189
3br6-assembly1.cif.gz_A crystal structure of the complex of rhodamine 6g bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor 0.7914 5 189
6en8-assembly1.cif.gz_E safadr in complex with dsdna 0.7785 2 189
3btj-assembly1.cif.gz_A crystal structure of qacr(e58q) bound to dequalinium 0.7779 5 189
ID Description Score Start End Superfamily
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9962 5 47 1.10.10.60
2wv1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9952 1 47 1.10.10.60
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9944 4 47 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9921 7 47 1.10.10.60
5gp9B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9902 7 47 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2G5XLB3-F1-model_v4 TetR family transcriptional regulator 0.9828 5 188 GO:0003677
AF-A0A3B0BRE1-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9788 3 188 GO:0003677
AF-A0A1U7PQH2-F1-model_v4 Transcriptional regulator, TetR family 0.9781 5 188 GO:0003677
AF-A0A127W3L4-F1-model_v4 deleted 0.9756 5 188
AF-D3FZ78-F1-model_v4 TetR family transcriptional regulator 0.9713 1 187 GO:0003677

Map