F343833

General Info

Members Datasets Scaffolds Average Seq Length
231 127 231 91

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100333438|Ga0070699_1003334382
Length 105
Sequence VLLTSPASRMIEKKPNKGEGNEQASELDQAELAHSIIESLLEHTRVVSDLIALMAQTLDQDTTKALTLTPQWQAYLESRRGMERTREDVEKFVDLIRKSGQEHPG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
116 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
117 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.57
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_386952 2162886007 Bacteria 952
2 JGI24034J14986_102323 3300001432 Bacteria 991
3 JGI24748J21848_1000025 3300002074 Bacteria 102370
4 JGI24034J26672_10000001 3300002239 Bacteria 1118280
5 JGI24742J22300_10017052 3300002244 Unclassified 1227
6 Ga0065704_10092738 3300005289 Bacteria 2636
7 Ga0065715_10038468 3300005293 Unclassified 1181
8 Ga0065715_10099551 3300005293 Unclassified 3398
9 Ga0065715_10551200 3300005293 Bacteria 736
10 Ga0065707_10006743 3300005295 Bacteria 4286
11 Ga0065707_10104348 3300005295 Bacteria 2700
12 Ga0065707_10446247 3300005295 Unclassified 805
13 Ga0070690_100102996 3300005330 Unclassified 1895
14 Ga0070690_100146845 3300005330 Bacteria 1605
15 Ga0070690_100150526 3300005330 Bacteria 1587
16 Ga0070690_100405482 3300005330 Bacteria 1002
17 Ga0070666_10188122 3300005335 Bacteria 1450
18 Ga0070680_100565325 3300005336 Bacteria 975
19 Ga0070680_100756449 3300005336 Bacteria 837
20 Ga0068868_101277062 3300005338 Bacteria 681
21 Ga0070687_100004254 3300005343 Bacteria 5690
22 Ga0070687_100018612 3300005343 Unclassified 3217
23 Ga0070692_10024494 3300005345 Bacteria 2967
24 Ga0070692_10239931 3300005345 Bacteria 1080
25 Ga0070692_10614163 3300005345 Unclassified 721
26 Ga0070692_10785060 3300005345 Unclassified 649
27 Ga0070669_100480138 3300005353 Bacteria 1028
28 Ga0070671_100086331 3300005355 Bacteria 2625
29 Ga0070674_100848250 3300005356 Viruses 792
30 Ga0070673_100135188 3300005364 Bacteria 2074
31 Ga0070688_100136535 3300005365 Bacteria 1661
32 Ga0070667_100735086 3300005367 Bacteria 914
33 Ga0070703_10060377 3300005406 Bacteria 1239
34 Ga0070701_10703313 3300005438 Bacteria 680
35 Ga0070705_100297621 3300005440 Bacteria 1155
36 Ga0070705_100430351 3300005440 Unclassified 985
37 Ga0070705_101508995 3300005440 Unclassified 563
38 Ga0070700_100012266 3300005441 Bacteria 4776
39 Ga0070700_100044750 3300005441 Bacteria 2728
40 Ga0070700_101911471 3300005441 Bacteria 513
41 Ga0070694_100347685 3300005444 Bacteria 1148
42 Ga0070694_100457397 3300005444 Bacteria 1009
43 Ga0070694_100575843 3300005444 Bacteria 904
44 Ga0070694_100686321 3300005444 Bacteria 832
45 Ga0070694_101482565 3300005444 Bacteria 574
46 Ga0070708_100005702 3300005445 Bacteria 9875
47 Ga0070708_100509362 3300005445 Bacteria 1135
48 Ga0070708_101299847 3300005445 Bacteria 679
49 Ga0070708_101585406 3300005445 Bacteria 609
50 Ga0070662_100062884 3300005457 Bacteria 2713
51 Ga0070662_100095106 3300005457 Bacteria 2245
52 Ga0070662_100437828 3300005457 Bacteria 1083
53 Ga0070681_11142422 3300005458 Bacteria 700
54 Ga0068867_100192551 3300005459 Bacteria 1628
55 Ga0068867_100351197 3300005459 Bacteria 1231
56 Ga0070706_100006868 3300005467 Bacteria 10747
57 Ga0070706_100008186 3300005467 Bacteria 9755
58 Ga0070707_100005488 3300005468 Bacteria 11861
59 Ga0070707_101879997 3300005468 Unclassified 566
60 Ga0070698_100004943 3300005471 Bacteria 14614
61 Ga0070698_100385023 3300005471 Bacteria 1335
62 Ga0070699_100206487 3300005518 Bacteria 1748
63 Ga0070699_100291181 3300005518 Bacteria 1464
64 Ga0070699_100333438 3300005518 Bacteria 1365
65 Ga0070699_101303187 3300005518 Unclassified 666
66 Ga0070697_100025046 3300005536 Bacteria 4756
67 Ga0070697_100077179 3300005536 Bacteria 2740
68 Ga0070697_100162665 3300005536 Unclassified 1886
69 Ga0070697_100280925 3300005536 Bacteria 1428
70 Ga0070672_100205902 3300005543 Bacteria 1646
71 Ga0070686_100002652 3300005544 Bacteria 9859
72 Ga0070686_100134553 3300005544 Bacteria 1713
73 Ga0070686_100138999 3300005544 Bacteria 1688
74 Ga0070686_100536040 3300005544 Bacteria 914
75 Ga0070695_100190229 3300005545 Bacteria 1460
76 Ga0070695_100444679 3300005545 Unclassified 992
77 Ga0070695_100678172 3300005545 Bacteria 816
78 Ga0070695_101753278 3300005545 Bacteria 520
79 Ga0070696_100717375 3300005546 Unclassified 816
80 Ga0070704_100040395 3300005549 Bacteria 3211
81 Ga0070704_100043798 3300005549 Bacteria 3105
82 Ga0070704_100070707 3300005549 Unclassified 2533
83 Ga0070704_100972927 3300005549 Unclassified 766
84 Ga0068854_100463824 3300005578 Bacteria 1060
85 Ga0070702_100185554 3300005615 Bacteria 1365
86 Ga0068852_101509782 3300005616 Unclassified 694
87 Ga0068859_100110843 3300005617 Bacteria 2806
88 Ga0068859_100349165 3300005617 Bacteria 1574
89 Ga0068864_100299698 3300005618 Bacteria 1505
90 Ga0068861_100007557 3300005719 Bacteria 7457
91 Ga0068861_100063974 3300005719 Bacteria 2829
92 Ga0068861_101028986 3300005719 Bacteria 788
93 Ga0068858_100000344 3300005842 Bacteria 49247
94 Ga0068860_100060984 3300005843 Bacteria 3583
95 Ga0068862_100075069 3300005844 Bacteria 2923
96 Ga0068862_100159952 3300005844 Bacteria 2010
97 Ga0081539_10001941 3300005985 Bacteria 31706
98 Ga0070715_10000034 3300006163 Bacteria 80012
99 Ga0070716_100120055 3300006173 Bacteria 1644
100 Ga0070716_100400300 3300006173 Bacteria 987
101 Ga0097621_101139422 3300006237 Unclassified 733
102 Ga0075428_100245502 3300006844 Bacteria 1931
103 Ga0075428_100515108 3300006844 Bacteria 1279
104 Ga0075430_100554343 3300006846 Unclassified 948
105 Ga0075431_101012519 3300006847 Bacteria 797
106 Ga0075433_10579278 3300006852 Bacteria 986
107 Ga0075433_10642907 3300006852 Bacteria 930
108 Ga0075434_100503429 3300006871 Bacteria 1232
109 Ga0075429_100024899 3300006880 Bacteria 5195
110 Ga0068865_100770762 3300006881 Bacteria 828
111 Ga0075436_100000009 3300006914 Bacteria 256132
112 Ga0097620_100110843 3300006931 Bacteria 2806
113 Ga0097620_100349210 3300006931 Bacteria 1574
114 Ga0075435_100007383 3300007076 Bacteria 7828
115 Ga0111539_10983175 3300009094 Bacteria 981
116 Ga0111539_10987974 3300009094 Bacteria 979
117 Ga0111539_11082454 3300009094 Bacteria 931
118 Ga0105245_11761470 3300009098 Bacteria 672
119 Ga0105247_10000002 3300009101 Bacteria 724587
120 Ga0114129_10037123 3300009147 Bacteria 6879
121 Ga0114129_10117451 3300009147 Unclassified 3665
122 Ga0114129_10393482 3300009147 Bacteria 1827
123 Ga0114129_10787143 3300009147 Bacteria 1214
124 Ga0114129_11058195 3300009147 Unclassified 1018
125 Ga0114129_13271919 3300009147 Unclassified 525
126 Ga0105243_10172927 3300009148 Bacteria 1872
127 Ga0105242_10053462 3300009176 Bacteria 3298
128 Ga0105248_10137061 3300009177 Bacteria 2761
129 Ga0105248_11161197 3300009177 Unclassified 873
130 Ga0105248_11808744 3300009177 Bacteria 693
131 Ga0105249_10044881 3300009553 Bacteria 4019
132 Ga0105249_10296258 3300009553 Bacteria 1621
133 Ga0105249_13040071 3300009553 Unclassified 539
134 Ga0105239_10741894 3300010375 Bacteria 1124
135 Ga0105246_10194003 3300011119 Bacteria 1574
136 Ga0157373_10851175 3300013100 Unclassified 674
137 Ga0157378_10137672 3300013297 Bacteria 2265
138 Ga0157378_10569577 3300013297 Bacteria 1140
139 Ga0157378_11925967 3300013297 Bacteria 640
140 Ga0163162_10422040 3300013306 Unclassified 1466
141 Ga0163162_10753116 3300013306 Unclassified 1093
142 Ga0163162_11146466 3300013306 Bacteria 881
143 Ga0157375_10244097 3300013308 Bacteria 1956
144 Ga0157380_10001205 3300014326 Bacteria 16752
145 Ga0157380_10021417 3300014326 Bacteria 4848
146 Ga0157380_10080244 3300014326 Bacteria 2667
147 Ga0157380_11352495 3300014326 Bacteria 761
148 Ga0157379_10653404 3300014968 Unclassified 985
149 Ga0163161_10712818 3300017792 Unclassified 836
150 Ga0207672_1000007 3300025223 Bacteria 27099
151 Ga0207653_10000145 3300025885 Bacteria 50672
152 Ga0207653_10030004 3300025885 Bacteria 1753
153 Ga0207710_10000002 3300025900 Bacteria 1251998
154 Ga0207685_10000006 3300025905 Bacteria 284255
155 Ga0207684_10005358 3300025910 Bacteria 11850
156 Ga0207684_10007548 3300025910 Bacteria 9780
157 Ga0207684_10049887 3300025910 Bacteria 3550
158 Ga0207707_11152120 3300025912 Bacteria 630
159 Ga0207662_10020084 3300025918 Bacteria 3810
160 Ga0207662_10022233 3300025918 Bacteria 3633
161 Ga0207662_10265631 3300025918 Unclassified 1131
162 Ga0207662_10888391 3300025918 Unclassified 631
163 Ga0207646_10001700 3300025922 Bacteria 26758
164 Ga0207646_10841188 3300025922 Unclassified 816
165 Ga0207681_10099505 3300025923 Bacteria 2094
166 Ga0207681_10282459 3300025923 Bacteria 1307
167 Ga0207644_10000889 3300025931 Bacteria 18867
168 Ga0207706_10456512 3300025933 Bacteria 1105
169 Ga0207670_10621786 3300025936 Unclassified 888
170 Ga0207704_10664181 3300025938 Bacteria 860
171 Ga0207704_11710058 3300025938 Bacteria 541
172 Ga0207704_11928658 3300025938 Unclassified 508
173 Ga0207665_10164006 3300025939 Bacteria 1601
174 Ga0207665_11550338 3300025939 Unclassified 526
175 Ga0207691_10660119 3300025940 Bacteria 883
176 Ga0207691_10840984 3300025940 Bacteria 770
177 Ga0207711_10515981 3300025941 Bacteria 1114
178 Ga0207711_11701601 3300025941 Unclassified 574
179 Ga0207711_11785247 3300025941 Unclassified 558
180 Ga0207689_11140389 3300025942 Bacteria 657
181 Ga0207651_10653617 3300025960 Unclassified 923
182 Ga0207651_11538746 3300025960 Bacteria 599
183 Ga0207651_11817513 3300025960 Bacteria 548
184 Ga0207712_10117212 3300025961 Bacteria 2008
185 Ga0207712_10630360 3300025961 Bacteria 930
186 Ga0207640_10092254 3300025981 Bacteria 2100
187 Ga0207703_10000332 3300026035 Bacteria 51596
188 Ga0207703_10358018 3300026035 Unclassified 1345
189 Ga0207703_11391710 3300026035 Unclassified 675
190 Ga0207708_10019188 3300026075 Bacteria 5150
191 Ga0207708_10059901 3300026075 Bacteria 2906
192 Ga0207708_10153369 3300026075 Bacteria 1816
193 Ga0207708_10407125 3300026075 Unclassified 1126
194 Ga0207708_11642427 3300026075 Bacteria 565
195 Ga0207648_10077324 3300026089 Bacteria 2901
196 Ga0207648_10084539 3300026089 Bacteria 2768
197 Ga0207648_10189395 3300026089 Bacteria 1822
198 Ga0207675_100033778 3300026118 Bacteria 4766
199 Ga0207675_100904603 3300026118 Bacteria 899
200 Ga0207698_12417817 3300026142 Bacteria 536
201 Ga0207428_10078297 3300027907 Unclassified 2587
202 Ga0268265_10014733 3300028380 Bacteria 5335
203 Ga0268265_10746768 3300028380 Bacteria 949
204 Ga0268265_11110976 3300028380 Bacteria 785
205 Ga0268264_10093505 3300028381 Bacteria 2597
206 Ga0307411_10629388 3300032005 Bacteria 926
207 Ga0307415_100219957 3300032126 Unclassified 1522
208 Ga0395900_0850186 3300037418 Bacteria 838
209 Ga0395900_1056953 3300037418 Unclassified 730
210 Ga0395898_1029158 3300037466 Unclassified 759
211 Ga0395905_0673629 3300037471 Unclassified 937
212 Ga0436365_0648028 3300039437 Bacteria 7366
213 Ga0436362_0622047 3300039453 Unclassified 882
214 Ga0439433_0037144 3300041999 Bacteria 1127
215 Ga0501299_135946 3300049522 Unclassified 607
216 Ga0501243_090855 3300049675 Unclassified 606
217 Ga0501035_1572417 3300049822 Unclassified 500
218 nmdc:mga05p37_1015138_c1 3300050507 Bacteria 879
219 nmdc:mga05p37_163177_c1 3300050507 Bacteria 2720
220 nmdc:mga05p37_22289_c1 3300050507 Bacteria 7681
221 nmdc:mga05p37_292645_c1 3300050507 Bacteria 1938
222 nmdc:mga05p37_64213_c1 3300050507 Unclassified 4517
223 nmdc:mga05p37_895945_c1 3300050507 Unclassified 957
224 nmdc:mga09592_79395_c1 3300050508 Unclassified 2793
225 nmdc:mga0qj67_681707_c1 3300050509 Unclassified 818
226 nmdc:mga06r32_929556_c1 3300050510 Bacteria 825
227 nmdc:mga08y16_181305_c1 3300050511 Bacteria 2187
228 nmdc:mga0rr50_520_c1 3300050513 Bacteria 20566
229 nmdc:mga08x19_107_c1 3300050514 Bacteria 74172
230 nmdc:mga0a205_593540_c1 3300050515 Bacteria 961
231 Ga0501082_0264956 3300060353 Bacteria 1495

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005343 Ga0070687_100018612 Ga0070687_1000186124 78
2 3300005293 Ga0065715_10099551 Ga0065715_100995513 80
3 3300005295 Ga0065707_10446247 Ga0065707_104462471 80
4 3300005518 Ga0070699_101303187 Ga0070699_1013031872 81
5 3300005545 Ga0070695_100444679 Ga0070695_1004446791 82
6 3300006852 Ga0075433_10642907 Ga0075433_106429072 82
7 3300006914 Ga0075436_100000009 Ga0075436_10000000917 82
8 3300007076 Ga0075435_100007383 Ga0075435_1000073834 82
9 3300009147 Ga0114129_10117451 Ga0114129_101174513 82
10 3300050507 nmdc:mga05p37_64213_c1 nmdc:mga05p37_64213_c1_213_470 82
11 3300050513 nmdc:mga0rr50_520_c1 nmdc:mga0rr50_520_c1_13753_14019 82
12 3300050514 nmdc:mga08x19_107_c1 nmdc:mga08x19_107_c1_56791_57057 82
13 3300050515 nmdc:mga0a205_593540_c1 nmdc:mga0a205_593540_c1_659_916 82
14 3300005295 Ga0065707_10006743 Ga0065707_100067434 83
15 3300005345 Ga0070692_10785060 Ga0070692_107850601 83
16 3300005365 Ga0070688_100136535 Ga0070688_1001365354 83
17 3300005367 Ga0070667_100735086 Ga0070667_1007350862 83
18 3300005440 Ga0070705_100297621 Ga0070705_1002976212 83
19 3300005441 Ga0070700_100044750 Ga0070700_1000447502 83
20 3300005444 Ga0070694_100686321 Ga0070694_1006863212 83
21 3300005445 Ga0070708_100005702 Ga0070708_1000057023 83
22 3300005544 Ga0070686_100134553 Ga0070686_1001345532 83
23 3300005615 Ga0070702_100185554 Ga0070702_1001855542 83
24 3300005617 Ga0068859_100110843 Ga0068859_1001108433 83
25 3300005618 Ga0068864_100299698 Ga0068864_1002996983 83
26 3300005843 Ga0068860_100060984 Ga0068860_1000609841 83
27 3300006163 Ga0070715_10000034 Ga0070715_1000003412 83
28 3300006844 Ga0075428_100515108 Ga0075428_1005151082 83
29 3300006846 Ga0075430_100554343 Ga0075430_1005543433 83
30 3300006880 Ga0075429_100024899 Ga0075429_1000248991 83
31 3300006931 Ga0097620_100110843 Ga0097620_1001108433 83
32 3300009177 Ga0105248_10137061 Ga0105248_101370612 83
33 3300009553 Ga0105249_13040071 Ga0105249_130400711 83
34 3300011119 Ga0105246_10194003 Ga0105246_101940031 83
35 3300017792 Ga0163161_10712818 Ga0163161_107128182 83
36 3300025885 Ga0207653_10000145 Ga0207653_1000014544 83
37 3300025905 Ga0207685_10000006 Ga0207685_1000000622 83
38 3300025918 Ga0207662_10265631 Ga0207662_102656313 83
39 3300025936 Ga0207670_10621786 Ga0207670_106217862 83
40 3300025941 Ga0207711_10515981 Ga0207711_105159812 83
41 3300025942 Ga0207689_11140389 Ga0207689_111403891 83
42 3300025960 Ga0207651_10653617 Ga0207651_106536172 83
43 3300026035 Ga0207703_10358018 Ga0207703_103580182 83
44 3300026075 Ga0207708_10019188 Ga0207708_100191886 83
45 3300026075 Ga0207708_10153369 Ga0207708_101533694 83
46 3300027907 Ga0207428_10078297 Ga0207428_100782973 83
47 3300028380 Ga0268265_11110976 Ga0268265_111109763 83
48 3300028381 Ga0268264_10093505 Ga0268264_100935052 83
49 3300050509 nmdc:mga0qj67_681707_c1 nmdc:mga0qj67_681707_c1_249_512 83
50 3300050511 nmdc:mga08y16_181305_c1 nmdc:mga08y16_181305_c1_887_1150 83
51 3300005444 Ga0070694_101482565 Ga0070694_1014825652 85
52 3300005445 Ga0070708_101585406 Ga0070708_1015854061 85
53 3300005467 Ga0070706_100008186 Ga0070706_1000081862 85
54 3300005468 Ga0070707_100005488 Ga0070707_10000548810 85
55 3300005471 Ga0070698_100385023 Ga0070698_1003850232 85
56 3300005536 Ga0070697_100162665 Ga0070697_1001626652 85
57 3300005536 Ga0070697_100280925 Ga0070697_1002809252 85
58 3300005549 Ga0070704_100070707 Ga0070704_1000707072 85
59 3300006173 Ga0070716_100120055 Ga0070716_1001200552 85
60 3300006847 Ga0075431_101012519 Ga0075431_1010125192 85
61 3300006852 Ga0075433_10579278 Ga0075433_105792782 85
62 3300006871 Ga0075434_100503429 Ga0075434_1005034292 85
63 3300009148 Ga0105243_10172927 Ga0105243_101729272 85
64 3300013297 Ga0157378_11925967 Ga0157378_119259672 85
65 3300025910 Ga0207684_10007548 Ga0207684_1000754812 85
66 3300025922 Ga0207646_10001700 Ga0207646_1000170021 85
67 3300025922 Ga0207646_10841188 Ga0207646_108411882 85
68 3300025939 Ga0207665_10164006 Ga0207665_101640063 85
69 3300026035 Ga0207703_11391710 Ga0207703_113917102 85
70 3300050507 nmdc:mga05p37_292645_c1 nmdc:mga05p37_292645_c1_195_470 85
71 3300050508 nmdc:mga09592_79395_c1 nmdc:mga09592_79395_c1_2043_2321 85
72 3300050510 nmdc:mga06r32_929556_c1 nmdc:mga06r32_929556_c1_272_547 85
73 3300005444 Ga0070694_100575843 Ga0070694_1005758432 86
74 3300005545 Ga0070695_100190229 Ga0070695_1001902292 86
75 3300001432 JGI24034J14986_102323 JGI24034J14986_1023232 87
76 3300002074 JGI24748J21848_1000025 JGI24748J21848_100002545 87
77 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001976 87
78 3300002244 JGI24742J22300_10017052 JGI24742J22300_100170522 87
79 3300005293 Ga0065715_10038468 Ga0065715_100384682 87
80 3300005330 Ga0070690_100405482 Ga0070690_1004054822 87
81 3300005353 Ga0070669_100480138 Ga0070669_1004801382 87
82 3300005355 Ga0070671_100086331 Ga0070671_1000863312 87
83 3300005356 Ga0070674_100848250 Ga0070674_1008482502 87
84 3300005406 Ga0070703_10060377 Ga0070703_100603772 87
85 3300005440 Ga0070705_100430351 Ga0070705_1004303511 87
86 3300005445 Ga0070708_100509362 Ga0070708_1005093622 87
87 3300005445 Ga0070708_101299847 Ga0070708_1012998471 87
88 3300005467 Ga0070706_100006868 Ga0070706_1000068687 87
89 3300005468 Ga0070707_101879997 Ga0070707_1018799971 87
90 3300005471 Ga0070698_100004943 Ga0070698_1000049433 87
91 3300005518 Ga0070699_100291181 Ga0070699_1002911811 87
92 3300005518 Ga0070699_100333438 Ga0070699_1003334382 87
93 3300005544 Ga0070686_100536040 Ga0070686_1005360403 87
94 3300005842 Ga0068858_100000344 Ga0068858_1000003444 87
95 3300006173 Ga0070716_100400300 Ga0070716_1004003002 87
96 3300009101 Ga0105247_10000002 Ga0105247_1000000243 87
97 3300013306 Ga0163162_10422040 Ga0163162_104220403 87
98 3300014968 Ga0157379_10653404 Ga0157379_106534042 87
99 3300025223 Ga0207672_1000007 Ga0207672_100000711 87
100 3300025885 Ga0207653_10030004 Ga0207653_100300042 87
101 3300025900 Ga0207710_10000002 Ga0207710_1000000244 87
102 3300025910 Ga0207684_10005358 Ga0207684_1000535810 87
103 3300025918 Ga0207662_10022233 Ga0207662_100222334 87
104 3300025931 Ga0207644_10000889 Ga0207644_100008897 87
105 3300025938 Ga0207704_11928658 Ga0207704_119286581 87
106 3300025939 Ga0207665_11550338 Ga0207665_115503381 87
107 3300026035 Ga0207703_10000332 Ga0207703_1000033222 87
108 3300026075 Ga0207708_10407125 Ga0207708_104071251 87
109 3300005336 Ga0070680_100565325 Ga0070680_1005653252 88
110 3300005345 Ga0070692_10614163 Ga0070692_106141632 88
111 3300005440 Ga0070705_101508995 Ga0070705_1015089952 88
112 3300005458 Ga0070681_11142422 Ga0070681_111424222 88
113 3300006844 Ga0075428_100245502 Ga0075428_1002455023 88
114 3300013100 Ga0157373_10851175 Ga0157373_108511751 88
115 3300025912 Ga0207707_11152120 Ga0207707_111521201 88
116 3300049522 Ga0501299_135946 Ga0501299_135946_61_327 88
117 3300049675 Ga0501243_090855 Ga0501243_090855_235_501 88
118 3300049822 Ga0501035_1572417 Ga0501035_1572417_98_373 88
119 3300060353 Ga0501082_0264956 Ga0501082_0264956_1195_1470 88
120 2162886007 SwRhRL2b_contig_386952 SwRhRL2b_0800.00004010 89
121 3300005289 Ga0065704_10092738 Ga0065704_100927382 89
122 3300005293 Ga0065715_10551200 Ga0065715_105512002 89
123 3300005295 Ga0065707_10104348 Ga0065707_101043483 89
124 3300005330 Ga0070690_100102996 Ga0070690_1001029962 89
125 3300005330 Ga0070690_100146845 Ga0070690_1001468452 89
126 3300005330 Ga0070690_100150526 Ga0070690_1001505262 89
127 3300005335 Ga0070666_10188122 Ga0070666_101881222 89
128 3300005336 Ga0070680_100756449 Ga0070680_1007564492 89
129 3300005338 Ga0068868_101277062 Ga0068868_1012770622 89
130 3300005343 Ga0070687_100004254 Ga0070687_1000042545 89
131 3300005345 Ga0070692_10024494 Ga0070692_100244944 89
132 3300005345 Ga0070692_10239931 Ga0070692_102399312 89
133 3300005364 Ga0070673_100135188 Ga0070673_1001351882 89
134 3300005438 Ga0070701_10703313 Ga0070701_107033131 89
135 3300005441 Ga0070700_100012266 Ga0070700_1000122665 89
136 3300005441 Ga0070700_101911471 Ga0070700_1019114711 89
137 3300005444 Ga0070694_100347685 Ga0070694_1003476851 89
138 3300005444 Ga0070694_100457397 Ga0070694_1004573972 89
139 3300005457 Ga0070662_100062884 Ga0070662_1000628845 89
140 3300005457 Ga0070662_100095106 Ga0070662_1000951062 89
141 3300005457 Ga0070662_100437828 Ga0070662_1004378282 89
142 3300005459 Ga0068867_100192551 Ga0068867_1001925512 89
143 3300005459 Ga0068867_100351197 Ga0068867_1003511972 89
144 3300005518 Ga0070699_100206487 Ga0070699_1002064872 89
145 3300005536 Ga0070697_100025046 Ga0070697_1000250462 89
146 3300005536 Ga0070697_100077179 Ga0070697_1000771793 89
147 3300005543 Ga0070672_100205902 Ga0070672_1002059022 89
148 3300005544 Ga0070686_100002652 Ga0070686_1000026526 89
149 3300005544 Ga0070686_100138999 Ga0070686_1001389992 89
150 3300005545 Ga0070695_100678172 Ga0070695_1006781722 89
151 3300005545 Ga0070695_101753278 Ga0070695_1017532782 89
152 3300005546 Ga0070696_100717375 Ga0070696_1007173752 89
153 3300005549 Ga0070704_100040395 Ga0070704_1000403952 89
154 3300005549 Ga0070704_100043798 Ga0070704_1000437984 89
155 3300005549 Ga0070704_100972927 Ga0070704_1009729272 89
156 3300005578 Ga0068854_100463824 Ga0068854_1004638242 89
157 3300005616 Ga0068852_101509782 Ga0068852_1015097822 89
158 3300005617 Ga0068859_100349165 Ga0068859_1003491652 89
159 3300005719 Ga0068861_100007557 Ga0068861_1000075574 89
160 3300005719 Ga0068861_100063974 Ga0068861_1000639743 89
161 3300005719 Ga0068861_101028986 Ga0068861_1010289862 89
162 3300005844 Ga0068862_100075069 Ga0068862_1000750693 89
163 3300005844 Ga0068862_100159952 Ga0068862_1001599523 89
164 3300005985 Ga0081539_10001941 Ga0081539_1000194122 89
165 3300006237 Ga0097621_101139422 Ga0097621_1011394221 89
166 3300006881 Ga0068865_100770762 Ga0068865_1007707622 89
167 3300006931 Ga0097620_100349210 Ga0097620_1003492102 89
168 3300009094 Ga0111539_10983175 Ga0111539_109831752 89
169 3300009094 Ga0111539_10987974 Ga0111539_109879742 89
170 3300009094 Ga0111539_11082454 Ga0111539_110824542 89
171 3300009098 Ga0105245_11761470 Ga0105245_117614702 89
172 3300009147 Ga0114129_10037123 Ga0114129_100371235 89
173 3300009147 Ga0114129_10393482 Ga0114129_103934821 89
174 3300009147 Ga0114129_10787143 Ga0114129_107871432 89
175 3300009147 Ga0114129_11058195 Ga0114129_110581952 89
176 3300009147 Ga0114129_13271919 Ga0114129_132719191 89
177 3300009176 Ga0105242_10053462 Ga0105242_100534623 89
178 3300009177 Ga0105248_11161197 Ga0105248_111611971 89
179 3300009177 Ga0105248_11808744 Ga0105248_118087441 89
180 3300009553 Ga0105249_10044881 Ga0105249_100448815 89
181 3300009553 Ga0105249_10296258 Ga0105249_102962582 89
182 3300010375 Ga0105239_10741894 Ga0105239_107418942 89
183 3300013297 Ga0157378_10137672 Ga0157378_101376722 89
184 3300013297 Ga0157378_10569577 Ga0157378_105695771 89
185 3300013306 Ga0163162_10753116 Ga0163162_107531162 89
186 3300013306 Ga0163162_11146466 Ga0163162_111464662 89
187 3300013308 Ga0157375_10244097 Ga0157375_102440972 89
188 3300014326 Ga0157380_10001205 Ga0157380_1000120516 89
189 3300014326 Ga0157380_10021417 Ga0157380_100214172 89
190 3300014326 Ga0157380_10080244 Ga0157380_100802442 89
191 3300014326 Ga0157380_11352495 Ga0157380_113524952 89
192 3300025910 Ga0207684_10049887 Ga0207684_100498872 89
193 3300025918 Ga0207662_10020084 Ga0207662_100200842 89
194 3300025918 Ga0207662_10888391 Ga0207662_108883911 89
195 3300025923 Ga0207681_10099505 Ga0207681_100995053 89
196 3300025923 Ga0207681_10282459 Ga0207681_102824591 89
197 3300025933 Ga0207706_10456512 Ga0207706_104565122 89
198 3300025938 Ga0207704_10664181 Ga0207704_106641812 89
199 3300025938 Ga0207704_11710058 Ga0207704_117100581 89
200 3300025940 Ga0207691_10660119 Ga0207691_106601192 89
201 3300025940 Ga0207691_10840984 Ga0207691_108409841 89
202 3300025941 Ga0207711_11701601 Ga0207711_117016011 89
203 3300025941 Ga0207711_11785247 Ga0207711_117852471 89
204 3300025960 Ga0207651_11538746 Ga0207651_115387461 89
205 3300025960 Ga0207651_11817513 Ga0207651_118175132 89
206 3300025961 Ga0207712_10117212 Ga0207712_101172123 89
207 3300025961 Ga0207712_10630360 Ga0207712_106303602 89
208 3300025981 Ga0207640_10092254 Ga0207640_100922542 89
209 3300026075 Ga0207708_10059901 Ga0207708_100599014 89
210 3300026075 Ga0207708_11642427 Ga0207708_116424271 89
211 3300026089 Ga0207648_10077324 Ga0207648_100773245 89
212 3300026089 Ga0207648_10084539 Ga0207648_100845393 89
213 3300026089 Ga0207648_10189395 Ga0207648_101893953 89
214 3300026118 Ga0207675_100033778 Ga0207675_1000337782 89
215 3300026118 Ga0207675_100904603 Ga0207675_1009046031 89
216 3300026142 Ga0207698_12417817 Ga0207698_124178171 89
217 3300028380 Ga0268265_10014733 Ga0268265_100147335 89
218 3300028380 Ga0268265_10746768 Ga0268265_107467681 89
219 3300032005 Ga0307411_10629388 Ga0307411_106293882 89
220 3300032126 Ga0307415_100219957 Ga0307415_1002199572 89
221 3300037418 Ga0395900_0850186 Ga0395900_0850186_91_360 89
222 3300037418 Ga0395900_1056953 Ga0395900_1056953_125_400 89
223 3300037466 Ga0395898_1029158 Ga0395898_1029158_103_378 89
224 3300037471 Ga0395905_0673629 Ga0395905_0673629_520_795 89
225 3300039437 Ga0436365_0648028 Ga0436365_0648028_2275_2565 89
226 3300039453 Ga0436362_0622047 Ga0436362_0622047_306_596 89
227 3300041999 Ga0439433_0037144 Ga0439433_0037144_337_645 89
228 3300050507 nmdc:mga05p37_1015138_c1 nmdc:mga05p37_1015138_c1_360_638 89
229 3300050507 nmdc:mga05p37_163177_c1 nmdc:mga05p37_163177_c1_1595_1879 89
230 3300050507 nmdc:mga05p37_22289_c1 nmdc:mga05p37_22289_c1_5044_5313 89
231 3300050507 nmdc:mga05p37_895945_c1 nmdc:mga05p37_895945_c1_49_324 89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dma-assembly3.cif.gz_F dhd15_closed 0.812 16 87
6dma-assembly3.cif.gz_F dhd15_closed 0.7811 16 87
1k4t-assembly1.cif.gz_A human dna topoisomerase i (70 kda) in complex with the poison topotecan and covalent complex with a 22 base pair dna duplex 0.7731 16 86
6yo0-assembly1.cif.gz_g1 cryo-em structure of tetrahymena thermophila mitochondrial atp synthase - f1/peripheral stalk 0.7704 14 87
5dac-assembly1.cif.gz_A atp-gamma-s bound rad50 from chaetomium thermophilum in complex with dna 0.7656 16 88
ID Description Score Start End Superfamily
af_Q9UTB2_49_154_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.793 16 88 1.10.287.40
af_A0A1D6PQL3_74_175_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.7919 16 85 1.10.287.40
af_Q9P1P4_46_332_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7867 23 72 1.20.1070.10
af_Q9VBR1_248_373_3.90.830.10 Alpha Beta;Alpha-Beta Complex;Syntaxin Binding Protein 1; Chain A, domain 2;Sec1/Munc18 (SM) protein, domain 3a 0.7729 23 85 3.90.830.10
1yg2A02 Special;Helix non-globular;Helix Hairpins; 0.744 16 88 6.10.140.190
ID Description Score Start End GO Terms
AF-A0A7W1HU56-F1-model_v4 Uncharacterized protein 0.8827 3 88
AF-A0A7T9JJM2-F1-model_v4 deleted 0.8775 8 88
AF-A0A7W1HU56-F1-model_v4 Uncharacterized protein 0.8444 3 88
AF-A0A3D0P564-F1-model_v4 Uncharacterized protein 0.8402 1 88
AF-A0A3D0P564-F1-model_v4 Uncharacterized protein 0.8224 1 88

Feature Viewer

pLDDT pTM Quality
84.45 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map