F343833
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 231 | 127 | 231 | 91 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100333438|Ga0070699_1003334382 |
| Length | 105 |
| Sequence | VLLTSPASRMIEKKPNKGEGNEQASELDQAELAHSIIESLLEHTRVVSDLIALMAQTLDQDTTKALTLTPQWQAYLESRRGMERTREDVEKFVDLIRKSGQEHPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 109 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 115 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 116 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 117 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 118 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 120 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 121 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 122 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_386952 | 2162886007 | Bacteria | 952 |
| 2 | JGI24034J14986_102323 | 3300001432 | Bacteria | 991 |
| 3 | JGI24748J21848_1000025 | 3300002074 | Bacteria | 102370 |
| 4 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 5 | JGI24742J22300_10017052 | 3300002244 | Unclassified | 1227 |
| 6 | Ga0065704_10092738 | 3300005289 | Bacteria | 2636 |
| 7 | Ga0065715_10038468 | 3300005293 | Unclassified | 1181 |
| 8 | Ga0065715_10099551 | 3300005293 | Unclassified | 3398 |
| 9 | Ga0065715_10551200 | 3300005293 | Bacteria | 736 |
| 10 | Ga0065707_10006743 | 3300005295 | Bacteria | 4286 |
| 11 | Ga0065707_10104348 | 3300005295 | Bacteria | 2700 |
| 12 | Ga0065707_10446247 | 3300005295 | Unclassified | 805 |
| 13 | Ga0070690_100102996 | 3300005330 | Unclassified | 1895 |
| 14 | Ga0070690_100146845 | 3300005330 | Bacteria | 1605 |
| 15 | Ga0070690_100150526 | 3300005330 | Bacteria | 1587 |
| 16 | Ga0070690_100405482 | 3300005330 | Bacteria | 1002 |
| 17 | Ga0070666_10188122 | 3300005335 | Bacteria | 1450 |
| 18 | Ga0070680_100565325 | 3300005336 | Bacteria | 975 |
| 19 | Ga0070680_100756449 | 3300005336 | Bacteria | 837 |
| 20 | Ga0068868_101277062 | 3300005338 | Bacteria | 681 |
| 21 | Ga0070687_100004254 | 3300005343 | Bacteria | 5690 |
| 22 | Ga0070687_100018612 | 3300005343 | Unclassified | 3217 |
| 23 | Ga0070692_10024494 | 3300005345 | Bacteria | 2967 |
| 24 | Ga0070692_10239931 | 3300005345 | Bacteria | 1080 |
| 25 | Ga0070692_10614163 | 3300005345 | Unclassified | 721 |
| 26 | Ga0070692_10785060 | 3300005345 | Unclassified | 649 |
| 27 | Ga0070669_100480138 | 3300005353 | Bacteria | 1028 |
| 28 | Ga0070671_100086331 | 3300005355 | Bacteria | 2625 |
| 29 | Ga0070674_100848250 | 3300005356 | Viruses | 792 |
| 30 | Ga0070673_100135188 | 3300005364 | Bacteria | 2074 |
| 31 | Ga0070688_100136535 | 3300005365 | Bacteria | 1661 |
| 32 | Ga0070667_100735086 | 3300005367 | Bacteria | 914 |
| 33 | Ga0070703_10060377 | 3300005406 | Bacteria | 1239 |
| 34 | Ga0070701_10703313 | 3300005438 | Bacteria | 680 |
| 35 | Ga0070705_100297621 | 3300005440 | Bacteria | 1155 |
| 36 | Ga0070705_100430351 | 3300005440 | Unclassified | 985 |
| 37 | Ga0070705_101508995 | 3300005440 | Unclassified | 563 |
| 38 | Ga0070700_100012266 | 3300005441 | Bacteria | 4776 |
| 39 | Ga0070700_100044750 | 3300005441 | Bacteria | 2728 |
| 40 | Ga0070700_101911471 | 3300005441 | Bacteria | 513 |
| 41 | Ga0070694_100347685 | 3300005444 | Bacteria | 1148 |
| 42 | Ga0070694_100457397 | 3300005444 | Bacteria | 1009 |
| 43 | Ga0070694_100575843 | 3300005444 | Bacteria | 904 |
| 44 | Ga0070694_100686321 | 3300005444 | Bacteria | 832 |
| 45 | Ga0070694_101482565 | 3300005444 | Bacteria | 574 |
| 46 | Ga0070708_100005702 | 3300005445 | Bacteria | 9875 |
| 47 | Ga0070708_100509362 | 3300005445 | Bacteria | 1135 |
| 48 | Ga0070708_101299847 | 3300005445 | Bacteria | 679 |
| 49 | Ga0070708_101585406 | 3300005445 | Bacteria | 609 |
| 50 | Ga0070662_100062884 | 3300005457 | Bacteria | 2713 |
| 51 | Ga0070662_100095106 | 3300005457 | Bacteria | 2245 |
| 52 | Ga0070662_100437828 | 3300005457 | Bacteria | 1083 |
| 53 | Ga0070681_11142422 | 3300005458 | Bacteria | 700 |
| 54 | Ga0068867_100192551 | 3300005459 | Bacteria | 1628 |
| 55 | Ga0068867_100351197 | 3300005459 | Bacteria | 1231 |
| 56 | Ga0070706_100006868 | 3300005467 | Bacteria | 10747 |
| 57 | Ga0070706_100008186 | 3300005467 | Bacteria | 9755 |
| 58 | Ga0070707_100005488 | 3300005468 | Bacteria | 11861 |
| 59 | Ga0070707_101879997 | 3300005468 | Unclassified | 566 |
| 60 | Ga0070698_100004943 | 3300005471 | Bacteria | 14614 |
| 61 | Ga0070698_100385023 | 3300005471 | Bacteria | 1335 |
| 62 | Ga0070699_100206487 | 3300005518 | Bacteria | 1748 |
| 63 | Ga0070699_100291181 | 3300005518 | Bacteria | 1464 |
| 64 | Ga0070699_100333438 | 3300005518 | Bacteria | 1365 |
| 65 | Ga0070699_101303187 | 3300005518 | Unclassified | 666 |
| 66 | Ga0070697_100025046 | 3300005536 | Bacteria | 4756 |
| 67 | Ga0070697_100077179 | 3300005536 | Bacteria | 2740 |
| 68 | Ga0070697_100162665 | 3300005536 | Unclassified | 1886 |
| 69 | Ga0070697_100280925 | 3300005536 | Bacteria | 1428 |
| 70 | Ga0070672_100205902 | 3300005543 | Bacteria | 1646 |
| 71 | Ga0070686_100002652 | 3300005544 | Bacteria | 9859 |
| 72 | Ga0070686_100134553 | 3300005544 | Bacteria | 1713 |
| 73 | Ga0070686_100138999 | 3300005544 | Bacteria | 1688 |
| 74 | Ga0070686_100536040 | 3300005544 | Bacteria | 914 |
| 75 | Ga0070695_100190229 | 3300005545 | Bacteria | 1460 |
| 76 | Ga0070695_100444679 | 3300005545 | Unclassified | 992 |
| 77 | Ga0070695_100678172 | 3300005545 | Bacteria | 816 |
| 78 | Ga0070695_101753278 | 3300005545 | Bacteria | 520 |
| 79 | Ga0070696_100717375 | 3300005546 | Unclassified | 816 |
| 80 | Ga0070704_100040395 | 3300005549 | Bacteria | 3211 |
| 81 | Ga0070704_100043798 | 3300005549 | Bacteria | 3105 |
| 82 | Ga0070704_100070707 | 3300005549 | Unclassified | 2533 |
| 83 | Ga0070704_100972927 | 3300005549 | Unclassified | 766 |
| 84 | Ga0068854_100463824 | 3300005578 | Bacteria | 1060 |
| 85 | Ga0070702_100185554 | 3300005615 | Bacteria | 1365 |
| 86 | Ga0068852_101509782 | 3300005616 | Unclassified | 694 |
| 87 | Ga0068859_100110843 | 3300005617 | Bacteria | 2806 |
| 88 | Ga0068859_100349165 | 3300005617 | Bacteria | 1574 |
| 89 | Ga0068864_100299698 | 3300005618 | Bacteria | 1505 |
| 90 | Ga0068861_100007557 | 3300005719 | Bacteria | 7457 |
| 91 | Ga0068861_100063974 | 3300005719 | Bacteria | 2829 |
| 92 | Ga0068861_101028986 | 3300005719 | Bacteria | 788 |
| 93 | Ga0068858_100000344 | 3300005842 | Bacteria | 49247 |
| 94 | Ga0068860_100060984 | 3300005843 | Bacteria | 3583 |
| 95 | Ga0068862_100075069 | 3300005844 | Bacteria | 2923 |
| 96 | Ga0068862_100159952 | 3300005844 | Bacteria | 2010 |
| 97 | Ga0081539_10001941 | 3300005985 | Bacteria | 31706 |
| 98 | Ga0070715_10000034 | 3300006163 | Bacteria | 80012 |
| 99 | Ga0070716_100120055 | 3300006173 | Bacteria | 1644 |
| 100 | Ga0070716_100400300 | 3300006173 | Bacteria | 987 |
| 101 | Ga0097621_101139422 | 3300006237 | Unclassified | 733 |
| 102 | Ga0075428_100245502 | 3300006844 | Bacteria | 1931 |
| 103 | Ga0075428_100515108 | 3300006844 | Bacteria | 1279 |
| 104 | Ga0075430_100554343 | 3300006846 | Unclassified | 948 |
| 105 | Ga0075431_101012519 | 3300006847 | Bacteria | 797 |
| 106 | Ga0075433_10579278 | 3300006852 | Bacteria | 986 |
| 107 | Ga0075433_10642907 | 3300006852 | Bacteria | 930 |
| 108 | Ga0075434_100503429 | 3300006871 | Bacteria | 1232 |
| 109 | Ga0075429_100024899 | 3300006880 | Bacteria | 5195 |
| 110 | Ga0068865_100770762 | 3300006881 | Bacteria | 828 |
| 111 | Ga0075436_100000009 | 3300006914 | Bacteria | 256132 |
| 112 | Ga0097620_100110843 | 3300006931 | Bacteria | 2806 |
| 113 | Ga0097620_100349210 | 3300006931 | Bacteria | 1574 |
| 114 | Ga0075435_100007383 | 3300007076 | Bacteria | 7828 |
| 115 | Ga0111539_10983175 | 3300009094 | Bacteria | 981 |
| 116 | Ga0111539_10987974 | 3300009094 | Bacteria | 979 |
| 117 | Ga0111539_11082454 | 3300009094 | Bacteria | 931 |
| 118 | Ga0105245_11761470 | 3300009098 | Bacteria | 672 |
| 119 | Ga0105247_10000002 | 3300009101 | Bacteria | 724587 |
| 120 | Ga0114129_10037123 | 3300009147 | Bacteria | 6879 |
| 121 | Ga0114129_10117451 | 3300009147 | Unclassified | 3665 |
| 122 | Ga0114129_10393482 | 3300009147 | Bacteria | 1827 |
| 123 | Ga0114129_10787143 | 3300009147 | Bacteria | 1214 |
| 124 | Ga0114129_11058195 | 3300009147 | Unclassified | 1018 |
| 125 | Ga0114129_13271919 | 3300009147 | Unclassified | 525 |
| 126 | Ga0105243_10172927 | 3300009148 | Bacteria | 1872 |
| 127 | Ga0105242_10053462 | 3300009176 | Bacteria | 3298 |
| 128 | Ga0105248_10137061 | 3300009177 | Bacteria | 2761 |
| 129 | Ga0105248_11161197 | 3300009177 | Unclassified | 873 |
| 130 | Ga0105248_11808744 | 3300009177 | Bacteria | 693 |
| 131 | Ga0105249_10044881 | 3300009553 | Bacteria | 4019 |
| 132 | Ga0105249_10296258 | 3300009553 | Bacteria | 1621 |
| 133 | Ga0105249_13040071 | 3300009553 | Unclassified | 539 |
| 134 | Ga0105239_10741894 | 3300010375 | Bacteria | 1124 |
| 135 | Ga0105246_10194003 | 3300011119 | Bacteria | 1574 |
| 136 | Ga0157373_10851175 | 3300013100 | Unclassified | 674 |
| 137 | Ga0157378_10137672 | 3300013297 | Bacteria | 2265 |
| 138 | Ga0157378_10569577 | 3300013297 | Bacteria | 1140 |
| 139 | Ga0157378_11925967 | 3300013297 | Bacteria | 640 |
| 140 | Ga0163162_10422040 | 3300013306 | Unclassified | 1466 |
| 141 | Ga0163162_10753116 | 3300013306 | Unclassified | 1093 |
| 142 | Ga0163162_11146466 | 3300013306 | Bacteria | 881 |
| 143 | Ga0157375_10244097 | 3300013308 | Bacteria | 1956 |
| 144 | Ga0157380_10001205 | 3300014326 | Bacteria | 16752 |
| 145 | Ga0157380_10021417 | 3300014326 | Bacteria | 4848 |
| 146 | Ga0157380_10080244 | 3300014326 | Bacteria | 2667 |
| 147 | Ga0157380_11352495 | 3300014326 | Bacteria | 761 |
| 148 | Ga0157379_10653404 | 3300014968 | Unclassified | 985 |
| 149 | Ga0163161_10712818 | 3300017792 | Unclassified | 836 |
| 150 | Ga0207672_1000007 | 3300025223 | Bacteria | 27099 |
| 151 | Ga0207653_10000145 | 3300025885 | Bacteria | 50672 |
| 152 | Ga0207653_10030004 | 3300025885 | Bacteria | 1753 |
| 153 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 154 | Ga0207685_10000006 | 3300025905 | Bacteria | 284255 |
| 155 | Ga0207684_10005358 | 3300025910 | Bacteria | 11850 |
| 156 | Ga0207684_10007548 | 3300025910 | Bacteria | 9780 |
| 157 | Ga0207684_10049887 | 3300025910 | Bacteria | 3550 |
| 158 | Ga0207707_11152120 | 3300025912 | Bacteria | 630 |
| 159 | Ga0207662_10020084 | 3300025918 | Bacteria | 3810 |
| 160 | Ga0207662_10022233 | 3300025918 | Bacteria | 3633 |
| 161 | Ga0207662_10265631 | 3300025918 | Unclassified | 1131 |
| 162 | Ga0207662_10888391 | 3300025918 | Unclassified | 631 |
| 163 | Ga0207646_10001700 | 3300025922 | Bacteria | 26758 |
| 164 | Ga0207646_10841188 | 3300025922 | Unclassified | 816 |
| 165 | Ga0207681_10099505 | 3300025923 | Bacteria | 2094 |
| 166 | Ga0207681_10282459 | 3300025923 | Bacteria | 1307 |
| 167 | Ga0207644_10000889 | 3300025931 | Bacteria | 18867 |
| 168 | Ga0207706_10456512 | 3300025933 | Bacteria | 1105 |
| 169 | Ga0207670_10621786 | 3300025936 | Unclassified | 888 |
| 170 | Ga0207704_10664181 | 3300025938 | Bacteria | 860 |
| 171 | Ga0207704_11710058 | 3300025938 | Bacteria | 541 |
| 172 | Ga0207704_11928658 | 3300025938 | Unclassified | 508 |
| 173 | Ga0207665_10164006 | 3300025939 | Bacteria | 1601 |
| 174 | Ga0207665_11550338 | 3300025939 | Unclassified | 526 |
| 175 | Ga0207691_10660119 | 3300025940 | Bacteria | 883 |
| 176 | Ga0207691_10840984 | 3300025940 | Bacteria | 770 |
| 177 | Ga0207711_10515981 | 3300025941 | Bacteria | 1114 |
| 178 | Ga0207711_11701601 | 3300025941 | Unclassified | 574 |
| 179 | Ga0207711_11785247 | 3300025941 | Unclassified | 558 |
| 180 | Ga0207689_11140389 | 3300025942 | Bacteria | 657 |
| 181 | Ga0207651_10653617 | 3300025960 | Unclassified | 923 |
| 182 | Ga0207651_11538746 | 3300025960 | Bacteria | 599 |
| 183 | Ga0207651_11817513 | 3300025960 | Bacteria | 548 |
| 184 | Ga0207712_10117212 | 3300025961 | Bacteria | 2008 |
| 185 | Ga0207712_10630360 | 3300025961 | Bacteria | 930 |
| 186 | Ga0207640_10092254 | 3300025981 | Bacteria | 2100 |
| 187 | Ga0207703_10000332 | 3300026035 | Bacteria | 51596 |
| 188 | Ga0207703_10358018 | 3300026035 | Unclassified | 1345 |
| 189 | Ga0207703_11391710 | 3300026035 | Unclassified | 675 |
| 190 | Ga0207708_10019188 | 3300026075 | Bacteria | 5150 |
| 191 | Ga0207708_10059901 | 3300026075 | Bacteria | 2906 |
| 192 | Ga0207708_10153369 | 3300026075 | Bacteria | 1816 |
| 193 | Ga0207708_10407125 | 3300026075 | Unclassified | 1126 |
| 194 | Ga0207708_11642427 | 3300026075 | Bacteria | 565 |
| 195 | Ga0207648_10077324 | 3300026089 | Bacteria | 2901 |
| 196 | Ga0207648_10084539 | 3300026089 | Bacteria | 2768 |
| 197 | Ga0207648_10189395 | 3300026089 | Bacteria | 1822 |
| 198 | Ga0207675_100033778 | 3300026118 | Bacteria | 4766 |
| 199 | Ga0207675_100904603 | 3300026118 | Bacteria | 899 |
| 200 | Ga0207698_12417817 | 3300026142 | Bacteria | 536 |
| 201 | Ga0207428_10078297 | 3300027907 | Unclassified | 2587 |
| 202 | Ga0268265_10014733 | 3300028380 | Bacteria | 5335 |
| 203 | Ga0268265_10746768 | 3300028380 | Bacteria | 949 |
| 204 | Ga0268265_11110976 | 3300028380 | Bacteria | 785 |
| 205 | Ga0268264_10093505 | 3300028381 | Bacteria | 2597 |
| 206 | Ga0307411_10629388 | 3300032005 | Bacteria | 926 |
| 207 | Ga0307415_100219957 | 3300032126 | Unclassified | 1522 |
| 208 | Ga0395900_0850186 | 3300037418 | Bacteria | 838 |
| 209 | Ga0395900_1056953 | 3300037418 | Unclassified | 730 |
| 210 | Ga0395898_1029158 | 3300037466 | Unclassified | 759 |
| 211 | Ga0395905_0673629 | 3300037471 | Unclassified | 937 |
| 212 | Ga0436365_0648028 | 3300039437 | Bacteria | 7366 |
| 213 | Ga0436362_0622047 | 3300039453 | Unclassified | 882 |
| 214 | Ga0439433_0037144 | 3300041999 | Bacteria | 1127 |
| 215 | Ga0501299_135946 | 3300049522 | Unclassified | 607 |
| 216 | Ga0501243_090855 | 3300049675 | Unclassified | 606 |
| 217 | Ga0501035_1572417 | 3300049822 | Unclassified | 500 |
| 218 | nmdc:mga05p37_1015138_c1 | 3300050507 | Bacteria | 879 |
| 219 | nmdc:mga05p37_163177_c1 | 3300050507 | Bacteria | 2720 |
| 220 | nmdc:mga05p37_22289_c1 | 3300050507 | Bacteria | 7681 |
| 221 | nmdc:mga05p37_292645_c1 | 3300050507 | Bacteria | 1938 |
| 222 | nmdc:mga05p37_64213_c1 | 3300050507 | Unclassified | 4517 |
| 223 | nmdc:mga05p37_895945_c1 | 3300050507 | Unclassified | 957 |
| 224 | nmdc:mga09592_79395_c1 | 3300050508 | Unclassified | 2793 |
| 225 | nmdc:mga0qj67_681707_c1 | 3300050509 | Unclassified | 818 |
| 226 | nmdc:mga06r32_929556_c1 | 3300050510 | Bacteria | 825 |
| 227 | nmdc:mga08y16_181305_c1 | 3300050511 | Bacteria | 2187 |
| 228 | nmdc:mga0rr50_520_c1 | 3300050513 | Bacteria | 20566 |
| 229 | nmdc:mga08x19_107_c1 | 3300050514 | Bacteria | 74172 |
| 230 | nmdc:mga0a205_593540_c1 | 3300050515 | Bacteria | 961 |
| 231 | Ga0501082_0264956 | 3300060353 | Bacteria | 1495 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005343 | Ga0070687_100018612 | Ga0070687_1000186124 | 78 |
| 2 | 3300005293 | Ga0065715_10099551 | Ga0065715_100995513 | 80 |
| 3 | 3300005295 | Ga0065707_10446247 | Ga0065707_104462471 | 80 |
| 4 | 3300005518 | Ga0070699_101303187 | Ga0070699_1013031872 | 81 |
| 5 | 3300005545 | Ga0070695_100444679 | Ga0070695_1004446791 | 82 |
| 6 | 3300006852 | Ga0075433_10642907 | Ga0075433_106429072 | 82 |
| 7 | 3300006914 | Ga0075436_100000009 | Ga0075436_10000000917 | 82 |
| 8 | 3300007076 | Ga0075435_100007383 | Ga0075435_1000073834 | 82 |
| 9 | 3300009147 | Ga0114129_10117451 | Ga0114129_101174513 | 82 |
| 10 | 3300050507 | nmdc:mga05p37_64213_c1 | nmdc:mga05p37_64213_c1_213_470 | 82 |
| 11 | 3300050513 | nmdc:mga0rr50_520_c1 | nmdc:mga0rr50_520_c1_13753_14019 | 82 |
| 12 | 3300050514 | nmdc:mga08x19_107_c1 | nmdc:mga08x19_107_c1_56791_57057 | 82 |
| 13 | 3300050515 | nmdc:mga0a205_593540_c1 | nmdc:mga0a205_593540_c1_659_916 | 82 |
| 14 | 3300005295 | Ga0065707_10006743 | Ga0065707_100067434 | 83 |
| 15 | 3300005345 | Ga0070692_10785060 | Ga0070692_107850601 | 83 |
| 16 | 3300005365 | Ga0070688_100136535 | Ga0070688_1001365354 | 83 |
| 17 | 3300005367 | Ga0070667_100735086 | Ga0070667_1007350862 | 83 |
| 18 | 3300005440 | Ga0070705_100297621 | Ga0070705_1002976212 | 83 |
| 19 | 3300005441 | Ga0070700_100044750 | Ga0070700_1000447502 | 83 |
| 20 | 3300005444 | Ga0070694_100686321 | Ga0070694_1006863212 | 83 |
| 21 | 3300005445 | Ga0070708_100005702 | Ga0070708_1000057023 | 83 |
| 22 | 3300005544 | Ga0070686_100134553 | Ga0070686_1001345532 | 83 |
| 23 | 3300005615 | Ga0070702_100185554 | Ga0070702_1001855542 | 83 |
| 24 | 3300005617 | Ga0068859_100110843 | Ga0068859_1001108433 | 83 |
| 25 | 3300005618 | Ga0068864_100299698 | Ga0068864_1002996983 | 83 |
| 26 | 3300005843 | Ga0068860_100060984 | Ga0068860_1000609841 | 83 |
| 27 | 3300006163 | Ga0070715_10000034 | Ga0070715_1000003412 | 83 |
| 28 | 3300006844 | Ga0075428_100515108 | Ga0075428_1005151082 | 83 |
| 29 | 3300006846 | Ga0075430_100554343 | Ga0075430_1005543433 | 83 |
| 30 | 3300006880 | Ga0075429_100024899 | Ga0075429_1000248991 | 83 |
| 31 | 3300006931 | Ga0097620_100110843 | Ga0097620_1001108433 | 83 |
| 32 | 3300009177 | Ga0105248_10137061 | Ga0105248_101370612 | 83 |
| 33 | 3300009553 | Ga0105249_13040071 | Ga0105249_130400711 | 83 |
| 34 | 3300011119 | Ga0105246_10194003 | Ga0105246_101940031 | 83 |
| 35 | 3300017792 | Ga0163161_10712818 | Ga0163161_107128182 | 83 |
| 36 | 3300025885 | Ga0207653_10000145 | Ga0207653_1000014544 | 83 |
| 37 | 3300025905 | Ga0207685_10000006 | Ga0207685_1000000622 | 83 |
| 38 | 3300025918 | Ga0207662_10265631 | Ga0207662_102656313 | 83 |
| 39 | 3300025936 | Ga0207670_10621786 | Ga0207670_106217862 | 83 |
| 40 | 3300025941 | Ga0207711_10515981 | Ga0207711_105159812 | 83 |
| 41 | 3300025942 | Ga0207689_11140389 | Ga0207689_111403891 | 83 |
| 42 | 3300025960 | Ga0207651_10653617 | Ga0207651_106536172 | 83 |
| 43 | 3300026035 | Ga0207703_10358018 | Ga0207703_103580182 | 83 |
| 44 | 3300026075 | Ga0207708_10019188 | Ga0207708_100191886 | 83 |
| 45 | 3300026075 | Ga0207708_10153369 | Ga0207708_101533694 | 83 |
| 46 | 3300027907 | Ga0207428_10078297 | Ga0207428_100782973 | 83 |
| 47 | 3300028380 | Ga0268265_11110976 | Ga0268265_111109763 | 83 |
| 48 | 3300028381 | Ga0268264_10093505 | Ga0268264_100935052 | 83 |
| 49 | 3300050509 | nmdc:mga0qj67_681707_c1 | nmdc:mga0qj67_681707_c1_249_512 | 83 |
| 50 | 3300050511 | nmdc:mga08y16_181305_c1 | nmdc:mga08y16_181305_c1_887_1150 | 83 |
| 51 | 3300005444 | Ga0070694_101482565 | Ga0070694_1014825652 | 85 |
| 52 | 3300005445 | Ga0070708_101585406 | Ga0070708_1015854061 | 85 |
| 53 | 3300005467 | Ga0070706_100008186 | Ga0070706_1000081862 | 85 |
| 54 | 3300005468 | Ga0070707_100005488 | Ga0070707_10000548810 | 85 |
| 55 | 3300005471 | Ga0070698_100385023 | Ga0070698_1003850232 | 85 |
| 56 | 3300005536 | Ga0070697_100162665 | Ga0070697_1001626652 | 85 |
| 57 | 3300005536 | Ga0070697_100280925 | Ga0070697_1002809252 | 85 |
| 58 | 3300005549 | Ga0070704_100070707 | Ga0070704_1000707072 | 85 |
| 59 | 3300006173 | Ga0070716_100120055 | Ga0070716_1001200552 | 85 |
| 60 | 3300006847 | Ga0075431_101012519 | Ga0075431_1010125192 | 85 |
| 61 | 3300006852 | Ga0075433_10579278 | Ga0075433_105792782 | 85 |
| 62 | 3300006871 | Ga0075434_100503429 | Ga0075434_1005034292 | 85 |
| 63 | 3300009148 | Ga0105243_10172927 | Ga0105243_101729272 | 85 |
| 64 | 3300013297 | Ga0157378_11925967 | Ga0157378_119259672 | 85 |
| 65 | 3300025910 | Ga0207684_10007548 | Ga0207684_1000754812 | 85 |
| 66 | 3300025922 | Ga0207646_10001700 | Ga0207646_1000170021 | 85 |
| 67 | 3300025922 | Ga0207646_10841188 | Ga0207646_108411882 | 85 |
| 68 | 3300025939 | Ga0207665_10164006 | Ga0207665_101640063 | 85 |
| 69 | 3300026035 | Ga0207703_11391710 | Ga0207703_113917102 | 85 |
| 70 | 3300050507 | nmdc:mga05p37_292645_c1 | nmdc:mga05p37_292645_c1_195_470 | 85 |
| 71 | 3300050508 | nmdc:mga09592_79395_c1 | nmdc:mga09592_79395_c1_2043_2321 | 85 |
| 72 | 3300050510 | nmdc:mga06r32_929556_c1 | nmdc:mga06r32_929556_c1_272_547 | 85 |
| 73 | 3300005444 | Ga0070694_100575843 | Ga0070694_1005758432 | 86 |
| 74 | 3300005545 | Ga0070695_100190229 | Ga0070695_1001902292 | 86 |
| 75 | 3300001432 | JGI24034J14986_102323 | JGI24034J14986_1023232 | 87 |
| 76 | 3300002074 | JGI24748J21848_1000025 | JGI24748J21848_100002545 | 87 |
| 77 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_10000001976 | 87 |
| 78 | 3300002244 | JGI24742J22300_10017052 | JGI24742J22300_100170522 | 87 |
| 79 | 3300005293 | Ga0065715_10038468 | Ga0065715_100384682 | 87 |
| 80 | 3300005330 | Ga0070690_100405482 | Ga0070690_1004054822 | 87 |
| 81 | 3300005353 | Ga0070669_100480138 | Ga0070669_1004801382 | 87 |
| 82 | 3300005355 | Ga0070671_100086331 | Ga0070671_1000863312 | 87 |
| 83 | 3300005356 | Ga0070674_100848250 | Ga0070674_1008482502 | 87 |
| 84 | 3300005406 | Ga0070703_10060377 | Ga0070703_100603772 | 87 |
| 85 | 3300005440 | Ga0070705_100430351 | Ga0070705_1004303511 | 87 |
| 86 | 3300005445 | Ga0070708_100509362 | Ga0070708_1005093622 | 87 |
| 87 | 3300005445 | Ga0070708_101299847 | Ga0070708_1012998471 | 87 |
| 88 | 3300005467 | Ga0070706_100006868 | Ga0070706_1000068687 | 87 |
| 89 | 3300005468 | Ga0070707_101879997 | Ga0070707_1018799971 | 87 |
| 90 | 3300005471 | Ga0070698_100004943 | Ga0070698_1000049433 | 87 |
| 91 | 3300005518 | Ga0070699_100291181 | Ga0070699_1002911811 | 87 |
| 92 | 3300005518 | Ga0070699_100333438 | Ga0070699_1003334382 | 87 |
| 93 | 3300005544 | Ga0070686_100536040 | Ga0070686_1005360403 | 87 |
| 94 | 3300005842 | Ga0068858_100000344 | Ga0068858_1000003444 | 87 |
| 95 | 3300006173 | Ga0070716_100400300 | Ga0070716_1004003002 | 87 |
| 96 | 3300009101 | Ga0105247_10000002 | Ga0105247_1000000243 | 87 |
| 97 | 3300013306 | Ga0163162_10422040 | Ga0163162_104220403 | 87 |
| 98 | 3300014968 | Ga0157379_10653404 | Ga0157379_106534042 | 87 |
| 99 | 3300025223 | Ga0207672_1000007 | Ga0207672_100000711 | 87 |
| 100 | 3300025885 | Ga0207653_10030004 | Ga0207653_100300042 | 87 |
| 101 | 3300025900 | Ga0207710_10000002 | Ga0207710_1000000244 | 87 |
| 102 | 3300025910 | Ga0207684_10005358 | Ga0207684_1000535810 | 87 |
| 103 | 3300025918 | Ga0207662_10022233 | Ga0207662_100222334 | 87 |
| 104 | 3300025931 | Ga0207644_10000889 | Ga0207644_100008897 | 87 |
| 105 | 3300025938 | Ga0207704_11928658 | Ga0207704_119286581 | 87 |
| 106 | 3300025939 | Ga0207665_11550338 | Ga0207665_115503381 | 87 |
| 107 | 3300026035 | Ga0207703_10000332 | Ga0207703_1000033222 | 87 |
| 108 | 3300026075 | Ga0207708_10407125 | Ga0207708_104071251 | 87 |
| 109 | 3300005336 | Ga0070680_100565325 | Ga0070680_1005653252 | 88 |
| 110 | 3300005345 | Ga0070692_10614163 | Ga0070692_106141632 | 88 |
| 111 | 3300005440 | Ga0070705_101508995 | Ga0070705_1015089952 | 88 |
| 112 | 3300005458 | Ga0070681_11142422 | Ga0070681_111424222 | 88 |
| 113 | 3300006844 | Ga0075428_100245502 | Ga0075428_1002455023 | 88 |
| 114 | 3300013100 | Ga0157373_10851175 | Ga0157373_108511751 | 88 |
| 115 | 3300025912 | Ga0207707_11152120 | Ga0207707_111521201 | 88 |
| 116 | 3300049522 | Ga0501299_135946 | Ga0501299_135946_61_327 | 88 |
| 117 | 3300049675 | Ga0501243_090855 | Ga0501243_090855_235_501 | 88 |
| 118 | 3300049822 | Ga0501035_1572417 | Ga0501035_1572417_98_373 | 88 |
| 119 | 3300060353 | Ga0501082_0264956 | Ga0501082_0264956_1195_1470 | 88 |
| 120 | 2162886007 | SwRhRL2b_contig_386952 | SwRhRL2b_0800.00004010 | 89 |
| 121 | 3300005289 | Ga0065704_10092738 | Ga0065704_100927382 | 89 |
| 122 | 3300005293 | Ga0065715_10551200 | Ga0065715_105512002 | 89 |
| 123 | 3300005295 | Ga0065707_10104348 | Ga0065707_101043483 | 89 |
| 124 | 3300005330 | Ga0070690_100102996 | Ga0070690_1001029962 | 89 |
| 125 | 3300005330 | Ga0070690_100146845 | Ga0070690_1001468452 | 89 |
| 126 | 3300005330 | Ga0070690_100150526 | Ga0070690_1001505262 | 89 |
| 127 | 3300005335 | Ga0070666_10188122 | Ga0070666_101881222 | 89 |
| 128 | 3300005336 | Ga0070680_100756449 | Ga0070680_1007564492 | 89 |
| 129 | 3300005338 | Ga0068868_101277062 | Ga0068868_1012770622 | 89 |
| 130 | 3300005343 | Ga0070687_100004254 | Ga0070687_1000042545 | 89 |
| 131 | 3300005345 | Ga0070692_10024494 | Ga0070692_100244944 | 89 |
| 132 | 3300005345 | Ga0070692_10239931 | Ga0070692_102399312 | 89 |
| 133 | 3300005364 | Ga0070673_100135188 | Ga0070673_1001351882 | 89 |
| 134 | 3300005438 | Ga0070701_10703313 | Ga0070701_107033131 | 89 |
| 135 | 3300005441 | Ga0070700_100012266 | Ga0070700_1000122665 | 89 |
| 136 | 3300005441 | Ga0070700_101911471 | Ga0070700_1019114711 | 89 |
| 137 | 3300005444 | Ga0070694_100347685 | Ga0070694_1003476851 | 89 |
| 138 | 3300005444 | Ga0070694_100457397 | Ga0070694_1004573972 | 89 |
| 139 | 3300005457 | Ga0070662_100062884 | Ga0070662_1000628845 | 89 |
| 140 | 3300005457 | Ga0070662_100095106 | Ga0070662_1000951062 | 89 |
| 141 | 3300005457 | Ga0070662_100437828 | Ga0070662_1004378282 | 89 |
| 142 | 3300005459 | Ga0068867_100192551 | Ga0068867_1001925512 | 89 |
| 143 | 3300005459 | Ga0068867_100351197 | Ga0068867_1003511972 | 89 |
| 144 | 3300005518 | Ga0070699_100206487 | Ga0070699_1002064872 | 89 |
| 145 | 3300005536 | Ga0070697_100025046 | Ga0070697_1000250462 | 89 |
| 146 | 3300005536 | Ga0070697_100077179 | Ga0070697_1000771793 | 89 |
| 147 | 3300005543 | Ga0070672_100205902 | Ga0070672_1002059022 | 89 |
| 148 | 3300005544 | Ga0070686_100002652 | Ga0070686_1000026526 | 89 |
| 149 | 3300005544 | Ga0070686_100138999 | Ga0070686_1001389992 | 89 |
| 150 | 3300005545 | Ga0070695_100678172 | Ga0070695_1006781722 | 89 |
| 151 | 3300005545 | Ga0070695_101753278 | Ga0070695_1017532782 | 89 |
| 152 | 3300005546 | Ga0070696_100717375 | Ga0070696_1007173752 | 89 |
| 153 | 3300005549 | Ga0070704_100040395 | Ga0070704_1000403952 | 89 |
| 154 | 3300005549 | Ga0070704_100043798 | Ga0070704_1000437984 | 89 |
| 155 | 3300005549 | Ga0070704_100972927 | Ga0070704_1009729272 | 89 |
| 156 | 3300005578 | Ga0068854_100463824 | Ga0068854_1004638242 | 89 |
| 157 | 3300005616 | Ga0068852_101509782 | Ga0068852_1015097822 | 89 |
| 158 | 3300005617 | Ga0068859_100349165 | Ga0068859_1003491652 | 89 |
| 159 | 3300005719 | Ga0068861_100007557 | Ga0068861_1000075574 | 89 |
| 160 | 3300005719 | Ga0068861_100063974 | Ga0068861_1000639743 | 89 |
| 161 | 3300005719 | Ga0068861_101028986 | Ga0068861_1010289862 | 89 |
| 162 | 3300005844 | Ga0068862_100075069 | Ga0068862_1000750693 | 89 |
| 163 | 3300005844 | Ga0068862_100159952 | Ga0068862_1001599523 | 89 |
| 164 | 3300005985 | Ga0081539_10001941 | Ga0081539_1000194122 | 89 |
| 165 | 3300006237 | Ga0097621_101139422 | Ga0097621_1011394221 | 89 |
| 166 | 3300006881 | Ga0068865_100770762 | Ga0068865_1007707622 | 89 |
| 167 | 3300006931 | Ga0097620_100349210 | Ga0097620_1003492102 | 89 |
| 168 | 3300009094 | Ga0111539_10983175 | Ga0111539_109831752 | 89 |
| 169 | 3300009094 | Ga0111539_10987974 | Ga0111539_109879742 | 89 |
| 170 | 3300009094 | Ga0111539_11082454 | Ga0111539_110824542 | 89 |
| 171 | 3300009098 | Ga0105245_11761470 | Ga0105245_117614702 | 89 |
| 172 | 3300009147 | Ga0114129_10037123 | Ga0114129_100371235 | 89 |
| 173 | 3300009147 | Ga0114129_10393482 | Ga0114129_103934821 | 89 |
| 174 | 3300009147 | Ga0114129_10787143 | Ga0114129_107871432 | 89 |
| 175 | 3300009147 | Ga0114129_11058195 | Ga0114129_110581952 | 89 |
| 176 | 3300009147 | Ga0114129_13271919 | Ga0114129_132719191 | 89 |
| 177 | 3300009176 | Ga0105242_10053462 | Ga0105242_100534623 | 89 |
| 178 | 3300009177 | Ga0105248_11161197 | Ga0105248_111611971 | 89 |
| 179 | 3300009177 | Ga0105248_11808744 | Ga0105248_118087441 | 89 |
| 180 | 3300009553 | Ga0105249_10044881 | Ga0105249_100448815 | 89 |
| 181 | 3300009553 | Ga0105249_10296258 | Ga0105249_102962582 | 89 |
| 182 | 3300010375 | Ga0105239_10741894 | Ga0105239_107418942 | 89 |
| 183 | 3300013297 | Ga0157378_10137672 | Ga0157378_101376722 | 89 |
| 184 | 3300013297 | Ga0157378_10569577 | Ga0157378_105695771 | 89 |
| 185 | 3300013306 | Ga0163162_10753116 | Ga0163162_107531162 | 89 |
| 186 | 3300013306 | Ga0163162_11146466 | Ga0163162_111464662 | 89 |
| 187 | 3300013308 | Ga0157375_10244097 | Ga0157375_102440972 | 89 |
| 188 | 3300014326 | Ga0157380_10001205 | Ga0157380_1000120516 | 89 |
| 189 | 3300014326 | Ga0157380_10021417 | Ga0157380_100214172 | 89 |
| 190 | 3300014326 | Ga0157380_10080244 | Ga0157380_100802442 | 89 |
| 191 | 3300014326 | Ga0157380_11352495 | Ga0157380_113524952 | 89 |
| 192 | 3300025910 | Ga0207684_10049887 | Ga0207684_100498872 | 89 |
| 193 | 3300025918 | Ga0207662_10020084 | Ga0207662_100200842 | 89 |
| 194 | 3300025918 | Ga0207662_10888391 | Ga0207662_108883911 | 89 |
| 195 | 3300025923 | Ga0207681_10099505 | Ga0207681_100995053 | 89 |
| 196 | 3300025923 | Ga0207681_10282459 | Ga0207681_102824591 | 89 |
| 197 | 3300025933 | Ga0207706_10456512 | Ga0207706_104565122 | 89 |
| 198 | 3300025938 | Ga0207704_10664181 | Ga0207704_106641812 | 89 |
| 199 | 3300025938 | Ga0207704_11710058 | Ga0207704_117100581 | 89 |
| 200 | 3300025940 | Ga0207691_10660119 | Ga0207691_106601192 | 89 |
| 201 | 3300025940 | Ga0207691_10840984 | Ga0207691_108409841 | 89 |
| 202 | 3300025941 | Ga0207711_11701601 | Ga0207711_117016011 | 89 |
| 203 | 3300025941 | Ga0207711_11785247 | Ga0207711_117852471 | 89 |
| 204 | 3300025960 | Ga0207651_11538746 | Ga0207651_115387461 | 89 |
| 205 | 3300025960 | Ga0207651_11817513 | Ga0207651_118175132 | 89 |
| 206 | 3300025961 | Ga0207712_10117212 | Ga0207712_101172123 | 89 |
| 207 | 3300025961 | Ga0207712_10630360 | Ga0207712_106303602 | 89 |
| 208 | 3300025981 | Ga0207640_10092254 | Ga0207640_100922542 | 89 |
| 209 | 3300026075 | Ga0207708_10059901 | Ga0207708_100599014 | 89 |
| 210 | 3300026075 | Ga0207708_11642427 | Ga0207708_116424271 | 89 |
| 211 | 3300026089 | Ga0207648_10077324 | Ga0207648_100773245 | 89 |
| 212 | 3300026089 | Ga0207648_10084539 | Ga0207648_100845393 | 89 |
| 213 | 3300026089 | Ga0207648_10189395 | Ga0207648_101893953 | 89 |
| 214 | 3300026118 | Ga0207675_100033778 | Ga0207675_1000337782 | 89 |
| 215 | 3300026118 | Ga0207675_100904603 | Ga0207675_1009046031 | 89 |
| 216 | 3300026142 | Ga0207698_12417817 | Ga0207698_124178171 | 89 |
| 217 | 3300028380 | Ga0268265_10014733 | Ga0268265_100147335 | 89 |
| 218 | 3300028380 | Ga0268265_10746768 | Ga0268265_107467681 | 89 |
| 219 | 3300032005 | Ga0307411_10629388 | Ga0307411_106293882 | 89 |
| 220 | 3300032126 | Ga0307415_100219957 | Ga0307415_1002199572 | 89 |
| 221 | 3300037418 | Ga0395900_0850186 | Ga0395900_0850186_91_360 | 89 |
| 222 | 3300037418 | Ga0395900_1056953 | Ga0395900_1056953_125_400 | 89 |
| 223 | 3300037466 | Ga0395898_1029158 | Ga0395898_1029158_103_378 | 89 |
| 224 | 3300037471 | Ga0395905_0673629 | Ga0395905_0673629_520_795 | 89 |
| 225 | 3300039437 | Ga0436365_0648028 | Ga0436365_0648028_2275_2565 | 89 |
| 226 | 3300039453 | Ga0436362_0622047 | Ga0436362_0622047_306_596 | 89 |
| 227 | 3300041999 | Ga0439433_0037144 | Ga0439433_0037144_337_645 | 89 |
| 228 | 3300050507 | nmdc:mga05p37_1015138_c1 | nmdc:mga05p37_1015138_c1_360_638 | 89 |
| 229 | 3300050507 | nmdc:mga05p37_163177_c1 | nmdc:mga05p37_163177_c1_1595_1879 | 89 |
| 230 | 3300050507 | nmdc:mga05p37_22289_c1 | nmdc:mga05p37_22289_c1_5044_5313 | 89 |
| 231 | 3300050507 | nmdc:mga05p37_895945_c1 | nmdc:mga05p37_895945_c1_49_324 | 89 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dma-assembly3.cif.gz_F | dhd15_closed | 0.812 | 16 | 87 |
| 6dma-assembly3.cif.gz_F | dhd15_closed | 0.7811 | 16 | 87 |
| 1k4t-assembly1.cif.gz_A | human dna topoisomerase i (70 kda) in complex with the poison topotecan and covalent complex with a 22 base pair dna duplex | 0.7731 | 16 | 86 |
| 6yo0-assembly1.cif.gz_g1 | cryo-em structure of tetrahymena thermophila mitochondrial atp synthase - f1/peripheral stalk | 0.7704 | 14 | 87 |
| 5dac-assembly1.cif.gz_A | atp-gamma-s bound rad50 from chaetomium thermophilum in complex with dna | 0.7656 | 16 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9UTB2_49_154_1.10.287.40 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain | 0.793 | 16 | 88 | 1.10.287.40 |
| af_A0A1D6PQL3_74_175_1.10.287.40 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain | 0.7919 | 16 | 85 | 1.10.287.40 |
| af_Q9P1P4_46_332_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.7867 | 23 | 72 | 1.20.1070.10 |
| af_Q9VBR1_248_373_3.90.830.10 | Alpha Beta;Alpha-Beta Complex;Syntaxin Binding Protein 1; Chain A, domain 2;Sec1/Munc18 (SM) protein, domain 3a | 0.7729 | 23 | 85 | 3.90.830.10 |
| 1yg2A02 | Special;Helix non-globular;Helix Hairpins; | 0.744 | 16 | 88 | 6.10.140.190 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1HU56-F1-model_v4 | Uncharacterized protein | 0.8827 | 3 | 88 |
|
| AF-A0A7T9JJM2-F1-model_v4 | deleted | 0.8775 | 8 | 88 |
|
| AF-A0A7W1HU56-F1-model_v4 | Uncharacterized protein | 0.8444 | 3 | 88 |
|
| AF-A0A3D0P564-F1-model_v4 | Uncharacterized protein | 0.8402 | 1 | 88 |
|
| AF-A0A3D0P564-F1-model_v4 | Uncharacterized protein | 0.8224 | 1 | 88 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar