F343914

General Info

Members Datasets Scaffolds Average Seq Length
231 145 462 220

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10060788|Ga0075366_100607883
Length 255
Sequence VIPLRDDVPSRTVPFVNYGLIAINALAFIYELGLGEGLQRFVFRAAVVPVLFTGPDHALSLLEVITTTFDPSTGSRVLVAMFLHGGWAHLLGNMLYLWIFGDNVEDRLGHGRYIVFYLLCGWTASYAHVWSDPSSRLPSLGASGAIAGVLGAYITLYPHARVVTLLPLGIFMQLIQIPALFFLGLWFLQQFLAGALTLSVRTAQTGGGVAWWAHIGGFAAGFILVWLFQKPSRRPPVRDDWWQREYGSRRRLRGW

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
101 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 3.46
Rhizosphere 95.67
Stem 0
Stem Tuber 0
Unclassified 6.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10060788 3300006195 Bacteria 2245
2 JGI25406J46586_10000382 3300003203 Bacteria 20298
3 JGI25406J46586_10055003 3300003203 Bacteria 1313
4 Ga0065714_10196146 3300005288 Bacteria 911
5 Ga0065712_10179720 3300005290 Bacteria 1199
6 Ga0065715_10334354 3300005293 Bacteria 978
7 Ga0065715_10374099 3300005293 Bacteria 917
8 Ga0065707_10082042 3300005295 Bacteria 23794
9 Ga0065707_10288509 3300005295 Bacteria 1031
10 Ga0070658_10501498 3300005327 Bacteria 1048
11 Ga0070690_100176018 3300005330 Bacteria 1476
12 Ga0070690_100319880 3300005330 Bacteria 1118
13 Ga0070670_100309381 3300005331 Unclassified 1383
14 Ga0070670_100776768 3300005331 Unclassified 864
15 Ga0070677_10060860 3300005333 Bacteria 1557
16 Ga0070666_10132657 3300005335 Bacteria 1732
17 Ga0070680_100071897 3300005336 Bacteria 2843
18 Ga0070660_100034550 3300005339 Bacteria 3821
19 Ga0070661_100613403 3300005344 Bacteria 881
20 Ga0070675_100412025 3300005354 Bacteria 1207
21 Ga0070671_100382566 3300005355 Bacteria 1203
22 Ga0070673_100007814 3300005364 Bacteria 7081
23 Ga0070673_100457713 3300005364 Bacteria 1148
24 Ga0070673_100606213 3300005364 Bacteria 999
25 Ga0070688_100560351 3300005365 Bacteria 870
26 Ga0070659_100287912 3300005366 Bacteria 1368
27 Ga0070701_10015831 3300005438 Bacteria 3493
28 Ga0070701_10140876 3300005438 Bacteria 1379
29 Ga0070705_100470021 3300005440 Bacteria 948
30 Ga0070700_100135865 3300005441 Bacteria 1665
31 Ga0070694_100453425 3300005444 Bacteria 1013
32 Ga0070662_100204896 3300005457 Bacteria 1567
33 Ga0070662_100349348 3300005457 Bacteria 1211
34 Ga0070681_10409429 3300005458 Bacteria 1268
35 Ga0070707_100196579 3300005468 Bacteria 1966
36 Ga0070707_100629051 3300005468 Bacteria 1036
37 Ga0070707_100799869 3300005468 Bacteria 907
38 Ga0070699_100122576 3300005518 Bacteria 2287
39 Ga0070699_100168742 3300005518 Bacteria 1939
40 Ga0070679_100141504 3300005530 Bacteria 2385
41 Ga0068853_100453249 3300005539 Bacteria 1207
42 Ga0070672_100922320 3300005543 Bacteria 772
43 Ga0070686_100042986 3300005544 Bacteria 2833
44 Ga0070686_100293237 3300005544 Bacteria 1204
45 Ga0070696_100541401 3300005546 Bacteria 932
46 Ga0070665_100101077 3300005548 Bacteria 2888
47 Ga0070665_100118317 3300005548 Unclassified 2652
48 Ga0070704_100951230 3300005549 Bacteria 775
49 Ga0068855_100216578 3300005563 Bacteria 2149
50 Ga0070664_100490161 3300005564 Bacteria 1132
51 Ga0070664_100645080 3300005564 Bacteria 984
52 Ga0070664_100816281 3300005564 Bacteria 872
53 Ga0068857_100067846 3300005577 Bacteria 3175
54 Ga0068857_100380939 3300005577 Bacteria 1310
55 Ga0068859_100060544 3300005617 Bacteria 3815
56 Ga0068859_100104871 3300005617 Bacteria 2886
57 Ga0068859_100649950 3300005617 Bacteria 1146
58 Ga0068859_101250602 3300005617 Bacteria 818
59 Ga0068864_100031796 3300005618 Bacteria 4479
60 Ga0068864_100055126 3300005618 Bacteria 3431
61 Ga0068864_100106291 3300005618 Bacteria 2496
62 Ga0068861_100503310 3300005719 Bacteria 1095
63 Ga0068851_10330277 3300005834 Bacteria 883
64 Ga0068863_100121498 3300005841 Bacteria 2491
65 Ga0068863_100181977 3300005841 Unclassified 2017
66 Ga0068863_100556511 3300005841 Bacteria 1133
67 Ga0068863_100879604 3300005841 Bacteria 896
68 Ga0068858_100005669 3300005842 Bacteria 12205
69 Ga0068858_100005990 3300005842 Bacteria 11873
70 Ga0068858_100879731 3300005842 Bacteria 876
71 Ga0068860_100191183 3300005843 Bacteria 1981
72 Ga0068862_100233739 3300005844 Unclassified 1669
73 Ga0068862_100419397 3300005844 Bacteria 1256
74 Ga0081539_10000112 3300005985 Bacteria 190218
75 Ga0081539_10001191 3300005985 Bacteria 46937
76 Ga0081539_10003388 3300005985 Bacteria 19723
77 Ga0081539_10052439 3300005985 Bacteria 2290
78 Ga0068871_100126814 3300006358 Bacteria 2161
79 Ga0075428_100614304 3300006844 Bacteria 1161
80 Ga0075434_100007167 3300006871 Bacteria 10306
81 Ga0075434_100021361 3300006871 Bacteria 6291
82 Ga0075434_100080809 3300006871 Bacteria 3248
83 Ga0075434_100115219 3300006871 Bacteria 2700
84 Ga0075434_100411097 3300006871 Bacteria 1374
85 Ga0075429_100530331 3300006880 Bacteria 1032
86 Ga0068865_100185632 3300006881 Unclassified 1604
87 Ga0075436_100076255 3300006914 Bacteria 2321
88 Ga0097620_100060544 3300006931 Bacteria 3815
89 Ga0097620_100104874 3300006931 Bacteria 2886
90 Ga0097620_100650000 3300006931 Bacteria 1146
91 Ga0097620_101250769 3300006931 Bacteria 818
92 Ga0075435_100002899 3300007076 Bacteria 11515
93 Ga0075435_100050901 3300007076 Bacteria 3334
94 Ga0111539_10007479 3300009094 Bacteria 13986
95 Ga0111539_10013457 3300009094 Bacteria 10227
96 Ga0111539_10233185 3300009094 Bacteria 2143
97 Ga0111539_10322788 3300009094 Bacteria 1797
98 Ga0111539_10398205 3300009094 Bacteria 1604
99 Ga0111539_10596164 3300009094 Bacteria 1287
100 Ga0105245_10777202 3300009098 Bacteria 995
101 Ga0114129_10219794 3300009147 Bacteria 2563
102 Ga0105241_10886140 3300009174 Bacteria 828
103 Ga0105242_10069236 3300009176 Bacteria 2922
104 Ga0105248_10006557 3300009177 Bacteria 12764
105 Ga0105248_10150080 3300009177 Bacteria 2629
106 Ga0105248_10488765 3300009177 Bacteria 1387
107 Ga0105248_10610636 3300009177 Bacteria 1230
108 Ga0105246_10236206 3300011119 Bacteria 1442
109 Ga0105246_10544256 3300011119 Unclassified 994
110 Ga0157374_10738693 3300013296 Bacteria 998
111 Ga0157378_10478345 3300013297 Bacteria 1241
112 Ga0163162_10269563 3300013306 Bacteria 1834
113 Ga0163163_10000833 3300014325 Bacteria 26251
114 Ga0163163_10047228 3300014325 Bacteria 4232
115 Ga0163163_10200731 3300014325 Bacteria 2042
116 Ga0157380_11401389 3300014326 Bacteria 749
117 Ga0157379_10229243 3300014968 Bacteria 1683
118 Ga0157376_10030176 3300014969 Bacteria 4326
119 Ga0157376_10083364 3300014969 Bacteria 2750
120 Ga0207656_10161151 3300025321 Bacteria 1068
121 Ga0207710_10034418 3300025900 Bacteria 2226
122 Ga0207688_10125948 3300025901 Bacteria 1498
123 Ga0207654_10444758 3300025911 Bacteria 908
124 Ga0207707_10606748 3300025912 Bacteria 926
125 Ga0207660_10229841 3300025917 Bacteria 1458
126 Ga0207657_10026974 3300025919 Bacteria 5267
127 Ga0207646_10136603 3300025922 Bacteria 2208
128 Ga0207646_10196971 3300025922 Bacteria 1819
129 Ga0207650_10174529 3300025925 Unclassified 1710
130 Ga0207650_10505866 3300025925 Unclassified 1010
131 Ga0207690_10214024 3300025932 Bacteria 1471
132 Ga0207706_10106444 3300025933 Unclassified 2468
133 Ga0207704_10118744 3300025938 Unclassified 1804
134 Ga0207691_10233740 3300025940 Bacteria 1591
135 Ga0207711_10380501 3300025941 Bacteria 1310
136 Ga0207711_10490613 3300025941 Bacteria 1144
137 Ga0207711_10687551 3300025941 Bacteria 954
138 Ga0207689_10752514 3300025942 Bacteria 822
139 Ga0207679_10386096 3300025945 Bacteria 1229
140 Ga0207667_10175088 3300025949 Bacteria 2205
141 Ga0207651_10005327 3300025960 Bacteria 6593
142 Ga0207651_10534994 3300025960 Bacteria 1017
143 Ga0207712_10195907 3300025961 Bacteria 1598
144 Ga0207712_10488015 3300025961 Unclassified 1051
145 Ga0207677_10093362 3300026023 Bacteria 2194
146 Ga0207703_10004466 3300026035 Bacteria 11488
147 Ga0207703_10034648 3300026035 Bacteria 4007
148 Ga0207708_10013976 3300026075 Bacteria 5996
149 Ga0207708_10051824 3300026075 Unclassified 3125
150 Ga0207641_10036522 3300026088 Bacteria 4102
151 Ga0207676_10036892 3300026095 Unclassified 3721
152 Ga0207676_10071912 3300026095 Bacteria 2778
153 Ga0207676_10265705 3300026095 Bacteria 1551
154 Ga0207674_10089227 3300026116 Bacteria 3076
155 Ga0207674_10163268 3300026116 Bacteria 2182
156 Ga0207698_10983591 3300026142 Bacteria 854
157 Ga0207428_10001075 3300027907 Bacteria 29809
158 Ga0207428_10163642 3300027907 Bacteria 1688
159 Ga0207428_10415261 3300027907 Bacteria 984
160 Ga0268265_10012863 3300028380 Bacteria 5681
161 Ga0268265_10193179 3300028380 Bacteria 1760
162 Ga0307416_101298335 3300032002 Bacteria 834
163 Ga0373937_0193393 3300036401 Bacteria 1912
164 Ga0373937_0784855 3300036401 Bacteria 900
165 Ga0373925_0180712 3300037068 Bacteria 1670
166 Ga0439464_0061521 3300042439 Bacteria 1099
167 Ga0450916_021869 3300042530 Bacteria 883
168 Ga0451576_0049146 3300045051 Bacteria 4427
169 Ga0451576_0694183 3300045051 Bacteria 1069
170 Ga0466967_0130076 3300045976 Bacteria 2336
171 Ga0495664_0394073 3300046477 Bacteria 832
172 Ga0495628_0235314 3300046516 Bacteria 1372
173 Ga0495630_0151795 3300046517 Bacteria 1763
174 Ga0495630_0784332 3300046517 Bacteria 728
175 Ga0495640_0194991 3300046533 Bacteria 1286
176 Ga0495645_0258009 3300046543 Bacteria 1156
177 Ga0495667_0362051 3300046559 Bacteria 916
178 Ga0495635_0422391 3300046663 Bacteria 884
179 Ga0495599_0219411 3300046678 Bacteria 1164
180 Ga0495672_0002079 3300047320 Bacteria 18800
181 Ga0496104_0060563 3300048907 Bacteria 3586
182 Ga0496105_0618273 3300048908 Bacteria 839
183 Ga0496108_0019008 3300048911 Bacteria 5636
184 Ga0496109_0204239 3300048912 Bacteria 1858
185 Ga0496110_0039341 3300048913 Bacteria 4117
186 Ga0496111_0131053 3300048914 Bacteria 1855
187 Ga0496113_0001902 3300048916 Bacteria 11922
188 Ga0496113_0553112 3300048916 Bacteria 923
189 Ga0501034_0091563 3300049571 Bacteria 3038
190 Ga0501042_0274469 3300049578 Bacteria 1217
191 Ga0501042_0281677 3300049578 Bacteria 1201
192 Ga0501043_0344053 3300049579 Bacteria 1134
193 Ga0501047_0026212 3300049581 Bacteria 5607
194 Ga0501071_0612642 3300049587 Bacteria 837
195 Ga0501071_0894611 3300049587 Bacteria 685
196 Ga0501072_0065621 3300049588 Bacteria 2863
197 Ga0501073_0000212 3300049589 Bacteria 37764
198 Ga0501073_0113971 3300049589 Bacteria 1874
199 Ga0501075_0163208 3300049591 Bacteria 1700
200 Ga0501076_0114601 3300049592 Bacteria 2181
201 Ga0501081_0096844 3300049743 Bacteria 2082
202 Ga0501044_0016902 3300049823 Bacteria 7826
203 nmdc:mga05p37_176936_c1 3300050507 Bacteria 2599
204 nmdc:mga08y16_194858_c1 3300050511 Bacteria 2101
205 nmdc:mga08y16_24355_c1 3300050511 Bacteria 6389
206 nmdc:mga08y16_386690_c1 3300050511 Bacteria 1434
207 nmdc:mga08y16_60471_c1 3300050511 Bacteria 3956
208 nmdc:mga0n895_117971_c1 3300050512 Bacteria 2673
209 nmdc:mga0n895_121973_c1 3300050512 Bacteria 2628
210 nmdc:mga0n895_16894_c1 3300050512 Bacteria 6711
211 nmdc:mga0n895_177464_c1 3300050512 Bacteria 2161
212 nmdc:mga0n895_63192_c1 3300050512 Unclassified 3661
213 nmdc:mga0n895_672053_c1 3300050512 Bacteria 1033
214 nmdc:mga0rr50_309102_c1 3300050513 Bacteria 1324
215 nmdc:mga0rr50_5053_c1 3300050513 Bacteria 7823
216 nmdc:mga0rr50_87515_c1 3300050513 Bacteria 2418
217 nmdc:mga08x19_121121_c1 3300050514 Bacteria 1754
218 nmdc:mga0a205_205528_c1 3300050515 Bacteria 1859
219 nmdc:mga0a205_214010_c1 3300050515 Bacteria 1814
220 nmdc:mga0a205_27877_c1 3300050515 Bacteria 5396
221 nmdc:mga0a205_50693_c1 3300050515 Bacteria 4007
222 Ga0495601_0059249 3300053077 Bacteria 2428
223 Ga0495619_0058586 3300053085 Bacteria 2557
224 Ga0495619_0214607 3300053085 Bacteria 1333
225 Ga0500641_0002669 3300053096 Bacteria 6300
226 Ga0501084_0303809 3300054114 Bacteria 1348
227 Ga0590071_000830 3300059421 Bacteria 8601
228 Ga0590074_003537 3300059423 Bacteria 2585
229 Ga0590075_000073 3300059424 Bacteria 25470
230 Ga0590077_000019 3300059426 Bacteria 36794
231 Ga0530510_0258788 3300061734 Bacteria 1297
232 Ga0075366_10060788
233 JGI25406J46586_10000382
234 JGI25406J46586_10055003
235 Ga0065714_10196146
236 Ga0065712_10179720
237 Ga0065715_10334354
238 Ga0065715_10374099
239 Ga0065707_10082042
240 Ga0065707_10288509
241 Ga0070658_10501498
242 Ga0070690_100176018
243 Ga0070690_100319880
244 Ga0070670_100309381
245 Ga0070670_100776768
246 Ga0070677_10060860
247 Ga0070666_10132657
248 Ga0070680_100071897
249 Ga0070660_100034550
250 Ga0070661_100613403
251 Ga0070675_100412025
252 Ga0070671_100382566
253 Ga0070673_100007814
254 Ga0070673_100457713
255 Ga0070673_100606213
256 Ga0070688_100560351
257 Ga0070659_100287912
258 Ga0070701_10015831
259 Ga0070701_10140876
260 Ga0070705_100470021
261 Ga0070700_100135865
262 Ga0070694_100453425
263 Ga0070662_100204896
264 Ga0070662_100349348
265 Ga0070681_10409429
266 Ga0070707_100196579
267 Ga0070707_100629051
268 Ga0070707_100799869
269 Ga0070699_100122576
270 Ga0070699_100168742
271 Ga0070679_100141504
272 Ga0068853_100453249
273 Ga0070672_100922320
274 Ga0070686_100042986
275 Ga0070686_100293237
276 Ga0070696_100541401
277 Ga0070665_100101077
278 Ga0070665_100118317
279 Ga0070704_100951230
280 Ga0068855_100216578
281 Ga0070664_100490161
282 Ga0070664_100645080
283 Ga0070664_100816281
284 Ga0068857_100067846
285 Ga0068857_100380939
286 Ga0068859_100060544
287 Ga0068859_100104871
288 Ga0068859_100649950
289 Ga0068859_101250602
290 Ga0068864_100031796
291 Ga0068864_100055126
292 Ga0068864_100106291
293 Ga0068861_100503310
294 Ga0068851_10330277
295 Ga0068863_100121498
296 Ga0068863_100181977
297 Ga0068863_100556511
298 Ga0068863_100879604
299 Ga0068858_100005669
300 Ga0068858_100005990
301 Ga0068858_100879731
302 Ga0068860_100191183
303 Ga0068862_100233739
304 Ga0068862_100419397
305 Ga0081539_10000112
306 Ga0081539_10001191
307 Ga0081539_10003388
308 Ga0081539_10052439
309 Ga0068871_100126814
310 Ga0075428_100614304
311 Ga0075434_100007167
312 Ga0075434_100021361
313 Ga0075434_100080809
314 Ga0075434_100115219
315 Ga0075434_100411097
316 Ga0075429_100530331
317 Ga0068865_100185632
318 Ga0075436_100076255
319 Ga0097620_100060544
320 Ga0097620_100104874
321 Ga0097620_100650000
322 Ga0097620_101250769
323 Ga0075435_100002899
324 Ga0075435_100050901
325 Ga0111539_10007479
326 Ga0111539_10013457
327 Ga0111539_10233185
328 Ga0111539_10322788
329 Ga0111539_10398205
330 Ga0111539_10596164
331 Ga0105245_10777202
332 Ga0114129_10219794
333 Ga0105241_10886140
334 Ga0105242_10069236
335 Ga0105248_10006557
336 Ga0105248_10150080
337 Ga0105248_10488765
338 Ga0105248_10610636
339 Ga0105246_10236206
340 Ga0105246_10544256
341 Ga0157374_10738693
342 Ga0157378_10478345
343 Ga0163162_10269563
344 Ga0163163_10000833
345 Ga0163163_10047228
346 Ga0163163_10200731
347 Ga0157380_11401389
348 Ga0157379_10229243
349 Ga0157376_10030176
350 Ga0157376_10083364
351 Ga0207656_10161151
352 Ga0207710_10034418
353 Ga0207688_10125948
354 Ga0207654_10444758
355 Ga0207707_10606748
356 Ga0207660_10229841
357 Ga0207657_10026974
358 Ga0207646_10136603
359 Ga0207646_10196971
360 Ga0207650_10174529
361 Ga0207650_10505866
362 Ga0207690_10214024
363 Ga0207706_10106444
364 Ga0207704_10118744
365 Ga0207691_10233740
366 Ga0207711_10380501
367 Ga0207711_10490613
368 Ga0207711_10687551
369 Ga0207689_10752514
370 Ga0207679_10386096
371 Ga0207667_10175088
372 Ga0207651_10005327
373 Ga0207651_10534994
374 Ga0207712_10195907
375 Ga0207712_10488015
376 Ga0207677_10093362
377 Ga0207703_10004466
378 Ga0207703_10034648
379 Ga0207708_10013976
380 Ga0207708_10051824
381 Ga0207641_10036522
382 Ga0207676_10036892
383 Ga0207676_10071912
384 Ga0207676_10265705
385 Ga0207674_10089227
386 Ga0207674_10163268
387 Ga0207698_10983591
388 Ga0207428_10001075
389 Ga0207428_10163642
390 Ga0207428_10415261
391 Ga0268265_10012863
392 Ga0268265_10193179
393 Ga0307416_101298335
394 Ga0373937_0193393
395 Ga0373937_0784855
396 Ga0373925_0180712
397 Ga0439464_0061521
398 Ga0450916_021869
399 Ga0451576_0049146
400 Ga0451576_0694183
401 Ga0466967_0130076
402 Ga0495664_0394073
403 Ga0495628_0235314
404 Ga0495630_0151795
405 Ga0495630_0784332
406 Ga0495640_0194991
407 Ga0495645_0258009
408 Ga0495667_0362051
409 Ga0495635_0422391
410 Ga0495599_0219411
411 Ga0495672_0002079
412 Ga0496104_0060563
413 Ga0496105_0618273
414 Ga0496108_0019008
415 Ga0496109_0204239
416 Ga0496110_0039341
417 Ga0496111_0131053
418 Ga0496113_0001902
419 Ga0496113_0553112
420 Ga0501034_0091563
421 Ga0501042_0274469
422 Ga0501042_0281677
423 Ga0501043_0344053
424 Ga0501047_0026212
425 Ga0501071_0612642
426 Ga0501071_0894611
427 Ga0501072_0065621
428 Ga0501073_0000212
429 Ga0501073_0113971
430 Ga0501075_0163208
431 Ga0501076_0114601
432 Ga0501081_0096844
433 Ga0501044_0016902
434 nmdc:mga05p37_176936_c1
435 nmdc:mga08y16_194858_c1
436 nmdc:mga08y16_24355_c1
437 nmdc:mga08y16_386690_c1
438 nmdc:mga08y16_60471_c1
439 nmdc:mga0n895_117971_c1
440 nmdc:mga0n895_121973_c1
441 nmdc:mga0n895_16894_c1
442 nmdc:mga0n895_177464_c1
443 nmdc:mga0n895_63192_c1
444 nmdc:mga0n895_672053_c1
445 nmdc:mga0rr50_309102_c1
446 nmdc:mga0rr50_5053_c1
447 nmdc:mga0rr50_87515_c1
448 nmdc:mga08x19_121121_c1
449 nmdc:mga0a205_205528_c1
450 nmdc:mga0a205_214010_c1
451 nmdc:mga0a205_27877_c1
452 nmdc:mga0a205_50693_c1
453 Ga0495601_0059249
454 Ga0495619_0058586
455 Ga0495619_0214607
456 Ga0500641_0002669
457 Ga0501084_0303809
458 Ga0590071_000830
459 Ga0590074_003537
460 Ga0590075_000073
461 Ga0590077_000019
462 Ga0530510_0258788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

71

231

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nr9-assembly1.cif.gz_A crystal structure of glpg, rhomboid peptidase from haemophilus influenzae 0.7553 16 208
6pj5-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7332 11 208
2nrf-assembly1.cif.gz_B crystal structure of glpg, a rhomboid family intramembrane protease 0.7297 16 208
3zmi-assembly1.cif.gz_A structure of e.coli rhomboid protease glpg in complex with monobactam l29 0.7266 16 208
5f5d-assembly1.cif.gz_A crystal structures and inhibition kinetics reveal a two-state catalytic mechanism with drug design implications for rhomboid proteolysis 0.7264 16 208
ID Description Score Start End Superfamily
af_Q8I3V7_262_478_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8319 55 203 1.20.1540.10
af_P53259_136_338_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8284 14 208 1.20.1540.10
af_A0A0P0VIC0_209_332_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8263 16 120 1.20.1540.10
3odjA00 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8222 16 135 1.20.1540.10
af_A0A6V7QZA6_121_312_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8065 17 209 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A382KFD3-F1-model_v4 Peptidase S54 rhomboid domain-containing protein 0.9856 12 131 GO:0004252
GO:0016020
AF-A0A521X534-F1-model_v4 Rhomboid family intramembrane serine protease 0.9689 1 174 GO:0004252
GO:0006508
GO:0016020
AF-A0A3D1AYP5-F1-model_v4 Rhomboid family intramembrane serine protease 0.9666 1 209 GO:0004252
GO:0006508
GO:0016020
AF-A0A7C2S7A3-F1-model_v4 Rhomboid family intramembrane serine protease 0.9631 1 159 GO:0004252
GO:0006508
GO:0016020
AF-A0A2D6E8A1-F1-model_v4 deleted 0.9626 2 209

Map