F344099

General Info

Members Datasets Scaffolds Average Seq Length
231 161 462 214

Family's Representative Sequence

Representative Sequence 3300025899|Ga0207642_10129521|Ga0207642_101295211
Length 237
Sequence LHRLRGEHGDLDHRAADFRANVRFLFRLQLARDDRSHDNGALRRGHDIVGVVREPAAVTSPDPRVRLVRGDATNADSVAEVARGADAVVSAISPRPNARGLPQPRLADNARALIAGLRQTGVRRVLYVGGGSTLEIAPGRQLLDEPDFPELYKAEALEGREALGIWRSEAEGLDWTFLSPAIEIGPGERTGSYRTTDERMLFDTNGKSFISFEDYAVAVLDELERPQHVGRRFGVAY

Samples

Sample ID Description Type Environment
1 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.73
Nodule 0
Rhizoplane 1.73
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 9.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207642_10129521 3300025899 Bacteria 1314
2 JGI25406J46586_10000844 3300003203 Bacteria 14406
3 Ga0007410J51695_1030137 3300003574 Bacteria 1217
4 Ga0065715_10093759 3300005293 Plasmid 4557
5 Ga0070658_10006573 3300005327 Bacteria 9428
6 Ga0070658_10088936 3300005327 Bacteria 2543
7 Ga0070690_100036321 3300005330 Bacteria 3096
8 Ga0070690_100071142 3300005330 Bacteria 2260
9 Ga0070690_100835853 3300005330 Bacteria 716
10 Ga0070670_100081701 3300005331 Bacteria 2776
11 Ga0068869_100387518 3300005334 Bacteria 1147
12 Ga0070680_100134459 3300005336 Bacteria 2070
13 Ga0070680_100590309 3300005336 Bacteria 953
14 Ga0068868_100081552 3300005338 Bacteria 2593
15 Ga0070689_100050823 3300005340 Bacteria 3203
16 Ga0070687_100025855 3300005343 Bacteria 2821
17 Ga0070668_100072120 3300005347 Bacteria 2691
18 Ga0070675_100575670 3300005354 Bacteria 1020
19 Ga0070675_100832655 3300005354 Bacteria 844
20 Ga0070671_100051622 3300005355 Bacteria 3420
21 Ga0070671_100456118 3300005355 Bacteria 1097
22 Ga0070674_100109903 3300005356 Bacteria 2022
23 Ga0070688_100200539 3300005365 Bacteria 1396
24 Ga0070659_100111907 3300005366 Bacteria 2205
25 Ga0070667_100075856 3300005367 Bacteria 2871
26 Ga0070709_10011338 3300005434 Bacteria 4963
27 Ga0070709_10140448 3300005434 Unclassified 1659
28 Ga0070713_100039162 3300005436 Bacteria 3845
29 Ga0070701_10008373 3300005438 Bacteria 4471
30 Ga0070711_100339370 3300005439 Unclassified 1205
31 Ga0070705_100022737 3300005440 Bacteria 3354
32 Ga0070705_100588562 3300005440 Bacteria 859
33 Ga0070694_100262459 3300005444 Bacteria 1310
34 Ga0070694_100284011 3300005444 Bacteria 1263
35 Ga0070694_100894938 3300005444 Unclassified 732
36 Ga0070708_100040866 3300005445 Bacteria 4063
37 Ga0070663_100009645 3300005455 Bacteria 5987
38 Ga0070678_100412283 3300005456 Bacteria 1176
39 Ga0070662_100290824 3300005457 Bacteria 1325
40 Ga0070681_10019134 3300005458 Bacteria 6852
41 Ga0070681_10186897 3300005458 Bacteria 1992
42 Ga0070681_10740420 3300005458 Bacteria 899
43 Ga0068867_100199768 3300005459 Bacteria 1600
44 Ga0068867_100679260 3300005459 Bacteria 906
45 Ga0070685_10075860 3300005466 Bacteria 2004
46 Ga0070706_100105053 3300005467 Unclassified 2627
47 Ga0070706_100457379 3300005467 Unclassified 1188
48 Ga0070707_100510967 3300005468 Bacteria 1163
49 Ga0070698_100210247 3300005471 Bacteria 1880
50 Ga0070698_100508673 3300005471 Bacteria 1142
51 Ga0070699_100348558 3300005518 Unclassified 1333
52 Ga0070672_100042910 3300005543 Bacteria 3484
53 Ga0070672_100062555 3300005543 Bacteria 2938
54 Ga0070695_100082484 3300005545 Bacteria 2129
55 Ga0070695_100153726 3300005545 Bacteria 1608
56 Ga0070695_100240847 3300005545 Bacteria 1312
57 Ga0070696_100065267 3300005546 Bacteria 2552
58 Ga0070693_100750869 3300005547 Bacteria 719
59 Ga0070665_101412394 3300005548 Bacteria 705
60 Ga0070704_100233780 3300005549 Bacteria 1501
61 Ga0070704_100721335 3300005549 Bacteria 886
62 Ga0068855_100859338 3300005563 Bacteria 961
63 Ga0070664_100082189 3300005564 Unclassified 2778
64 Ga0068854_100198743 3300005578 Bacteria 1575
65 Ga0068854_100666958 3300005578 Bacteria 894
66 Ga0070702_100486274 3300005615 Bacteria 903
67 Ga0068859_100055667 3300005617 Bacteria 3979
68 Ga0068864_100067294 3300005618 Bacteria 3111
69 Ga0068864_100180650 3300005618 Unclassified 1929
70 Ga0068864_100220921 3300005618 Bacteria 1748
71 Ga0068866_10062769 3300005718 Bacteria 1934
72 Ga0068866_10252411 3300005718 Bacteria 1080
73 Ga0068861_100137088 3300005719 Bacteria 1992
74 Ga0068870_10054390 3300005840 Bacteria 2129
75 Ga0068863_100385744 3300005841 Bacteria 1368
76 Ga0068863_101240969 3300005841 Bacteria 752
77 Ga0068858_100167855 3300005842 Bacteria 2068
78 Ga0068860_100201703 3300005843 Bacteria 1928
79 Ga0068862_100242391 3300005844 Bacteria 1640
80 Ga0081539_10002320 3300005985 Bacteria 27418
81 Ga0070712_100145933 3300006175 Bacteria 1811
82 Ga0068871_100837091 3300006358 Bacteria 850
83 Ga0075433_10021593 3300006852 Bacteria 5399
84 Ga0075433_10214763 3300006852 Bacteria 1709
85 Ga0075433_10448756 3300006852 Bacteria 1137
86 Ga0075434_100058964 3300006871 Bacteria 3816
87 Ga0075434_100143445 3300006871 Bacteria 2408
88 Ga0075434_100332916 3300006871 Bacteria 1539
89 Ga0068865_100065301 3300006881 Bacteria 2563
90 Ga0075436_100003237 3300006914 Bacteria 11161
91 Ga0097620_100055667 3300006931 Bacteria 3979
92 Ga0075435_100011406 3300007076 Bacteria 6535
93 Ga0075435_100301609 3300007076 Unclassified 1370
94 Ga0105240_10080593 3300009093 Bacteria 4003
95 Ga0105240_10108815 3300009093 Unclassified 3357
96 Ga0105240_10186632 3300009093 Bacteria 2442
97 Ga0105245_10738729 3300009098 Unclassified 1019
98 Ga0105247_10280307 3300009101 Bacteria 1150
99 Ga0105243_10109529 3300009148 Bacteria 2307
100 Ga0105242_10123635 3300009176 Bacteria 2224
101 Ga0105242_10197926 3300009176 Bacteria 1783
102 Ga0105248_10008049 3300009177 Bacteria 11572
103 Ga0105248_10581842 3300009177 Bacteria 1263
104 Ga0105237_10000357 3300009545 Bacteria 64574
105 Ga0105238_10237885 3300009551 Unclassified 1798
106 Ga0105238_11171878 3300009551 Bacteria 792
107 Ga0105249_10281009 3300009553 Bacteria 1662
108 Ga0105249_11184412 3300009553 Bacteria 835
109 Ga0099796_10077796 3300010159 Unclassified 1211
110 Ga0105239_10032400 3300010375 Bacteria 5744
111 Ga0105239_10476677 3300010375 Bacteria 1417
112 Ga0157374_11111087 3300013296 Bacteria 811
113 Ga0157378_10297207 3300013297 Bacteria 1561
114 Ga0157378_10390909 3300013297 Bacteria 1368
115 Ga0157372_11077569 3300013307 Bacteria 930
116 Ga0157375_10360182 3300013308 Bacteria 1620
117 Ga0157375_10365152 3300013308 Bacteria 1610
118 Ga0157375_10466878 3300013308 Bacteria 1427
119 Ga0163163_10180847 3300014325 Bacteria 2156
120 Ga0163163_10381168 3300014325 Bacteria 1468
121 Ga0157380_10115128 3300014326 Bacteria 2267
122 Ga0163161_10432755 3300017792 Bacteria 1060
123 Ga0207426_1006061 3300025302 Bacteria 5338
124 Ga0207426_1017694 3300025302 Bacteria 2528
125 Ga0207699_10211892 3300025906 Bacteria 1318
126 Ga0207699_10288425 3300025906 Unclassified 1143
127 Ga0207645_10047444 3300025907 Bacteria 2743
128 Ga0207643_10091180 3300025908 Bacteria 1777
129 Ga0207705_10049155 3300025909 Bacteria 3036
130 Ga0207705_10214274 3300025909 Bacteria 1461
131 Ga0207684_10787414 3300025910 Bacteria 804
132 Ga0207695_10138198 3300025913 Bacteria 2388
133 Ga0207695_10185323 3300025913 Bacteria 2001
134 Ga0207695_10212938 3300025913 Bacteria 1842
135 Ga0207695_10227609 3300025913 Bacteria 1770
136 Ga0207671_10000195 3300025914 Bacteria 94152
137 Ga0207660_10334506 3300025917 Bacteria 1211
138 Ga0207660_10960725 3300025917 Bacteria 697
139 Ga0207662_10043977 3300025918 Bacteria 2636
140 Ga0207662_10125351 3300025918 Bacteria 1614
141 Ga0207650_10052320 3300025925 Unclassified 3025
142 Ga0207650_10218128 3300025925 Bacteria 1534
143 Ga0207687_10530093 3300025927 Unclassified 986
144 Ga0207700_10073174 3300025928 Unclassified 2646
145 Ga0207664_10143114 3300025929 Unclassified 2025
146 Ga0207644_10112821 3300025931 Bacteria 2058
147 Ga0207690_10162077 3300025932 Bacteria 1668
148 Ga0207706_10191438 3300025933 Bacteria 1795
149 Ga0207686_10444553 3300025934 Bacteria 996
150 Ga0207670_10239109 3300025936 Bacteria 1398
151 Ga0207670_10460216 3300025936 Bacteria 1027
152 Ga0207665_10004348 3300025939 Bacteria 9411
153 Ga0207691_10049301 3300025940 Bacteria 3858
154 Ga0207691_10108366 3300025940 Bacteria 2472
155 Ga0207711_10019177 3300025941 Bacteria 5694
156 Ga0207711_10807877 3300025941 Bacteria 873
157 Ga0207689_10112592 3300025942 Bacteria 2237
158 Ga0207679_10038033 3300025945 Bacteria 3426
159 Ga0207679_10142215 3300025945 Bacteria 1941
160 Ga0207679_10255986 3300025945 Unclassified 1491
161 Ga0207667_10057876 3300025949 Unclassified 4067
162 Ga0207667_10708743 3300025949 Bacteria 1008
163 Ga0207712_10325120 3300025961 Bacteria 1270
164 Ga0207668_10198982 3300025972 Bacteria 1594
165 Ga0207640_10138987 3300025981 Bacteria 1768
166 Ga0207640_10247351 3300025981 Bacteria 1382
167 Ga0207640_10520890 3300025981 Bacteria 994
168 Ga0207640_10544473 3300025981 Bacteria 974
169 Ga0207658_10086933 3300025986 Bacteria 2413
170 Ga0207658_10116207 3300025986 Bacteria 2125
171 Ga0207678_10017341 3300026067 Bacteria 6321
172 Ga0207708_10042990 3300026075 Bacteria 3443
173 Ga0207648_10005280 3300026089 Bacteria 13045
174 Ga0207648_10332053 3300026089 Bacteria 1368
175 Ga0207676_10042606 3300026095 Bacteria 3492
176 Ga0207676_10362680 3300026095 Bacteria 1343
177 Ga0207675_100010349 3300026118 Bacteria 8741
178 Ga0207683_10025728 3300026121 Bacteria 5076
179 Ga0207698_10137749 3300026142 Bacteria 2097
180 Ga0268265_10360862 3300028380 Bacteria 1330
181 Ga0268264_10062681 3300028381 Bacteria 3123
182 Ga0265318_10029985 3300028577 Bacteria 2118
183 Ga0265338_10592035 3300028800 Bacteria 773
184 Ga0265330_10024155 3300031235 Bacteria 2757
185 Ga0265339_10346608 3300031249 Bacteria 701
186 Ga0307413_10158786 3300031824 Bacteria 1586
187 Ga0307409_100151185 3300031995 Bacteria 2016
188 Ga0307416_100332456 3300032002 Bacteria 1528
189 Ga0307416_100845126 3300032002 Bacteria 1013
190 Ga0307415_100061287 3300032126 Bacteria 2604
191 Ga0307415_101188757 3300032126 Bacteria 718
192 Ga0373959_0016380 3300034820 Bacteria 1373
193 Ga0373956_0072361 3300035119 Bacteria 1574
194 Ga0373960_0114389 3300035121 Bacteria 889
195 Ga0373955_0046074 3300035172 Bacteria 2356
196 Ga0373961_0059724 3300035241 Unclassified 1154
197 Ga0373937_0080086 3300036401 Bacteria 3020
198 Ga0373937_0092365 3300036401 Bacteria 2805
199 Ga0373937_0355198 3300036401 Unclassified 1389
200 Ga0395899_0051200 3300037312 Bacteria 3065
201 Ga0395900_0016992 3300037418 Bacteria 7427
202 Ga0395905_0039039 3300037471 Bacteria 4454
203 Ga0395905_0238593 3300037471 Bacteria 1699
204 Ga0395901_0114807 3300038443 Bacteria 2828
205 Ga0451577_0046141 3300042876 Bacteria 3899
206 Ga0453684_0049072 3300044712 Bacteria 5571
207 Ga0453684_0403956 3300044712 Bacteria 1529
208 Ga0466958_0353447 3300045836 Bacteria 946
209 Ga0466967_0823983 3300045976 Bacteria 922
210 Ga0495643_0000252 3300046522 Bacteria 78817
211 Ga0495658_0580368 3300046683 Bacteria 718
212 Ga0495686_0077263 3300047472 Bacteria 2039
213 Ga0496107_0210353 3300048910 Bacteria 1446
214 Ga0496109_0177025 3300048912 Bacteria 2003
215 Ga0496113_0753366 3300048916 Unclassified 775
216 Ga0496114_0943489 3300048917 Bacteria 745
217 Ga0501043_0144161 3300049579 Bacteria 1865
218 Ga0501047_0002520 3300049581 Bacteria 17469
219 Ga0501070_0159249 3300049586 Bacteria 1862
220 Ga0501241_018884 3300049758 Bacteria 1264
221 Ga0501035_0000365 3300049822 Bacteria 52161
222 Ga0501044_0002273 3300049823 Bacteria 21908
223 nmdc:mga06z11_75438_c1 3300050494 Bacteria 1795
224 nmdc:mga0n895_156878_c1 3300050512 Bacteria 2307
225 nmdc:mga0rr50_11511_c1 3300050513 Bacteria 5669
226 nmdc:mga0rr50_151820_c1 3300050513 Bacteria 1872
227 nmdc:mga08x19_14116_c1 3300050514 Bacteria 4841
228 nmdc:mga08x19_420242_c1 3300050514 Bacteria 939
229 nmdc:mga0a205_39090_c1 3300050515 Bacteria 4566
230 nmdc:mga0a205_64516_c1 3300050515 Bacteria 3537
231 Ga0500644_0084028 3300053088 Bacteria 1177
232 Ga0207642_10129521
233 JGI25406J46586_10000844
234 Ga0007410J51695_1030137
235 Ga0065715_10093759
236 Ga0070658_10006573
237 Ga0070658_10088936
238 Ga0070690_100036321
239 Ga0070690_100071142
240 Ga0070690_100835853
241 Ga0070670_100081701
242 Ga0068869_100387518
243 Ga0070680_100134459
244 Ga0070680_100590309
245 Ga0068868_100081552
246 Ga0070689_100050823
247 Ga0070687_100025855
248 Ga0070668_100072120
249 Ga0070675_100575670
250 Ga0070675_100832655
251 Ga0070671_100051622
252 Ga0070671_100456118
253 Ga0070674_100109903
254 Ga0070688_100200539
255 Ga0070659_100111907
256 Ga0070667_100075856
257 Ga0070709_10011338
258 Ga0070709_10140448
259 Ga0070713_100039162
260 Ga0070701_10008373
261 Ga0070711_100339370
262 Ga0070705_100022737
263 Ga0070705_100588562
264 Ga0070694_100262459
265 Ga0070694_100284011
266 Ga0070694_100894938
267 Ga0070708_100040866
268 Ga0070663_100009645
269 Ga0070678_100412283
270 Ga0070662_100290824
271 Ga0070681_10019134
272 Ga0070681_10186897
273 Ga0070681_10740420
274 Ga0068867_100199768
275 Ga0068867_100679260
276 Ga0070685_10075860
277 Ga0070706_100105053
278 Ga0070706_100457379
279 Ga0070707_100510967
280 Ga0070698_100210247
281 Ga0070698_100508673
282 Ga0070699_100348558
283 Ga0070672_100042910
284 Ga0070672_100062555
285 Ga0070695_100082484
286 Ga0070695_100153726
287 Ga0070695_100240847
288 Ga0070696_100065267
289 Ga0070693_100750869
290 Ga0070665_101412394
291 Ga0070704_100233780
292 Ga0070704_100721335
293 Ga0068855_100859338
294 Ga0070664_100082189
295 Ga0068854_100198743
296 Ga0068854_100666958
297 Ga0070702_100486274
298 Ga0068859_100055667
299 Ga0068864_100067294
300 Ga0068864_100180650
301 Ga0068864_100220921
302 Ga0068866_10062769
303 Ga0068866_10252411
304 Ga0068861_100137088
305 Ga0068870_10054390
306 Ga0068863_100385744
307 Ga0068863_101240969
308 Ga0068858_100167855
309 Ga0068860_100201703
310 Ga0068862_100242391
311 Ga0081539_10002320
312 Ga0070712_100145933
313 Ga0068871_100837091
314 Ga0075433_10021593
315 Ga0075433_10214763
316 Ga0075433_10448756
317 Ga0075434_100058964
318 Ga0075434_100143445
319 Ga0075434_100332916
320 Ga0068865_100065301
321 Ga0075436_100003237
322 Ga0097620_100055667
323 Ga0075435_100011406
324 Ga0075435_100301609
325 Ga0105240_10080593
326 Ga0105240_10108815
327 Ga0105240_10186632
328 Ga0105245_10738729
329 Ga0105247_10280307
330 Ga0105243_10109529
331 Ga0105242_10123635
332 Ga0105242_10197926
333 Ga0105248_10008049
334 Ga0105248_10581842
335 Ga0105237_10000357
336 Ga0105238_10237885
337 Ga0105238_11171878
338 Ga0105249_10281009
339 Ga0105249_11184412
340 Ga0099796_10077796
341 Ga0105239_10032400
342 Ga0105239_10476677
343 Ga0157374_11111087
344 Ga0157378_10297207
345 Ga0157378_10390909
346 Ga0157372_11077569
347 Ga0157375_10360182
348 Ga0157375_10365152
349 Ga0157375_10466878
350 Ga0163163_10180847
351 Ga0163163_10381168
352 Ga0157380_10115128
353 Ga0163161_10432755
354 Ga0207426_1006061
355 Ga0207426_1017694
356 Ga0207699_10211892
357 Ga0207699_10288425
358 Ga0207645_10047444
359 Ga0207643_10091180
360 Ga0207705_10049155
361 Ga0207705_10214274
362 Ga0207684_10787414
363 Ga0207695_10138198
364 Ga0207695_10185323
365 Ga0207695_10212938
366 Ga0207695_10227609
367 Ga0207671_10000195
368 Ga0207660_10334506
369 Ga0207660_10960725
370 Ga0207662_10043977
371 Ga0207662_10125351
372 Ga0207650_10052320
373 Ga0207650_10218128
374 Ga0207687_10530093
375 Ga0207700_10073174
376 Ga0207664_10143114
377 Ga0207644_10112821
378 Ga0207690_10162077
379 Ga0207706_10191438
380 Ga0207686_10444553
381 Ga0207670_10239109
382 Ga0207670_10460216
383 Ga0207665_10004348
384 Ga0207691_10049301
385 Ga0207691_10108366
386 Ga0207711_10019177
387 Ga0207711_10807877
388 Ga0207689_10112592
389 Ga0207679_10038033
390 Ga0207679_10142215
391 Ga0207679_10255986
392 Ga0207667_10057876
393 Ga0207667_10708743
394 Ga0207712_10325120
395 Ga0207668_10198982
396 Ga0207640_10138987
397 Ga0207640_10247351
398 Ga0207640_10520890
399 Ga0207640_10544473
400 Ga0207658_10086933
401 Ga0207658_10116207
402 Ga0207678_10017341
403 Ga0207708_10042990
404 Ga0207648_10005280
405 Ga0207648_10332053
406 Ga0207676_10042606
407 Ga0207676_10362680
408 Ga0207675_100010349
409 Ga0207683_10025728
410 Ga0207698_10137749
411 Ga0268265_10360862
412 Ga0268264_10062681
413 Ga0265318_10029985
414 Ga0265338_10592035
415 Ga0265330_10024155
416 Ga0265339_10346608
417 Ga0307413_10158786
418 Ga0307409_100151185
419 Ga0307416_100332456
420 Ga0307416_100845126
421 Ga0307415_100061287
422 Ga0307415_101188757
423 Ga0373959_0016380
424 Ga0373956_0072361
425 Ga0373960_0114389
426 Ga0373955_0046074
427 Ga0373961_0059724
428 Ga0373937_0080086
429 Ga0373937_0092365
430 Ga0373937_0355198
431 Ga0395899_0051200
432 Ga0395900_0016992
433 Ga0395905_0039039
434 Ga0395905_0238593
435 Ga0395901_0114807
436 Ga0451577_0046141
437 Ga0453684_0049072
438 Ga0453684_0403956
439 Ga0466958_0353447
440 Ga0466967_0823983
441 Ga0495643_0000252
442 Ga0495658_0580368
443 Ga0495686_0077263
444 Ga0496107_0210353
445 Ga0496109_0177025
446 Ga0496113_0753366
447 Ga0496114_0943489
448 Ga0501043_0144161
449 Ga0501047_0002520
450 Ga0501070_0159249
451 Ga0501241_018884
452 Ga0501035_0000365
453 Ga0501044_0002273
454 nmdc:mga06z11_75438_c1
455 nmdc:mga0n895_156878_c1
456 nmdc:mga0rr50_11511_c1
457 nmdc:mga0rr50_151820_c1
458 nmdc:mga08x19_14116_c1
459 nmdc:mga08x19_420242_c1
460 nmdc:mga0a205_39090_c1
461 nmdc:mga0a205_64516_c1
462 Ga0500644_0084028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13460

NAD_binding_10

NAD(P)H-binding

39

226

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhn-assembly1.cif.gz_A crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310. 0.914 2 204
3dhn-assembly1.cif.gz_A crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310. 0.9012 2 204
4jgb-assembly1.cif.gz_A crystal structure of putative exported protein from burkholderia pseudomallei 0.9011 1 203
4jgb-assembly2.cif.gz_B crystal structure of putative exported protein from burkholderia pseudomallei 0.8968 1 203
4jgb-assembly1.cif.gz_A crystal structure of putative exported protein from burkholderia pseudomallei 0.8884 1 203
ID Description Score Start End Superfamily
af_Q2QVJ5_13_242_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9209 2 33 3.90.180.10
af_P76113_12_234_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9129 2 33 3.40.50.2300
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.912 2 33 3.90.180.10
2jaeB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8986 2 32 3.50.50.60
4jgbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8968 1 203 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2N5C593-F1-model_v4 3-beta hydroxysteroid dehydrogenase 0.9822 64 203 GO:0016646
AF-A0A519I2U4-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9815 94 203 GO:0016646
AF-A0A6L9QHW1-F1-model_v4 NAD(P)H-binding protein 0.9797 80 203 GO:0016646
AF-A0A6I6MM52-F1-model_v4 NADH-flavin reductase 0.9764 1 203 GO:0016646
AF-A0A6M0CWA0-F1-model_v4 NAD(P)H-binding protein 0.9743 46 203 GO:0016646

Map