F344187

General Info

Members Datasets Scaffolds Average Seq Length
231 115 231 311

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000981|Ga0265327_100009815
Length 307
Sequence MSKTAILFAGQGAQVVGMGKDLAEKFPSARAWFDRANAALGYDLASICFNGPEADLTKTENAQPGIFLVSWVCLQLLKEQVPHLKFDATAGLSLGEFTALTAAGAMSFEDGLRVVRQRGKFMQEACDVTKGGMAAVIGLDEAPTREVCAEAGIVLANLNCPGQLVISGEADKIARACELAKARGAKRAIPLPVAGAYHSPLMASAQPKLREELARITISVPAVLVISNVTAQVHGSDISVRLVEQVCASVRWEESMRALLAQGYTRFIELGPGTALSGFMKRIDKTATMLNVADAASLETTAKALAA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
41 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
42 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
51 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
52 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
56 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
69 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
70 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
71 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
72 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
75 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 0.87
Rhizosphere 98.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10413414 3300005327 Bacteria 1159
2 Ga0070683_100446693 3300005329 Bacteria 1234
3 Ga0070690_100277554 3300005330 Unclassified 1194
4 Ga0070680_100152492 3300005336 Bacteria 1940
5 Ga0070689_100102378 3300005340 Bacteria 2268
6 Ga0070687_100061333 3300005343 Bacteria 1988
7 Ga0070711_100025928 3300005439 Bacteria 3838
8 Ga0070681_10016003 3300005458 Bacteria 7478
9 Ga0070681_10116898 3300005458 Unclassified 2603
10 Ga0070679_100343737 3300005530 Bacteria 1440
11 Ga0070672_100223387 3300005543 Bacteria 1580
12 Ga0070686_100000544 3300005544 Bacteria 22500
13 Ga0070686_100089370 3300005544 Unclassified 2058
14 Ga0068855_100117335 3300005563 Bacteria 3049
15 Ga0068855_100151031 3300005563 Bacteria 2641
16 Ga0068855_100213791 3300005563 Unclassified 2166
17 Ga0068857_100016838 3300005577 Bacteria 6403
18 Ga0068857_100469486 3300005577 Unclassified 1178
19 Ga0068856_100000058 3300005614 Bacteria 101767
20 Ga0068856_100035919 3300005614 Bacteria 4858
21 Ga0068863_100054734 3300005841 Bacteria 3780
22 Ga0068863_100083361 3300005841 Bacteria 3030
23 Ga0068863_100116776 3300005841 Unclassified 2543
24 Ga0068863_100271001 3300005841 Unclassified 1643
25 Ga0068858_100113786 3300005842 Bacteria 2527
26 Ga0075428_100598360 3300006844 Bacteria 1178
27 Ga0075434_100218463 3300006871 Unclassified 1926
28 Ga0105240_10007319 3300009093 Bacteria 16060
29 Ga0105240_10065947 3300009093 Bacteria 4493
30 Ga0105240_10114604 3300009093 Bacteria 3256
31 Ga0105240_10329674 3300009093 Bacteria 1737
32 Ga0111539_10004377 3300009094 Bacteria 18480
33 Ga0105241_10159210 3300009174 Bacteria 1854
34 Ga0105242_10225579 3300009176 Bacteria 1676
35 Ga0105242_10253112 3300009176 Unclassified 1588
36 Ga0105238_10015021 3300009551 Bacteria 7841
37 Ga0157374_10482652 3300013296 Unclassified 1243
38 Ga0157378_10226985 3300013297 Unclassified 1778
39 Ga0157372_10208715 3300013307 Bacteria 2263
40 Ga0157372_10258206 3300013307 Bacteria 2023
41 Ga0157375_10278356 3300013308 Unclassified 1836
42 Ga0163163_10000153 3300014325 Bacteria 71877
43 Ga0163163_10107637 3300014325 Unclassified 2814
44 Ga0163163_10296093 3300014325 Unclassified 1670
45 Ga0157376_10170223 3300014969 Bacteria 1983
46 Ga0207705_10276337 3300025909 Bacteria 1285
47 Ga0207707_10046320 3300025912 Bacteria 3787
48 Ga0207707_10380430 3300025912 Unclassified 1213
49 Ga0207695_10060086 3300025913 Bacteria 3937
50 Ga0207695_10117363 3300025913 Bacteria 2634
51 Ga0207663_10015974 3300025916 Bacteria 4153
52 Ga0207652_10261577 3300025921 Bacteria 1561
53 Ga0207652_10271258 3300025921 Bacteria 1530
54 Ga0207670_10019194 3300025936 Bacteria 4170
55 Ga0207670_10033305 3300025936 Bacteria 3319
56 Ga0207667_10026474 3300025949 Bacteria 6336
57 Ga0207667_10495791 3300025949 Unclassified 1239
58 Ga0207702_10004230 3300026078 Bacteria 12823
59 Ga0207702_10101449 3300026078 Bacteria 2541
60 Ga0207702_10157216 3300026078 Bacteria 2073
61 Ga0207702_10216370 3300026078 Bacteria 1783
62 Ga0207641_10009837 3300026088 Bacteria 7875
63 Ga0207641_10395203 3300026088 Unclassified 1326
64 Ga0207674_10023918 3300026116 Bacteria 6534
65 Ga0207428_10054717 3300027907 Bacteria 3177
66 Ga0265337_1000362 3300028556 Bacteria 24298
67 Ga0265337_1002211 3300028556 Bacteria 9050
68 Ga0265337_1003123 3300028556 Bacteria 7301
69 Ga0265337_1004667 3300028556 Bacteria 5633
70 Ga0265337_1005745 3300028556 Bacteria 4874
71 Ga0265337_1013747 3300028556 Bacteria 2704
72 Ga0265337_1030952 3300028556 Bacteria 1591
73 Ga0265326_10004921 3300028558 Bacteria 4232
74 Ga0265326_10013426 3300028558 Bacteria 2397
75 Ga0265326_10024562 3300028558 Bacteria 1720
76 Ga0265319_1000003 3300028563 Bacteria 340561
77 Ga0265319_1009496 3300028563 Bacteria 4138
78 Ga0265319_1029763 3300028563 Bacteria 1915
79 Ga0265334_10015674 3300028573 Bacteria 3145
80 Ga0265334_10025292 3300028573 Bacteria 2404
81 Ga0265334_10069728 3300028573 Unclassified 1311
82 Ga0265323_10000183 3300028653 Bacteria 37704
83 Ga0265323_10057215 3300028653 Bacteria 1365
84 Ga0265322_10018505 3300028654 Unclassified 2002
85 Ga0265336_10001917 3300028666 Bacteria 8985
86 Ga0265336_10005083 3300028666 Bacteria 4894
87 Ga0265336_10056437 3300028666 Unclassified 1180
88 Ga0265338_10000184 3300028800 Bacteria 116834
89 Ga0265338_10000494 3300028800 Bacteria 70344
90 Ga0265338_10000701 3300028800 Bacteria 57480
91 Ga0265338_10001968 3300028800 Bacteria 31992
92 Ga0265338_10002298 3300028800 Bacteria 29060
93 Ga0265338_10003664 3300028800 Bacteria 21402
94 Ga0265338_10004075 3300028800 Bacteria 20013
95 Ga0265338_10004684 3300028800 Bacteria 18348
96 Ga0265338_10018948 3300028800 Bacteria 7335
97 Ga0265338_10019116 3300028800 Bacteria 7291
98 Ga0265338_10021119 3300028800 Bacteria 6806
99 Ga0265338_10028324 3300028800 Bacteria 5589
100 Ga0265338_10030385 3300028800 Bacteria 5323
101 Ga0265338_10032158 3300028800 Bacteria 5126
102 Ga0265338_10042182 3300028800 Bacteria 4254
103 Ga0265338_10061304 3300028800 Bacteria 3297
104 Ga0265338_10066196 3300028800 Bacteria 3128
105 Ga0265324_10000744 3300029957 Bacteria 21661
106 Ga0265324_10004698 3300029957 Bacteria 6066
107 Ga0265324_10005217 3300029957 Bacteria 5658
108 Ga0265324_10013218 3300029957 Bacteria 3085
109 Ga0265324_10030343 3300029957 Bacteria 1897
110 Ga0265330_10039335 3300031235 Bacteria 2101
111 Ga0265330_10044268 3300031235 Bacteria 1966
112 Ga0265332_10009837 3300031238 Unclassified 4262
113 Ga0265328_10098393 3300031239 Bacteria 1083
114 Ga0265320_10000296 3300031240 Bacteria 40524
115 Ga0265320_10000488 3300031240 Bacteria 31056
116 Ga0265320_10002276 3300031240 Bacteria 13481
117 Ga0265325_10010961 3300031241 Bacteria 5222
118 Ga0265325_10019802 3300031241 Bacteria 3715
119 Ga0265325_10020776 3300031241 Bacteria 3615
120 Ga0265329_10005554 3300031242 Bacteria 5084
121 Ga0265340_10004729 3300031247 Bacteria 7568
122 Ga0265340_10021244 3300031247 Bacteria 3329
123 Ga0265340_10066718 3300031247 Bacteria 1711
124 Ga0265339_10007696 3300031249 Bacteria 6930
125 Ga0265331_10047608 3300031250 Bacteria 2063
126 Ga0265327_10000981 3300031251 Bacteria 40636
127 Ga0265327_10002162 3300031251 Bacteria 21650
128 Ga0265327_10018606 3300031251 Bacteria 4298
129 Ga0265327_10020020 3300031251 Bacteria 4094
130 Ga0265316_10017392 3300031344 Bacteria 6217
131 Ga0265316_10020744 3300031344 Bacteria 5586
132 Ga0265316_10025976 3300031344 Bacteria 4879
133 Ga0265316_10037235 3300031344 Bacteria 3928
134 Ga0265316_10049370 3300031344 Bacteria 3315
135 Ga0265316_10065020 3300031344 Bacteria 2825
136 Ga0265316_10120355 3300031344 Bacteria 1983
137 Ga0265316_10160666 3300031344 Bacteria 1680
138 Ga0307408_100245692 3300031548 Bacteria 1473
139 Ga0265313_10002291 3300031595 Bacteria 16778
140 Ga0265313_10009511 3300031595 Bacteria 6296
141 Ga0265314_10000382 3300031711 Bacteria 60703
142 Ga0265314_10010842 3300031711 Bacteria 7577
143 Ga0265314_10061678 3300031711 Bacteria 2552
144 Ga0265314_10092285 3300031711 Bacteria 1969
145 Ga0265342_10058518 3300031712 Bacteria 2278
146 Ga0265342_10159282 3300031712 Bacteria 1248
147 Ga0265342_10186720 3300031712 Unclassified 1133
148 Ga0307405_10042685 3300031731 Bacteria 2762
149 Ga0307412_10135988 3300031911 Bacteria 1793
150 Ga0307411_10046990 3300032005 Bacteria 2788
151 Ga0373929_0000550 3300035085 Bacteria 7213
152 Ga0373944_0025069 3300035089 Bacteria 1753
153 Ga0373949_0000728 3300035090 Bacteria 10666
154 Ga0373932_0000004 3300035112 Bacteria 412176
155 Ga0373945_0036587 3300035116 Bacteria 1759
156 Ga0373943_0102904 3300035170 Unclassified 1496
157 Ga0373962_0000029 3300035242 Bacteria 36959
158 Ga0373924_0025068 3300035410 Bacteria 2356
159 Ga0373931_0000018 3300035691 Bacteria 190282
160 Ga0373935_0040259 3300035692 Bacteria 2932
161 Ga0373927_0004366 3300035695 Bacteria 9916
162 Ga0373947_0005066 3300035725 Bacteria 7718
163 Ga0373947_0033555 3300035725 Bacteria 3031
164 Ga0373947_0064417 3300035725 Bacteria 2235
165 Ga0373937_0037128 3300036401 Unclassified 4440
166 Ga0373925_0000317 3300037068 Bacteria 50371
167 Ga0373925_0002758 3300037068 Bacteria 13900
168 Ga0373925_0070121 3300037068 Bacteria 2649
169 Ga0373925_0212105 3300037068 Bacteria 1543
170 Ga0395905_0161759 3300037471 Bacteria 2104
171 Ga0451577_0006767 3300042876 Bacteria 11372
172 Ga0451577_0007985 3300042876 Bacteria 10333
173 Ga0451577_0081827 3300042876 Bacteria 2880
174 Ga0451577_0133587 3300042876 Bacteria 2227
175 Ga0451577_0192007 3300042876 Bacteria 1842
176 Ga0451577_0283890 3300042876 Bacteria 1500
177 Ga0453684_0002794 3300044712 Bacteria 41282
178 Ga0453684_0011804 3300044712 Bacteria 14555
179 Ga0453684_0026333 3300044712 Bacteria 8407
180 Ga0453684_0156534 3300044712 Bacteria 2701
181 Ga0453684_0635324 3300044712 Bacteria 1166
182 Ga0451576_0030362 3300045051 Bacteria 5777
183 Ga0451576_0066413 3300045051 Bacteria 3756
184 Ga0451576_0174662 3300045051 Bacteria 2243
185 Ga0451576_0249418 3300045051 Bacteria 1855
186 Ga0451576_0361058 3300045051 Bacteria 1521
187 Ga0451576_0451736 3300045051 Bacteria 1349
188 Ga0495592_0125474 3300046454 Bacteria 1802
189 Ga0495582_0034997 3300046473 Bacteria 2761
190 Ga0495618_0000412 3300046514 Bacteria 30775
191 Ga0495630_0000043 3300046517 Bacteria 104062
192 Ga0495630_0009071 3300046517 Bacteria 7148
193 Ga0495666_0001830 3300046526 Bacteria 10507
194 Ga0495666_0035159 3300046526 Bacteria 2443
195 Ga0495652_0182318 3300046529 Bacteria 1610
196 Ga0495586_0000077 3300046535 Bacteria 60087
197 Ga0495586_0002373 3300046535 Bacteria 10225
198 Ga0495586_0002913 3300046535 Bacteria 9234
199 Ga0495645_0071014 3300046543 Bacteria 2512
200 Ga0495645_0130562 3300046543 Bacteria 1761
201 Ga0495634_0008056 3300046642 Bacteria 7861
202 Ga0495634_0132424 3300046642 Bacteria 1588
203 Ga0495599_0015956 3300046678 Bacteria 4663
204 Ga0495599_0042387 3300046678 Bacteria 2856
205 Ga0495647_0005439 3300046681 Bacteria 4172
206 Ga0495647_0040741 3300046681 Bacteria 1766
207 Ga0495647_0053482 3300046681 Bacteria 1575
208 Ga0495658_0057356 3300046683 Bacteria 2224
209 Ga0495613_0004139 3300046689 Bacteria 10857
210 Ga0495624_0069872 3300046690 Bacteria 2187
211 Ga0495624_0125851 3300046690 Unclassified 1573
212 Ga0495600_0310826 3300046809 Unclassified 993
213 Ga0495674_0003120 3300047319 Bacteria 16101
214 Ga0495674_0422906 3300047319 Unclassified 1073
215 Ga0495676_0017393 3300047321 Bacteria 6359
216 Ga0495680_0006678 3300047322 Bacteria 10684
217 Ga0496107_0011535 3300048910 Bacteria 6157
218 Ga0496115_0272407 3300048918 Unclassified 1391
219 Ga0501031_0000638 3300049568 Bacteria 20752
220 Ga0501032_0015768 3300049569 Bacteria 5329
221 Ga0501033_0004029 3300049570 Bacteria 11864
222 Ga0501033_0010755 3300049570 Bacteria 7016
223 Ga0501033_0051628 3300049570 Bacteria 3048
224 Ga0501037_0121457 3300049573 Bacteria 1878
225 Ga0501043_0113613 3300049579 Bacteria 2126
226 Ga0501083_0207333 3300049744 Unclassified 1278
227 Ga0501035_0007736 3300049822 Bacteria 10037
228 Ga0501044_0000611 3300049823 Bacteria 43362
229 Ga0501044_0277958 3300049823 Bacteria 1609
230 nmdc:mga08y16_7652_c1 3300050511 Bacteria 11307
231 Ga0500636_0154986 3300053177 Unclassified 1255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100343737 Ga0070679_1003437371 290
2 3300006844 Ga0075428_100598360 Ga0075428_1005983601 290
3 3300025949 Ga0207667_10026474 Ga0207667_100264744 290
4 3300035116 Ga0373945_0036587 Ga0373945_0036587_799_1734 290
5 3300042876 Ga0451577_0133587 Ga0451577_0133587_767_1648 290
6 3300044712 Ga0453684_0011804 Ga0453684_0011804_2061_2939 290
7 3300044712 Ga0453684_0156534 Ga0453684_0156534_129_1010 290
8 3300045051 Ga0451576_0249418 Ga0451576_0249418_16_897 290
9 3300046473 Ga0495582_0034997 Ga0495582_0034997_545_1429 290
10 3300046526 Ga0495666_0035159 Ga0495666_0035159_589_1473 290
11 3300046535 Ga0495586_0002913 Ga0495586_0002913_7807_8691 290
12 3300046642 Ga0495634_0008056 Ga0495634_0008056_4659_5543 290
13 3300046681 Ga0495647_0040741 Ga0495647_0040741_480_1364 290
14 3300046690 Ga0495624_0125851 Ga0495624_0125851_291_1175 290
15 3300046809 Ga0495600_0310826 Ga0495600_0310826_16_894 290
16 3300005330 Ga0070690_100277554 Ga0070690_1002775542 300
17 3300028800 Ga0265338_10000701 Ga0265338_1000070141 302
18 3300014325 Ga0163163_10296093 Ga0163163_102960932 304
19 3300005842 Ga0068858_100113786 Ga0068858_1001137862 305
20 3300031251 Ga0265327_10000981 Ga0265327_100009815 305
21 3300049823 Ga0501044_0277958 Ga0501044_0277958_345_1265 305
22 3300053177 Ga0500636_0154986 Ga0500636_0154986_259_1176 305
23 3300005340 Ga0070689_100102378 Ga0070689_1001023782 306
24 3300005544 Ga0070686_100089370 Ga0070686_1000893702 306
25 3300025936 Ga0207670_10019194 Ga0207670_100191941 306
26 3300028563 Ga0265319_1029763 Ga0265319_10297633 306
27 3300042876 Ga0451577_0007985 Ga0451577_0007985_4909_5835 306
28 3300005327 Ga0070658_10413414 Ga0070658_104134141 307
29 3300005329 Ga0070683_100446693 Ga0070683_1004466931 307
30 3300005336 Ga0070680_100152492 Ga0070680_1001524922 307
31 3300005343 Ga0070687_100061333 Ga0070687_1000613332 307
32 3300005439 Ga0070711_100025928 Ga0070711_1000259283 307
33 3300005458 Ga0070681_10016003 Ga0070681_100160036 307
34 3300005458 Ga0070681_10116898 Ga0070681_101168981 307
35 3300005543 Ga0070672_100223387 Ga0070672_1002233872 307
36 3300005544 Ga0070686_100000544 Ga0070686_1000005449 307
37 3300005563 Ga0068855_100117335 Ga0068855_1001173352 307
38 3300005563 Ga0068855_100151031 Ga0068855_1001510312 307
39 3300005563 Ga0068855_100213791 Ga0068855_1002137911 307
40 3300005577 Ga0068857_100016838 Ga0068857_1000168384 307
41 3300005577 Ga0068857_100469486 Ga0068857_1004694861 307
42 3300005614 Ga0068856_100000058 Ga0068856_10000005881 307
43 3300005614 Ga0068856_100035919 Ga0068856_1000359194 307
44 3300005841 Ga0068863_100054734 Ga0068863_1000547344 307
45 3300005841 Ga0068863_100083361 Ga0068863_1000833611 307
46 3300005841 Ga0068863_100116776 Ga0068863_1001167763 307
47 3300005841 Ga0068863_100271001 Ga0068863_1002710012 307
48 3300006871 Ga0075434_100218463 Ga0075434_1002184632 307
49 3300009093 Ga0105240_10007319 Ga0105240_1000731917 307
50 3300009093 Ga0105240_10065947 Ga0105240_100659474 307
51 3300009093 Ga0105240_10114604 Ga0105240_101146044 307
52 3300009093 Ga0105240_10329674 Ga0105240_103296742 307
53 3300009094 Ga0111539_10004377 Ga0111539_1000437710 307
54 3300009174 Ga0105241_10159210 Ga0105241_101592102 307
55 3300009176 Ga0105242_10225579 Ga0105242_102255792 307
56 3300009176 Ga0105242_10253112 Ga0105242_102531121 307
57 3300009551 Ga0105238_10015021 Ga0105238_100150212 307
58 3300013296 Ga0157374_10482652 Ga0157374_104826521 307
59 3300013297 Ga0157378_10226985 Ga0157378_102269853 307
60 3300013307 Ga0157372_10208715 Ga0157372_102087152 307
61 3300013307 Ga0157372_10258206 Ga0157372_102582064 307
62 3300013308 Ga0157375_10278356 Ga0157375_102783562 307
63 3300014325 Ga0163163_10000153 Ga0163163_1000015337 307
64 3300014325 Ga0163163_10107637 Ga0163163_101076374 307
65 3300014969 Ga0157376_10170223 Ga0157376_101702232 307
66 3300025909 Ga0207705_10276337 Ga0207705_102763371 307
67 3300025912 Ga0207707_10046320 Ga0207707_100463204 307
68 3300025912 Ga0207707_10380430 Ga0207707_103804301 307
69 3300025913 Ga0207695_10060086 Ga0207695_100600861 307
70 3300025913 Ga0207695_10117363 Ga0207695_101173631 307
71 3300025916 Ga0207663_10015974 Ga0207663_100159743 307
72 3300025921 Ga0207652_10261577 Ga0207652_102615771 307
73 3300025921 Ga0207652_10271258 Ga0207652_102712582 307
74 3300025936 Ga0207670_10033305 Ga0207670_100333054 307
75 3300025949 Ga0207667_10495791 Ga0207667_104957911 307
76 3300026078 Ga0207702_10004230 Ga0207702_100042302 307
77 3300026078 Ga0207702_10101449 Ga0207702_101014492 307
78 3300026078 Ga0207702_10157216 Ga0207702_101572162 307
79 3300026078 Ga0207702_10216370 Ga0207702_102163702 307
80 3300026088 Ga0207641_10009837 Ga0207641_100098377 307
81 3300026088 Ga0207641_10395203 Ga0207641_103952032 307
82 3300026116 Ga0207674_10023918 Ga0207674_100239184 307
83 3300027907 Ga0207428_10054717 Ga0207428_100547173 307
84 3300028556 Ga0265337_1000362 Ga0265337_100036225 307
85 3300028556 Ga0265337_1002211 Ga0265337_10022114 307
86 3300028556 Ga0265337_1003123 Ga0265337_10031235 307
87 3300028556 Ga0265337_1004667 Ga0265337_10046672 307
88 3300028556 Ga0265337_1005745 Ga0265337_10057455 307
89 3300028556 Ga0265337_1013747 Ga0265337_10137474 307
90 3300028556 Ga0265337_1030952 Ga0265337_10309522 307
91 3300028558 Ga0265326_10004921 Ga0265326_100049214 307
92 3300028558 Ga0265326_10013426 Ga0265326_100134262 307
93 3300028558 Ga0265326_10024562 Ga0265326_100245622 307
94 3300028563 Ga0265319_1000003 Ga0265319_1000003237 307
95 3300028563 Ga0265319_1009496 Ga0265319_10094963 307
96 3300028573 Ga0265334_10015674 Ga0265334_100156743 307
97 3300028573 Ga0265334_10025292 Ga0265334_100252923 307
98 3300028573 Ga0265334_10069728 Ga0265334_100697281 307
99 3300028653 Ga0265323_10000183 Ga0265323_100001836 307
100 3300028653 Ga0265323_10057215 Ga0265323_100572152 307
101 3300028654 Ga0265322_10018505 Ga0265322_100185052 307
102 3300028666 Ga0265336_10001917 Ga0265336_100019173 307
103 3300028666 Ga0265336_10005083 Ga0265336_100050835 307
104 3300028666 Ga0265336_10056437 Ga0265336_100564371 307
105 3300028800 Ga0265338_10000184 Ga0265338_10000184108 307
106 3300028800 Ga0265338_10000494 Ga0265338_1000049414 307
107 3300028800 Ga0265338_10001968 Ga0265338_1000196827 307
108 3300028800 Ga0265338_10002298 Ga0265338_1000229830 307
109 3300028800 Ga0265338_10003664 Ga0265338_1000366413 307
110 3300028800 Ga0265338_10004075 Ga0265338_1000407510 307
111 3300028800 Ga0265338_10004684 Ga0265338_1000468410 307
112 3300028800 Ga0265338_10018948 Ga0265338_100189486 307
113 3300028800 Ga0265338_10019116 Ga0265338_100191163 307
114 3300028800 Ga0265338_10021119 Ga0265338_100211195 307
115 3300028800 Ga0265338_10028324 Ga0265338_100283241 307
116 3300028800 Ga0265338_10030385 Ga0265338_100303853 307
117 3300028800 Ga0265338_10032158 Ga0265338_100321584 307
118 3300028800 Ga0265338_10042182 Ga0265338_100421823 307
119 3300028800 Ga0265338_10061304 Ga0265338_100613043 307
120 3300028800 Ga0265338_10066196 Ga0265338_100661962 307
121 3300029957 Ga0265324_10000744 Ga0265324_1000074414 307
122 3300029957 Ga0265324_10004698 Ga0265324_100046982 307
123 3300029957 Ga0265324_10005217 Ga0265324_100052175 307
124 3300029957 Ga0265324_10013218 Ga0265324_100132184 307
125 3300029957 Ga0265324_10030343 Ga0265324_100303432 307
126 3300031235 Ga0265330_10039335 Ga0265330_100393353 307
127 3300031235 Ga0265330_10044268 Ga0265330_100442682 307
128 3300031238 Ga0265332_10009837 Ga0265332_100098373 307
129 3300031239 Ga0265328_10098393 Ga0265328_100983931 307
130 3300031240 Ga0265320_10000296 Ga0265320_1000029635 307
131 3300031240 Ga0265320_10000488 Ga0265320_1000048816 307
132 3300031240 Ga0265320_10002276 Ga0265320_1000227614 307
133 3300031241 Ga0265325_10010961 Ga0265325_100109613 307
134 3300031241 Ga0265325_10019802 Ga0265325_100198022 307
135 3300031241 Ga0265325_10020776 Ga0265325_100207763 307
136 3300031242 Ga0265329_10005554 Ga0265329_100055543 307
137 3300031247 Ga0265340_10004729 Ga0265340_100047294 307
138 3300031247 Ga0265340_10021244 Ga0265340_100212442 307
139 3300031247 Ga0265340_10066718 Ga0265340_100667182 307
140 3300031249 Ga0265339_10007696 Ga0265339_100076964 307
141 3300031250 Ga0265331_10047608 Ga0265331_100476082 307
142 3300031251 Ga0265327_10002162 Ga0265327_100021623 307
143 3300031251 Ga0265327_10018606 Ga0265327_100186062 307
144 3300031251 Ga0265327_10020020 Ga0265327_100200203 307
145 3300031344 Ga0265316_10017392 Ga0265316_100173923 307
146 3300031344 Ga0265316_10020744 Ga0265316_100207443 307
147 3300031344 Ga0265316_10025976 Ga0265316_100259762 307
148 3300031344 Ga0265316_10037235 Ga0265316_100372353 307
149 3300031344 Ga0265316_10049370 Ga0265316_100493704 307
150 3300031344 Ga0265316_10065020 Ga0265316_100650202 307
151 3300031344 Ga0265316_10120355 Ga0265316_101203552 307
152 3300031344 Ga0265316_10160666 Ga0265316_101606662 307
153 3300031548 Ga0307408_100245692 Ga0307408_1002456921 307
154 3300031595 Ga0265313_10002291 Ga0265313_1000229115 307
155 3300031595 Ga0265313_10009511 Ga0265313_100095115 307
156 3300031711 Ga0265314_10000382 Ga0265314_1000038210 307
157 3300031711 Ga0265314_10010842 Ga0265314_100108428 307
158 3300031711 Ga0265314_10061678 Ga0265314_100616783 307
159 3300031711 Ga0265314_10092285 Ga0265314_100922852 307
160 3300031712 Ga0265342_10058518 Ga0265342_100585182 307
161 3300031712 Ga0265342_10159282 Ga0265342_101592822 307
162 3300031712 Ga0265342_10186720 Ga0265342_101867202 307
163 3300031731 Ga0307405_10042685 Ga0307405_100426852 307
164 3300031911 Ga0307412_10135988 Ga0307412_101359882 307
165 3300032005 Ga0307411_10046990 Ga0307411_100469902 307
166 3300035085 Ga0373929_0000550 Ga0373929_0000550_4884_5870 307
167 3300035089 Ga0373944_0025069 Ga0373944_0025069_59_1045 307
168 3300035090 Ga0373949_0000728 Ga0373949_0000728_998_1984 307
169 3300035112 Ga0373932_0000004 Ga0373932_0000004_18059_19045 307
170 3300035170 Ga0373943_0102904 Ga0373943_0102904_100_1032 307
171 3300035242 Ga0373962_0000029 Ga0373962_0000029_2396_3382 307
172 3300035410 Ga0373924_0025068 Ga0373924_0025068_285_1214 307
173 3300035691 Ga0373931_0000018 Ga0373931_0000018_171237_172223 307
174 3300035692 Ga0373935_0040259 Ga0373935_0040259_1384_2316 307
175 3300035695 Ga0373927_0004366 Ga0373927_0004366_3487_4419 307
176 3300035725 Ga0373947_0005066 Ga0373947_0005066_1653_2585 307
177 3300035725 Ga0373947_0033555 Ga0373947_0033555_1450_2436 307
178 3300035725 Ga0373947_0064417 Ga0373947_0064417_1061_1993 307
179 3300036401 Ga0373937_0037128 Ga0373937_0037128_3205_4134 307
180 3300037068 Ga0373925_0000317 Ga0373925_0000317_39037_40023 307
181 3300037068 Ga0373925_0002758 Ga0373925_0002758_129_1061 307
182 3300037068 Ga0373925_0070121 Ga0373925_0070121_661_1587 307
183 3300037068 Ga0373925_0212105 Ga0373925_0212105_305_1234 307
184 3300037471 Ga0395905_0161759 Ga0395905_0161759_189_1121 307
185 3300042876 Ga0451577_0006767 Ga0451577_0006767_10053_10982 307
186 3300042876 Ga0451577_0081827 Ga0451577_0081827_1590_2519 307
187 3300042876 Ga0451577_0192007 Ga0451577_0192007_805_1734 307
188 3300042876 Ga0451577_0283890 Ga0451577_0283890_287_1219 307
189 3300044712 Ga0453684_0002794 Ga0453684_0002794_359_1288 307
190 3300044712 Ga0453684_0026333 Ga0453684_0026333_327_1256 307
191 3300044712 Ga0453684_0635324 Ga0453684_0635324_222_1151 307
192 3300045051 Ga0451576_0030362 Ga0451576_0030362_3615_4550 307
193 3300045051 Ga0451576_0066413 Ga0451576_0066413_2388_3323 307
194 3300045051 Ga0451576_0174662 Ga0451576_0174662_525_1454 307
195 3300045051 Ga0451576_0361058 Ga0451576_0361058_82_1011 307
196 3300045051 Ga0451576_0451736 Ga0451576_0451736_323_1252 307
197 3300046454 Ga0495592_0125474 Ga0495592_0125474_804_1733 307
198 3300046514 Ga0495618_0000412 Ga0495618_0000412_26334_27263 307
199 3300046517 Ga0495630_0000043 Ga0495630_0000043_99109_100053 307
200 3300046517 Ga0495630_0009071 Ga0495630_0009071_574_1506 307
201 3300046526 Ga0495666_0001830 Ga0495666_0001830_7051_7995 307
202 3300046529 Ga0495652_0182318 Ga0495652_0182318_422_1351 307
203 3300046535 Ga0495586_0000077 Ga0495586_0000077_4026_4970 307
204 3300046535 Ga0495586_0002373 Ga0495586_0002373_474_1403 307
205 3300046543 Ga0495645_0071014 Ga0495645_0071014_921_1850 307
206 3300046543 Ga0495645_0130562 Ga0495645_0130562_724_1653 307
207 3300046642 Ga0495634_0132424 Ga0495634_0132424_390_1319 307
208 3300046678 Ga0495599_0015956 Ga0495599_0015956_603_1529 307
209 3300046678 Ga0495599_0042387 Ga0495599_0042387_1192_2121 307
210 3300046681 Ga0495647_0005439 Ga0495647_0005439_2990_3919 307
211 3300046681 Ga0495647_0053482 Ga0495647_0053482_475_1419 307
212 3300046683 Ga0495658_0057356 Ga0495658_0057356_169_1113 307
213 3300046689 Ga0495613_0004139 Ga0495613_0004139_8207_9136 307
214 3300046690 Ga0495624_0069872 Ga0495624_0069872_1051_1980 307
215 3300047319 Ga0495674_0003120 Ga0495674_0003120_11112_12056 307
216 3300047319 Ga0495674_0422906 Ga0495674_0422906_93_1022 307
217 3300047321 Ga0495676_0017393 Ga0495676_0017393_1375_2319 307
218 3300047322 Ga0495680_0006678 Ga0495680_0006678_767_1696 307
219 3300048910 Ga0496107_0011535 Ga0496107_0011535_228_1154 307
220 3300048918 Ga0496115_0272407 Ga0496115_0272407_191_1150 307
221 3300049568 Ga0501031_0000638 Ga0501031_0000638_16101_17030 307
222 3300049569 Ga0501032_0015768 Ga0501032_0015768_1822_2751 307
223 3300049570 Ga0501033_0004029 Ga0501033_0004029_3501_4430 307
224 3300049570 Ga0501033_0010755 Ga0501033_0010755_4249_5172 307
225 3300049570 Ga0501033_0051628 Ga0501033_0051628_556_1485 307
226 3300049573 Ga0501037_0121457 Ga0501037_0121457_919_1848 307
227 3300049579 Ga0501043_0113613 Ga0501043_0113613_480_1409 307
228 3300049744 Ga0501083_0207333 Ga0501083_0207333_267_1196 307
229 3300049822 Ga0501035_0007736 Ga0501035_0007736_5626_6555 307
230 3300049823 Ga0501044_0000611 Ga0501044_0000611_26120_27049 307
231 3300050511 nmdc:mga08y16_7652_c1 nmdc:mga08y16_7652_c1_1241_2176 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00698

Acyl_transf_1

Acyl transferase domain

6

303

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cdh-assembly1.cif.gz_4 architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9586 3 306
6smd-assembly2.cif.gz_C plmcat:antf (holo): type ii pks acyl-carrier protein in complex with its malonyl-transacylase 0.9578 2 307
3h0p-assembly1.cif.gz_A 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. 0.9572 2 303
3r97-assembly1.cif.gz_A crystal structure of malonyl-coa:acyl carrier protein transacylase (fabd), xoo0880, from xanthomonas oryzae pv. oryzae kacc10331 0.9565 1 306
2cuy-assembly1.cif.gz_B crystal structure of malonyl coa-acyl carrier protein transacylase from thermus thermophilus hb8 0.9557 4 306
ID Description Score Start End Superfamily
2cuyB01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9613 4 306 3.40.366.10
3im8A01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9594 3 307 3.40.366.10
3im8A01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9554 3 307 3.40.366.10
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9541 7 283 3.20.10.10
2g1hA01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9531 3 305 3.40.366.10
ID Description Score Start End GO Terms
AF-A0A353B054-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9831 18 294 GO:0004314
AF-A0A1F8P0P5-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9773 2 302 GO:0004314
GO:0005829
GO:0006633
AF-A0A7V0QFP4-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9768 2 302 GO:0004314
GO:0005829
GO:0006633
AF-U6MR52-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase, putative 0.9758 84 294 GO:0016740
AF-A0A7S0W1A9-F1-model_v4 Malonyl-CoA:ACP transacylase (MAT) domain-containing protein 0.9747 2 293 GO:0004314

Feature Viewer

pLDDT pTM Quality
94.1 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map