F344210

General Info

Members Datasets Scaffolds Average Seq Length
231 154 205 164

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100324301|Ga0307409_1003243013
Length 186
Sequence VTEEPPDTPKADDPPAGEPSSRRRARASDGLGDAARPGTGEVTATVIVKAPADVVFAAFTAWERQGDWIPFTKVKVVAGDGGEGSEIEAVTQLGPAVLRDQMRVVQLDPPRTVRVVHYGRVLRGPGVLRCTPMDGNRTQVVWHEWFHLPGGGAGRVAWPVMWPGSKVSLTAALRRFAKLVESGRLP

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
5 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
6 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
7 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
8 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
9 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
10 2855683550 Micromonospora sp. RP3T Isolate Unclassified
11 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
12 2858868258 Micromonospora sp. MH33 Isolate Unclassified
13 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
14 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
15 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
16 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
17 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
18 2902582711 Micromonospora sp. AP08 Isolate Unclassified
19 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
20 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
148 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
149 649633069 Micromonospora sp. L5 Isolate Unclassified
150 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
151 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
152 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
153 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
154 8054704163 Micromonospora trifolii NIE79 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.74
Metatranscriptomes 0
Isolates 11.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0.43
Rhizoplane 3.9
Rhizosphere 86.58
Stem 0
Stem Tuber 0
Unclassified 8.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10025343 3300003203 Bacteria 2304
2 Ga0070683_100002334 3300005329 Bacteria 15051
3 Ga0070683_100012848 3300005329 Bacteria 7286
4 Ga0070670_100401532 3300005331 Bacteria 1210
5 Ga0068869_100035256 3300005334 Bacteria 3545
6 Ga0070680_100328371 3300005336 Bacteria 1299
7 Ga0068868_100610663 3300005338 Bacteria 967
8 Ga0070689_100796526 3300005340 Bacteria 831
9 Ga0070661_100027973 3300005344 Bacteria 4064
10 Ga0070669_100233087 3300005353 Bacteria 1460
11 Ga0070675_100004261 3300005354 Bacteria 10892
12 Ga0070659_100006845 3300005366 Bacteria 8257
13 Ga0070700_100015732 3300005441 Bacteria 4296
14 Ga0070663_100001901 3300005455 Bacteria 11654
15 Ga0070678_100233927 3300005456 Bacteria 1533
16 Ga0070662_100275779 3300005457 Bacteria 1359
17 Ga0070681_10319987 3300005458 Bacteria 1461
18 Ga0070706_100234546 3300005467 Bacteria 1713
19 Ga0070684_100035398 3300005535 Bacteria 4274
20 Ga0070684_100100830 3300005535 Bacteria 2579
21 Ga0070684_101558091 3300005535 Unclassified 623
22 Ga0068853_101463382 3300005539 Bacteria 661
23 Ga0070693_100369831 3300005547 Bacteria 986
24 Ga0070665_100274090 3300005548 Bacteria 1689
25 Ga0070664_100002347 3300005564 Bacteria 15207
26 Ga0070664_100009016 3300005564 Bacteria 8091
27 Ga0068857_100003410 3300005577 Bacteria 13246
28 Ga0068857_100111151 3300005577 Bacteria 2463
29 Ga0068857_101119187 3300005577 Bacteria 761
30 Ga0068852_100123078 3300005616 Bacteria 2378
31 Ga0068859_100380029 3300005617 Bacteria 1508
32 Ga0068864_100027145 3300005618 Bacteria 4832
33 Ga0068864_100050066 3300005618 Bacteria 3595
34 Ga0068864_100130931 3300005618 Bacteria 2253
35 Ga0068864_100229313 3300005618 Bacteria 1717
36 Ga0068866_10634610 3300005718 Bacteria 725
37 Ga0068870_10058347 3300005840 Bacteria 2066
38 Ga0068863_100005394 3300005841 Bacteria 12610
39 Ga0068863_100258818 3300005841 Bacteria 1682
40 Ga0068863_100852755 3300005841 Bacteria 910
41 Ga0068860_100279538 3300005843 Bacteria 1631
42 Ga0068862_100042420 3300005844 Bacteria 3875
43 Ga0081539_10000094 3300005985 Bacteria 206102
44 Ga0075428_100001086 3300006844 Bacteria 28950
45 Ga0075428_100075945 3300006844 Bacteria 3668
46 Ga0075428_100165774 3300006844 Bacteria 2397
47 Ga0075428_100498603 3300006844 Bacteria 1303
48 Ga0075428_100686612 3300006844 Bacteria 1091
49 Ga0075428_101461381 3300006844 Bacteria 717
50 Ga0075430_100039100 3300006846 Bacteria 4018
51 Ga0075431_100006547 3300006847 Bacteria 11573
52 Ga0075431_100043073 3300006847 Bacteria 4658
53 Ga0075431_100163952 3300006847 Bacteria 2285
54 Ga0075429_100777228 3300006880 Bacteria 839
55 Ga0075429_100789530 3300006880 Bacteria 832
56 Ga0068865_100787185 3300006881 Bacteria 819
57 Ga0097620_100380003 3300006931 Bacteria 1508
58 Ga0111539_10049019 3300009094 Bacteria 5040
59 Ga0111539_11191313 3300009094 Unclassified 885
60 Ga0105245_10004745 3300009098 Bacteria 12000
61 Ga0105247_10171552 3300009101 Bacteria 1443
62 Ga0114129_10000278 3300009147 Bacteria 58533
63 Ga0114129_10000585 3300009147 Bacteria 44984
64 Ga0114129_10042290 3300009147 Bacteria 6416
65 Ga0114129_10232130 3300009147 Bacteria 2485
66 Ga0114129_10324365 3300009147 Bacteria 2046
67 Ga0114129_11198401 3300009147 Bacteria 946
68 Ga0114129_11596529 3300009147 Bacteria 799
69 Ga0105243_10527689 3300009148 Bacteria 1124
70 Ga0105241_10567995 3300009174 Bacteria 1021
71 Ga0105248_10164183 3300009177 Bacteria 2504
72 Ga0105248_10247506 3300009177 Bacteria 2007
73 Ga0105249_10145064 3300009553 Bacteria 2280
74 Ga0105239_10503455 3300010375 Bacteria 1377
75 Ga0105246_10156051 3300011119 Bacteria 1733
76 Ga0163162_10257381 3300013306 Bacteria 1877
77 Ga0157372_11183461 3300013307 Bacteria 883
78 Ga0157372_12026661 3300013307 Bacteria 661
79 Ga0157375_10178270 3300013308 Bacteria 2276
80 Ga0163163_10050533 3300014325 Bacteria 4094
81 Ga0163163_10325652 3300014325 Bacteria 1590
82 Ga0157380_10266962 3300014326 Bacteria 1558
83 Ga0157377_10015216 3300014745 Bacteria 3929
84 Ga0157379_10208797 3300014968 Bacteria 1767
85 Ga0207688_10089101 3300025901 Bacteria 1770
86 Ga0207643_10047396 3300025908 Bacteria 2431
87 Ga0207684_10345050 3300025910 Bacteria 1282
88 Ga0207707_10279503 3300025912 Bacteria 1446
89 Ga0207660_10538598 3300025917 Bacteria 949
90 Ga0207649_10049476 3300025920 Bacteria 2596
91 Ga0207650_10195481 3300025925 Bacteria 1618
92 Ga0207659_10011326 3300025926 Bacteria 5633
93 Ga0207687_10155006 3300025927 Bacteria 1752
94 Ga0207690_10018138 3300025932 Bacteria 4313
95 Ga0207706_10090133 3300025933 Bacteria 2696
96 Ga0207670_10822760 3300025936 Bacteria 775
97 Ga0207670_11249579 3300025936 Bacteria 629
98 Ga0207704_11547118 3300025938 Bacteria 569
99 Ga0207711_10068994 3300025941 Bacteria 3063
100 Ga0207711_10560695 3300025941 Bacteria 1065
101 Ga0207711_10855232 3300025941 Unclassified 846
102 Ga0207689_10023865 3300025942 Bacteria 5130
103 Ga0207689_10203161 3300025942 Bacteria 1636
104 Ga0207661_10010046 3300025944 Bacteria 6801
105 Ga0207661_10025185 3300025944 Bacteria 4521
106 Ga0207679_10016240 3300025945 Bacteria 4940
107 Ga0207712_10078009 3300025961 Bacteria 2402
108 Ga0207668_10468459 3300025972 Bacteria 1078
109 Ga0207677_10107198 3300026023 Bacteria 2072
110 Ga0207678_10004142 3300026067 Bacteria 13031
111 Ga0207708_10004796 3300026075 Bacteria 9961
112 Ga0207641_10221479 3300026088 Bacteria 1755
113 Ga0207641_10749493 3300026088 Bacteria 964
114 Ga0207676_10174396 3300026095 Bacteria 1876
115 Ga0207676_10180491 3300026095 Bacteria 1848
116 Ga0207676_10194558 3300026095 Bacteria 1787
117 Ga0207674_10007216 3300026116 Bacteria 12967
118 Ga0207674_10130803 3300026116 Bacteria 2473
119 Ga0207674_10257220 3300026116 Bacteria 1693
120 Ga0207675_100130091 3300026118 Bacteria 2386
121 Ga0207683_10540999 3300026121 Bacteria 1077
122 Ga0207698_10016662 3300026142 Bacteria 4964
123 Ga0207428_10061270 3300027907 Bacteria 2979
124 Ga0268266_10814666 3300028379 Bacteria 902
125 Ga0268265_10028178 3300028380 Bacteria 4019
126 Ga0268265_11560774 3300028380 Bacteria 665
127 Ga0268264_10564615 3300028381 Bacteria 1118
128 Ga0307517_10406387 3300028786 Bacteria 719
129 Ga0307513_10144722 3300031456 Bacteria 2297
130 Ga0307513_10590682 3300031456 Bacteria 820
131 Ga0307408_100318493 3300031548 Bacteria 1309
132 Ga0307508_10015761 3300031616 Bacteria 6887
133 Ga0307405_10001012 3300031731 Bacteria 11359
134 Ga0307405_11048256 3300031731 Bacteria 698
135 Ga0307413_10050805 3300031824 Bacteria 2494
136 Ga0307410_10022462 3300031852 Bacteria 3901
137 Ga0307410_10028510 3300031852 Bacteria 3543
138 Ga0307406_10051216 3300031901 Bacteria 2621
139 Ga0307406_10142409 3300031901 Bacteria 1699
140 Ga0307406_10711380 3300031901 Bacteria 840
141 Ga0307412_10270618 3300031911 Bacteria 1329
142 Ga0307412_10476768 3300031911 Bacteria 1034
143 Ga0307409_100000392 3300031995 Bacteria 18558
144 Ga0307409_100176476 3300031995 Bacteria 1886
145 Ga0307409_100324301 3300031995 Bacteria 1443
146 Ga0307416_100001718 3300032002 Bacteria 12121
147 Ga0307416_100424532 3300032002 Bacteria 1375
148 Ga0307416_101480049 3300032002 Bacteria 785
149 Ga0307415_100000002 3300032126 Bacteria 133560
150 Ga0307415_100009381 3300032126 Bacteria 5480
151 Ga0307415_100015928 3300032126 Bacteria 4465
152 Ga0307415_100017631 3300032126 Bacteria 4286
153 Ga0307415_100050393 3300032126 Bacteria 2821
154 Ga0307415_100126321 3300032126 Bacteria 1928
155 Ga0307415_100325683 3300032126 Bacteria 1283
156 Ga0307415_100466428 3300032126 Bacteria 1096
157 Ga0307415_100499601 3300032126 Bacteria 1063
158 Ga0373955_0524628 3300035172 Bacteria 724
159 Ga0495603_0239140 3300046455 Bacteria 1046
160 Ga0495629_0132932 3300046459 Bacteria 1733
161 Ga0495662_0394226 3300046476 Bacteria 680
162 Ga0495594_0017538 3300046499 Bacteria 3783
163 Ga0495594_0052784 3300046499 Bacteria 2238
164 Ga0495606_0011327 3300046507 Bacteria 7286
165 Ga0495630_0786865 3300046517 Bacteria 726
166 Ga0495665_0273618 3300046531 Bacteria 867
167 Ga0495668_0000818 3300046616 Bacteria 35712
168 Ga0495625_0001540 3300046660 Bacteria 27551
169 Ga0495683_0075054 3300047323 Bacteria 1656
170 Ga0495626_0000116 3300048091 Bacteria 104938
171 Ga0496105_0610802 3300048908 Bacteria 845
172 Ga0496108_0158313 3300048911 Bacteria 1956
173 Ga0496108_1004005 3300048911 Bacteria 713
174 Ga0496110_1628462 3300048913 Bacteria 556
175 Ga0496111_0008476 3300048914 Bacteria 6808
176 Ga0496112_0005211 3300048915 Bacteria 11186
177 Ga0496112_0007924 3300048915 Bacteria 9465
178 Ga0496113_0000980 3300048916 Bacteria 15225
179 Ga0496113_0218979 3300048916 Bacteria 1517
180 Ga0501042_0809965 3300049578 Bacteria 682
181 Ga0501048_0855276 3300049582 Bacteria 654
182 Ga0501081_0470026 3300049743 Bacteria 935
183 nmdc:mga05p37_10344_c1 3300050507 Bacteria 11078
184 nmdc:mga05p37_1652803_c1 3300050507 Bacteria 627
185 nmdc:mga05p37_1684_c1 3300050507 Bacteria 25717
186 nmdc:mga05p37_3882_c1 3300050507 Bacteria 17482
187 nmdc:mga05p37_421331_c1 3300050507 Bacteria 1553
188 nmdc:mga05p37_592826_c1 3300050507 Bacteria 1252
189 nmdc:mga05p37_791001_c1 3300050507 Bacteria 1039
190 nmdc:mga05p37_973971_c1 3300050507 Bacteria 905
191 nmdc:mga09592_241201_c1 3300050508 Bacteria 1566
192 nmdc:mga09592_385819_c1 3300050508 Bacteria 1211
193 nmdc:mga09592_519990_c1 3300050508 Bacteria 1024
194 nmdc:mga09592_62_c1 3300050508 Bacteria 60818
195 nmdc:mga09592_647174_c1 3300050508 Bacteria 903
196 nmdc:mga0qj67_106_c2 3300050509 Bacteria 34014
197 nmdc:mga0qj67_32293_c1 3300050509 Bacteria 4081
198 nmdc:mga06r32_1433_c1 3300050510 Bacteria 21539
199 nmdc:mga06r32_14871_c1 3300050510 Bacteria 7061
200 nmdc:mga06r32_16515_c1 3300050510 Bacteria 6060
201 nmdc:mga06r32_191458_c1 3300050510 Bacteria 2033
202 nmdc:mga08y16_36122_c1 3300050511 Bacteria 5189
203 nmdc:mga08x19_680830_c1 3300050514 Bacteria 730
204 Ga0500641_0154760 3300053096 Bacteria 989
205 Ga0500594_0034956 3300053118 Bacteria 1345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2887478801 2887486926 145
2 iso_pu_bacteria 8001781756 8001785258 145
3 3300005340 Ga0070689_100796526 Ga0070689_1007965262 146
4 3300005617 Ga0068859_100380029 Ga0068859_1003800292 146
5 3300006931 Ga0097620_100380003 Ga0097620_1003800032 146
6 3300025936 Ga0207670_10822760 Ga0207670_108227602 146
7 3300005535 Ga0070684_101558091 Ga0070684_1015580911 147
8 3300006844 Ga0075428_100686612 Ga0075428_1006866122 147
9 3300006847 Ga0075431_100163952 Ga0075431_1001639524 147
10 3300006880 Ga0075429_100777228 Ga0075429_1007772281 147
11 3300013307 Ga0157372_11183461 Ga0157372_111834612 147
12 3300035172 Ga0373955_0524628 Ga0373955_0524628_107_586 147
13 3300049743 Ga0501081_0470026 Ga0501081_0470026_451_921 147
14 3300050507 nmdc:mga05p37_791001_c1 nmdc:mga05p37_791001_c1_27_497 147
15 3300050508 nmdc:mga09592_647174_c1 nmdc:mga09592_647174_c1_360_830 147
16 3300050510 nmdc:mga06r32_16515_c1 nmdc:mga06r32_16515_c1_3550_4020 147
17 iso_pu_bacteria 2501939600 2501941818 148
18 iso_pu_bacteria 2622736626 2623586406 148
19 iso_pu_bacteria 2675903059 2676484894 148
20 iso_pu_bacteria 2772190715 2772641647 148
21 iso_pu_bacteria 2831935698 2831939882 148
22 iso_pu_bacteria 2832004796 2832007998 148
23 iso_pu_bacteria 2855683550 2855685268 148
24 iso_pu_bacteria 2856858025 2856860327 148
25 iso_pu_bacteria 2858868258 2858874100 148
26 iso_pu_bacteria 2858902515 2858905617 148
27 iso_pu_bacteria 2866065130 2866070502 148
28 iso_pu_bacteria 2867302475 2867303781 148
29 iso_pu_bacteria 2867507094 2867509291 148
30 iso_pu_bacteria 2902582711 2902586421 148
31 iso_pu_bacteria 2929219909 2929220539 148
32 iso_pu_bacteria 2996221748 2996224768 148
33 iso_pu_bacteria 649633069 649811066 148
34 iso_pu_bacteria 8003830390 8003835363 148
35 iso_pu_bacteria 8003856774 8003859285 148
36 iso_pu_bacteria 8003870546 8003877530 148
37 iso_pu_bacteria 8054704163 8054710244 148
38 3300005353 Ga0070669_100233087 Ga0070669_1002330872 149
39 3300005577 Ga0068857_101119187 Ga0068857_1011191871 149
40 3300005618 Ga0068864_100027145 Ga0068864_1000271456 149
41 3300005618 Ga0068864_100229313 Ga0068864_1002293132 149
42 3300006844 Ga0075428_100165774 Ga0075428_1001657744 149
43 3300009094 Ga0111539_11191313 Ga0111539_111913131 149
44 3300009147 Ga0114129_10324365 Ga0114129_103243652 149
45 3300009177 Ga0105248_10247506 Ga0105248_102475062 149
46 3300014325 Ga0163163_10050533 Ga0163163_100505332 149
47 3300014968 Ga0157379_10208797 Ga0157379_102087973 149
48 3300025936 Ga0207670_11249579 Ga0207670_112495792 149
49 3300025941 Ga0207711_10068994 Ga0207711_100689944 149
50 3300025941 Ga0207711_10560695 Ga0207711_105606952 149
51 3300026095 Ga0207676_10174396 Ga0207676_101743962 149
52 3300026116 Ga0207674_10257220 Ga0207674_102572202 149
53 3300028380 Ga0268265_11560774 Ga0268265_115607741 149
54 3300031548 Ga0307408_100318493 Ga0307408_1003184932 149
55 3300031731 Ga0307405_10001012 Ga0307405_100010123 149
56 3300031731 Ga0307405_11048256 Ga0307405_110482562 149
57 3300031824 Ga0307413_10050805 Ga0307413_100508054 149
58 3300031852 Ga0307410_10028510 Ga0307410_100285104 149
59 3300031901 Ga0307406_10051216 Ga0307406_100512161 149
60 3300031911 Ga0307412_10270618 Ga0307412_102706182 149
61 3300031995 Ga0307409_100000392 Ga0307409_1000003927 149
62 3300031995 Ga0307409_100176476 Ga0307409_1001764762 149
63 3300032002 Ga0307416_100001718 Ga0307416_1000017183 149
64 3300032002 Ga0307416_100424532 Ga0307416_1004245322 149
65 3300032126 Ga0307415_100000002 Ga0307415_10000000221 149
66 3300032126 Ga0307415_100009381 Ga0307415_1000093817 149
67 3300032126 Ga0307415_100017631 Ga0307415_1000176315 149
68 3300032126 Ga0307415_100499601 Ga0307415_1004996012 149
69 3300046459 Ga0495629_0132932 Ga0495629_0132932_723_1205 149
70 3300046476 Ga0495662_0394226 Ga0495662_0394226_123_605 149
71 3300046499 Ga0495594_0017538 Ga0495594_0017538_2412_2906 149
72 3300046507 Ga0495606_0011327 Ga0495606_0011327_5376_5852 149
73 3300046517 Ga0495630_0786865 Ga0495630_0786865_59_541 149
74 3300046531 Ga0495665_0273618 Ga0495665_0273618_88_570 149
75 3300046616 Ga0495668_0000818 Ga0495668_0000818_6050_6526 149
76 3300046660 Ga0495625_0001540 Ga0495625_0001540_24699_25175 149
77 3300047323 Ga0495683_0075054 Ga0495683_0075054_47_523 149
78 3300048091 Ga0495626_0000116 Ga0495626_0000116_64586_65062 149
79 3300048908 Ga0496105_0610802 Ga0496105_0610802_96_578 149
80 3300048911 Ga0496108_0158313 Ga0496108_0158313_459_941 149
81 3300048913 Ga0496110_1628462 Ga0496110_1628462_46_522 149
82 3300048914 Ga0496111_0008476 Ga0496111_0008476_3476_3958 149
83 3300048916 Ga0496113_0000980 Ga0496113_0000980_9784_10266 149
84 3300050507 nmdc:mga05p37_592826_c1 nmdc:mga05p37_592826_c1_587_1072 149
85 3300050507 nmdc:mga05p37_973971_c1 nmdc:mga05p37_973971_c1_250_735 149
86 3300006844 Ga0075428_100001086 Ga0075428_1000010869 150
87 3300006844 Ga0075428_100498603 Ga0075428_1004986032 150
88 3300006847 Ga0075431_100006547 Ga0075431_10000654710 150
89 3300006880 Ga0075429_100789530 Ga0075429_1007895302 150
90 3300009147 Ga0114129_10000585 Ga0114129_1000058518 150
91 3300009147 Ga0114129_10042290 Ga0114129_100422904 150
92 3300031901 Ga0307406_10711380 Ga0307406_107113802 150
93 3300050507 nmdc:mga05p37_10344_c1 nmdc:mga05p37_10344_c1_7205_7690 150
94 3300050507 nmdc:mga05p37_3882_c1 nmdc:mga05p37_3882_c1_5525_6022 150
95 3300050508 nmdc:mga09592_519990_c1 nmdc:mga09592_519990_c1_204_689 150
96 3300050508 nmdc:mga09592_62_c1 nmdc:mga09592_62_c1_37137_37634 150
97 3300050509 nmdc:mga0qj67_106_c2 nmdc:mga0qj67_106_c2_26359_26856 150
98 3300050510 nmdc:mga06r32_1433_c1 nmdc:mga06r32_1433_c1_19964_20461 150
99 3300005548 Ga0070665_100274090 Ga0070665_1002740902 151
100 3300005618 Ga0068864_100050066 Ga0068864_1000500665 151
101 3300005841 Ga0068863_100005394 Ga0068863_10000539412 151
102 3300009101 Ga0105247_10171552 Ga0105247_101715521 151
103 3300014325 Ga0163163_10325652 Ga0163163_103256522 151
104 3300025941 Ga0207711_10855232 Ga0207711_108552322 151
105 3300026095 Ga0207676_10180491 Ga0207676_101804912 151
106 3300028379 Ga0268266_10814666 Ga0268266_108146661 151
107 3300031616 Ga0307508_10015761 Ga0307508_100157617 151
108 3300046499 Ga0495594_0052784 Ga0495594_0052784_1533_2021 151
109 3300048911 Ga0496108_1004005 Ga0496108_1004005_91_579 151
110 3300048915 Ga0496112_0005211 Ga0496112_0005211_529_1017 151
111 3300048915 Ga0496112_0007924 Ga0496112_0007924_8555_9043 151
112 3300048916 Ga0496113_0218979 Ga0496113_0218979_527_1015 151
113 3300003203 JGI25406J46586_10025343 JGI25406J46586_100253433 152
114 3300005329 Ga0070683_100002334 Ga0070683_10000233413 152
115 3300005329 Ga0070683_100012848 Ga0070683_1000128485 152
116 3300005331 Ga0070670_100401532 Ga0070670_1004015322 152
117 3300005334 Ga0068869_100035256 Ga0068869_1000352563 152
118 3300005336 Ga0070680_100328371 Ga0070680_1003283712 152
119 3300005338 Ga0068868_100610663 Ga0068868_1006106632 152
120 3300005344 Ga0070661_100027973 Ga0070661_1000279735 152
121 3300005354 Ga0070675_100004261 Ga0070675_1000042614 152
122 3300005366 Ga0070659_100006845 Ga0070659_1000068457 152
123 3300005441 Ga0070700_100015732 Ga0070700_1000157324 152
124 3300005455 Ga0070663_100001901 Ga0070663_1000019019 152
125 3300005456 Ga0070678_100233927 Ga0070678_1002339273 152
126 3300005457 Ga0070662_100275779 Ga0070662_1002757793 152
127 3300005458 Ga0070681_10319987 Ga0070681_103199871 152
128 3300005467 Ga0070706_100234546 Ga0070706_1002345462 152
129 3300005535 Ga0070684_100035398 Ga0070684_1000353983 152
130 3300005535 Ga0070684_100100830 Ga0070684_1001008303 152
131 3300005539 Ga0068853_101463382 Ga0068853_1014633821 152
132 3300005547 Ga0070693_100369831 Ga0070693_1003698312 152
133 3300005564 Ga0070664_100002347 Ga0070664_1000023473 152
134 3300005564 Ga0070664_100009016 Ga0070664_1000090164 152
135 3300005577 Ga0068857_100003410 Ga0068857_10000341010 152
136 3300005577 Ga0068857_100111151 Ga0068857_1001111512 152
137 3300005616 Ga0068852_100123078 Ga0068852_1001230782 152
138 3300005618 Ga0068864_100130931 Ga0068864_1001309312 152
139 3300005718 Ga0068866_10634610 Ga0068866_106346102 152
140 3300005840 Ga0068870_10058347 Ga0068870_100583473 152
141 3300005841 Ga0068863_100258818 Ga0068863_1002588182 152
142 3300005841 Ga0068863_100852755 Ga0068863_1008527552 152
143 3300005843 Ga0068860_100279538 Ga0068860_1002795382 152
144 3300005844 Ga0068862_100042420 Ga0068862_1000424205 152
145 3300005985 Ga0081539_10000094 Ga0081539_10000094116 152
146 3300006844 Ga0075428_100075945 Ga0075428_1000759451 152
147 3300006844 Ga0075428_101461381 Ga0075428_1014613812 152
148 3300006846 Ga0075430_100039100 Ga0075430_1000391003 152
149 3300006847 Ga0075431_100043073 Ga0075431_1000430736 152
150 3300006881 Ga0068865_100787185 Ga0068865_1007871852 152
151 3300009094 Ga0111539_10049019 Ga0111539_100490196 152
152 3300009098 Ga0105245_10004745 Ga0105245_100047456 152
153 3300009147 Ga0114129_10000278 Ga0114129_1000027829 152
154 3300009147 Ga0114129_10232130 Ga0114129_102321302 152
155 3300009147 Ga0114129_11198401 Ga0114129_111984012 152
156 3300009147 Ga0114129_11596529 Ga0114129_115965292 152
157 3300009148 Ga0105243_10527689 Ga0105243_105276892 152
158 3300009174 Ga0105241_10567995 Ga0105241_105679952 152
159 3300009177 Ga0105248_10164183 Ga0105248_101641832 152
160 3300009553 Ga0105249_10145064 Ga0105249_101450642 152
161 3300010375 Ga0105239_10503455 Ga0105239_105034552 152
162 3300011119 Ga0105246_10156051 Ga0105246_101560512 152
163 3300013306 Ga0163162_10257381 Ga0163162_102573811 152
164 3300013307 Ga0157372_12026661 Ga0157372_120266612 152
165 3300013308 Ga0157375_10178270 Ga0157375_101782702 152
166 3300014326 Ga0157380_10266962 Ga0157380_102669622 152
167 3300014745 Ga0157377_10015216 Ga0157377_100152164 152
168 3300025901 Ga0207688_10089101 Ga0207688_100891013 152
169 3300025908 Ga0207643_10047396 Ga0207643_100473964 152
170 3300025910 Ga0207684_10345050 Ga0207684_103450502 152
171 3300025912 Ga0207707_10279503 Ga0207707_102795032 152
172 3300025917 Ga0207660_10538598 Ga0207660_105385982 152
173 3300025920 Ga0207649_10049476 Ga0207649_100494763 152
174 3300025925 Ga0207650_10195481 Ga0207650_101954812 152
175 3300025926 Ga0207659_10011326 Ga0207659_100113264 152
176 3300025927 Ga0207687_10155006 Ga0207687_101550062 152
177 3300025932 Ga0207690_10018138 Ga0207690_100181384 152
178 3300025933 Ga0207706_10090133 Ga0207706_100901334 152
179 3300025938 Ga0207704_11547118 Ga0207704_115471181 152
180 3300025942 Ga0207689_10023865 Ga0207689_100238654 152
181 3300025942 Ga0207689_10203161 Ga0207689_102031612 152
182 3300025944 Ga0207661_10010046 Ga0207661_100100464 152
183 3300025944 Ga0207661_10025185 Ga0207661_100251855 152
184 3300025945 Ga0207679_10016240 Ga0207679_100162404 152
185 3300025961 Ga0207712_10078009 Ga0207712_100780092 152
186 3300025972 Ga0207668_10468459 Ga0207668_104684592 152
187 3300026023 Ga0207677_10107198 Ga0207677_101071981 152
188 3300026067 Ga0207678_10004142 Ga0207678_100041425 152
189 3300026075 Ga0207708_10004796 Ga0207708_100047964 152
190 3300026088 Ga0207641_10221479 Ga0207641_102214792 152
191 3300026088 Ga0207641_10749493 Ga0207641_107494932 152
192 3300026095 Ga0207676_10194558 Ga0207676_101945583 152
193 3300026116 Ga0207674_10007216 Ga0207674_1000721610 152
194 3300026116 Ga0207674_10130803 Ga0207674_101308032 152
195 3300026118 Ga0207675_100130091 Ga0207675_1001300914 152
196 3300026121 Ga0207683_10540999 Ga0207683_105409992 152
197 3300026142 Ga0207698_10016662 Ga0207698_100166625 152
198 3300027907 Ga0207428_10061270 Ga0207428_100612704 152
199 3300028380 Ga0268265_10028178 Ga0268265_100281784 152
200 3300028381 Ga0268264_10564615 Ga0268264_105646152 152
201 3300028786 Ga0307517_10406387 Ga0307517_104063872 152
202 3300031456 Ga0307513_10144722 Ga0307513_101447222 152
203 3300031456 Ga0307513_10590682 Ga0307513_105906822 152
204 3300031852 Ga0307410_10022462 Ga0307410_100224626 152
205 3300031901 Ga0307406_10142409 Ga0307406_101424092 152
206 3300031911 Ga0307412_10476768 Ga0307412_104767682 152
207 3300031995 Ga0307409_100324301 Ga0307409_1003243013 152
208 3300032002 Ga0307416_101480049 Ga0307416_1014800492 152
209 3300032126 Ga0307415_100015928 Ga0307415_1000159284 152
210 3300032126 Ga0307415_100050393 Ga0307415_1000503934 152
211 3300032126 Ga0307415_100126321 Ga0307415_1001263212 152
212 3300032126 Ga0307415_100325683 Ga0307415_1003256831 152
213 3300032126 Ga0307415_100466428 Ga0307415_1004664282 152
214 3300046455 Ga0495603_0239140 Ga0495603_0239140_202_699 152
215 3300049578 Ga0501042_0809965 Ga0501042_0809965_39_539 152
216 3300049582 Ga0501048_0855276 Ga0501048_0855276_119_640 152
217 3300050507 nmdc:mga05p37_1652803_c1 nmdc:mga05p37_1652803_c1_108_602 152
218 3300050507 nmdc:mga05p37_1684_c1 nmdc:mga05p37_1684_c1_17024_17527 152
219 3300050507 nmdc:mga05p37_421331_c1 nmdc:mga05p37_421331_c1_1015_1509 152
220 3300050508 nmdc:mga09592_241201_c1 nmdc:mga09592_241201_c1_661_1170 152
221 3300050508 nmdc:mga09592_385819_c1 nmdc:mga09592_385819_c1_26_520 152
222 3300050509 nmdc:mga0qj67_32293_c1 nmdc:mga0qj67_32293_c1_2801_3307 152
223 3300050510 nmdc:mga06r32_14871_c1 nmdc:mga06r32_14871_c1_4888_5382 152
224 3300050510 nmdc:mga06r32_191458_c1 nmdc:mga06r32_191458_c1_604_1110 152
225 3300050511 nmdc:mga08y16_36122_c1 nmdc:mga08y16_36122_c1_1375_1884 152
226 3300050514 nmdc:mga08x19_680830_c1 nmdc:mga08x19_680830_c1_203_691 152
227 3300053096 Ga0500641_0154760 Ga0500641_0154760_328_813 152
228 3300053118 Ga0500594_0034956 Ga0500594_0034956_138_623 152
229 iso_pu_bacteria 2515154088 2515493945 152
230 iso_pu_bacteria 2515154137 2515755321 152
231 iso_pu_bacteria 2515154203 2516092367 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

39

181

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tl1-assembly2.cif.gz_B crystal structure of the streptomyces coelicolor whie orfvi polyketide aromatase/cyclase 0.8228 14 150
7z1r-assembly1.cif.gz_D000 x-ray crystal structure of slpyl1-e151d mutant aba complex 0.8183 11 149
4n0g-assembly1.cif.gz_C crystal structure of pyl13-pp2ca complex 0.8117 16 150
2pcs-assembly1.cif.gz_A crystal structure of conserved protein from geobacillus kaustophilus 0.8054 16 150
6ka2-assembly1.cif.gz_B crystal structure of a thebaine synthase from papaver somniferum in complex with tbn 0.8049 15 149
ID Description Score Start End Superfamily
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8737 17 150 3.30.530.20
af_Q9M073_3_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8582 16 149 3.30.530.20
af_A0A1D6NAC7_96_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8423 16 147 3.30.530.20
af_Q94K52_78_219_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8272 17 149 3.30.530.20
af_A0A1D8PLT3_1_151_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8267 16 148 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7W7SRR5-F1-model_v4 Putative membrane protein 0.9557 4 152
AF-A0A2G4FZJ3-F1-model_v4 SRPBCC family protein 0.9506 16 145 GO:0016020
AF-A0A6V8LAL5-F1-model_v4 Polyketide cyclase 0.9502 1 152
AF-W7VQ83-F1-model_v4 deleted 0.9497 1 152
AF-A0A840NGP2-F1-model_v4 Polyketide cyclase/dehydrase/lipid transport protein 0.9458 16 147

Feature Viewer

pLDDT pTM Quality
90.82 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map