F343611

General Info

Members Datasets Scaffolds Average Seq Length
231 135 231 124

Family's Representative Sequence

Representative Sequence 3300001991|JGI24743J22301_10027398|JGI24743J22301_100273982
Length 127
Sequence MAKAMAKTKEKAHPYQEHIDALRKKQSEIIDAFKRDKQAVNTQSDDGIQDLADKAASAYSKELNFSLSDGERNLLVLIEEAFTRLDNGSYGTCTNCGATIGDKRLAAVPWTPFCIDCQELQEKGLLS

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.87
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 4.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10027398 3300001991 Bacteria 1112
2 Ga0065715_10147811 3300005293 Bacteria 1766
3 Ga0065715_10433350 3300005293 Bacteria 824
4 Ga0065707_10825474 3300005295 Unclassified 580
5 Ga0070658_10070689 3300005327 Bacteria 2858
6 Ga0070683_100000061 3300005329 Bacteria 80712
7 Ga0070683_100254497 3300005329 Bacteria 1670
8 Ga0070670_100000205 3300005331 Bacteria 54998
9 Ga0070670_101170697 3300005331 Bacteria 702
10 Ga0068869_100082344 3300005334 Bacteria 2405
11 Ga0068869_100195470 3300005334 Bacteria 1593
12 Ga0070680_101661169 3300005336 Bacteria 554
13 Ga0070682_100000007 3300005337 Bacteria 346590
14 Ga0070682_100064174 3300005337 Bacteria 2331
15 Ga0068868_100000050 3300005338 Bacteria 66644
16 Ga0068868_100000179 3300005338 Bacteria 42162
17 Ga0070689_100001060 3300005340 Bacteria 17251
18 Ga0070691_10325831 3300005341 Bacteria 846
19 Ga0070661_100366098 3300005344 Unclassified 1134
20 Ga0070692_10031710 3300005345 Bacteria 2651
21 Ga0070692_10487893 3300005345 Bacteria 796
22 Ga0070675_102218983 3300005354 Bacteria 506
23 Ga0070674_101171544 3300005356 Bacteria 681
24 Ga0070673_100690104 3300005364 Bacteria 937
25 Ga0070673_102035908 3300005364 Bacteria 545
26 Ga0070709_10304538 3300005434 Bacteria 1165
27 Ga0070714_100554877 3300005435 Unclassified 1100
28 Ga0070713_101570048 3300005436 Unclassified 639
29 Ga0070701_10001341 3300005438 Bacteria 9068
30 Ga0070711_100144925 3300005439 Bacteria 1785
31 Ga0070708_100042184 3300005445 Unclassified 4003
32 Ga0070708_100216233 3300005445 Bacteria 1796
33 Ga0070708_100421473 3300005445 Bacteria 1259
34 Ga0070681_10671413 3300005458 Bacteria 951
35 Ga0068867_100060638 3300005459 Bacteria 2807
36 Ga0068867_100639379 3300005459 Bacteria 932
37 Ga0070706_100007628 3300005467 Bacteria 10126
38 Ga0070706_100014555 3300005467 Bacteria 7267
39 Ga0070706_100099785 3300005467 Bacteria 2697
40 Ga0070706_100215588 3300005467 Unclassified 1792
41 Ga0070707_100016150 3300005468 Bacteria 7006
42 Ga0070707_100017016 3300005468 Bacteria 6827
43 Ga0070707_100542778 3300005468 Bacteria 1125
44 Ga0070698_100029530 3300005471 Bacteria 5692
45 Ga0070698_100554560 3300005471 Unclassified 1089
46 Ga0070699_100005363 3300005518 Bacteria 11243
47 Ga0070699_100054053 3300005518 Bacteria 3475
48 Ga0070699_100217144 3300005518 Unclassified 1703
49 Ga0070684_100001160 3300005535 Bacteria 18916
50 Ga0070697_100182369 3300005536 Bacteria 1779
51 Ga0070697_100242849 3300005536 Bacteria 1538
52 Ga0070697_100401703 3300005536 Bacteria 1189
53 Ga0070697_101135071 3300005536 Bacteria 696
54 Ga0068853_100140449 3300005539 Bacteria 2168
55 Ga0068853_100458517 3300005539 Bacteria 1199
56 Ga0068853_100465789 3300005539 Bacteria 1190
57 Ga0070672_100000044 3300005543 Bacteria 53544
58 Ga0070672_100556834 3300005543 Bacteria 996
59 Ga0070686_100222371 3300005544 Bacteria 1365
60 Ga0070686_100328070 3300005544 Bacteria 1143
61 Ga0070686_101482631 3300005544 Unclassified 571
62 Ga0070693_100019418 3300005547 Bacteria 3562
63 Ga0070704_100901804 3300005549 Unclassified 795
64 Ga0068857_100558778 3300005577 Bacteria 1079
65 Ga0068854_100001312 3300005578 Bacteria 14997
66 Ga0068854_100035648 3300005578 Unclassified 3483
67 Ga0068854_102146850 3300005578 Bacteria 516
68 Ga0070702_100018140 3300005615 Bacteria 3645
69 Ga0070702_100185893 3300005615 Bacteria 1364
70 Ga0070702_100527264 3300005615 Bacteria 872
71 Ga0068859_100575428 3300005617 Unclassified 1220
72 Ga0068864_100000028 3300005618 Bacteria 227840
73 Ga0068851_10071365 3300005834 Unclassified 1797
74 Ga0068863_100702502 3300005841 Bacteria 1005
75 Ga0068858_100001208 3300005842 Bacteria 26779
76 Ga0068858_101513361 3300005842 Unclassified 662
77 Ga0068858_102082273 3300005842 Bacteria 561
78 Ga0068860_100881895 3300005843 Bacteria 910
79 Ga0070717_10000088 3300006028 Bacteria 72135
80 Ga0070717_10460985 3300006028 Bacteria 1146
81 Ga0070716_100299529 3300006173 Bacteria 1118
82 Ga0097621_100450426 3300006237 Bacteria 1159
83 Ga0097621_102033350 3300006237 Bacteria 549
84 Ga0068871_100662461 3300006358 Bacteria 954
85 Ga0075428_100014081 3300006844 Bacteria 8899
86 Ga0075431_100305149 3300006847 Bacteria 1608
87 Ga0075434_100186933 3300006871 Unclassified 2092
88 Ga0075434_100290789 3300006871 Unclassified 1654
89 Ga0075434_100881361 3300006871 Bacteria 910
90 Ga0068865_100044100 3300006881 Bacteria 3051
91 Ga0075436_100744210 3300006914 Bacteria 728
92 Ga0097620_100575465 3300006931 Unclassified 1220
93 Ga0075435_100013147 3300007076 Bacteria 6150
94 Ga0075435_100027867 3300007076 Bacteria 4424
95 Ga0105240_10036780 3300009093 Bacteria 6294
96 Ga0105245_10000035 3300009098 Bacteria 147165
97 Ga0105245_10001085 3300009098 Bacteria 24657
98 Ga0105245_10004147 3300009098 Bacteria 12873
99 Ga0105245_10189126 3300009098 Archaea 1971
100 Ga0105245_11266698 3300009098 Bacteria 786
101 Ga0105245_12539934 3300009098 Unclassified 566
102 Ga0114129_10303536 3300009147 Bacteria 2127
103 Ga0114129_10555293 3300009147 Unclassified 1493
104 Ga0114129_10565844 3300009147 Bacteria 1476
105 Ga0114129_10589297 3300009147 Unclassified 1442
106 Ga0114129_10706540 3300009147 Bacteria 1295
107 Ga0105241_10517168 3300009174 Bacteria 1067
108 Ga0105242_10239814 3300009176 Bacteria 1629
109 Ga0105242_10724480 3300009176 Unclassified 976
110 Ga0105248_10945229 3300009177 Unclassified 973
111 Ga0105238_10000008 3300009551 Bacteria 307196
112 Ga0105238_11244621 3300009551 Unclassified 769
113 Ga0105239_10262811 3300010375 Unclassified 1940
114 Ga0105246_10387463 3300011119 Bacteria 1157
115 Ga0105246_11079049 3300011119 Unclassified 732
116 Ga0157371_10923043 3300013102 Bacteria 663
117 Ga0157369_10000317 3300013105 Bacteria 64962
118 Ga0157369_10278238 3300013105 Bacteria 1743
119 Ga0157374_10000072 3300013296 Bacteria 102276
120 Ga0157378_10000281 3300013297 Bacteria 49560
121 Ga0157378_10010204 3300013297 Bacteria 8196
122 Ga0157378_10031483 3300013297 Bacteria 4684
123 Ga0157378_10427390 3300013297 Bacteria 1310
124 Ga0157378_11544158 3300013297 Bacteria 709
125 Ga0163162_10001652 3300013306 Bacteria 20901
126 Ga0157372_10408992 3300013307 Bacteria 1581
127 Ga0157375_10000003 3300013308 Bacteria 476325
128 Ga0157375_10000010 3300013308 Bacteria 361011
129 Ga0157375_10001496 3300013308 Bacteria 20070
130 Ga0163163_10304343 3300014325 Bacteria 1647
131 Ga0157380_10005793 3300014326 Bacteria 8649
132 Ga0157380_11890176 3300014326 Bacteria 657
133 Ga0157377_10000011 3300014745 Bacteria 305350
134 Ga0157377_10692475 3300014745 Bacteria 739
135 Ga0157376_10000002 3300014969 Bacteria 684532
136 Ga0213873_10000001 3300021358 Bacteria 1657979
137 Ga0213876_10000002 3300021384 Bacteria 1168769
138 Ga0213876_10000439 3300021384 Bacteria 33868
139 Ga0213875_10113490 3300021388 Bacteria 1266
140 Ga0207656_10170059 3300025321 Unclassified 1041
141 Ga0207643_10004901 3300025908 Bacteria 7164
142 Ga0207643_10031247 3300025908 Bacteria 2967
143 Ga0207705_10028662 3300025909 Bacteria 3969
144 Ga0207684_10055234 3300025910 Bacteria 3369
145 Ga0207684_10099941 3300025910 Bacteria 2478
146 Ga0207684_10123307 3300025910 Bacteria 2222
147 Ga0207684_10429257 3300025910 Bacteria 1135
148 Ga0207684_10855565 3300025910 Bacteria 766
149 Ga0207707_11639262 3300025912 Unclassified 505
150 Ga0207695_10010656 3300025913 Bacteria 11232
151 Ga0207660_11061432 3300025917 Bacteria 660
152 Ga0207662_10163299 3300025918 Bacteria 1424
153 Ga0207649_10322858 3300025920 Unclassified 1135
154 Ga0207646_10007567 3300025922 Bacteria 11006
155 Ga0207646_10371421 3300025922 Bacteria 1292
156 Ga0207646_11447811 3300025922 Bacteria 596
157 Ga0207694_10000001 3300025924 Bacteria 4078485
158 Ga0207650_10000251 3300025925 Bacteria 58147
159 Ga0207650_10051710 3300025925 Bacteria 3041
160 Ga0207650_10439030 3300025925 Bacteria 1085
161 Ga0207650_10570922 3300025925 Bacteria 949
162 Ga0207687_10000009 3300025927 Bacteria 443946
163 Ga0207687_10000581 3300025927 Bacteria 24670
164 Ga0207687_10006956 3300025927 Bacteria 7452
165 Ga0207664_10158433 3300025929 Unclassified 1929
166 Ga0207644_10088641 3300025931 Bacteria 2302
167 Ga0207644_10372857 3300025931 Unclassified 1163
168 Ga0207686_11831691 3300025934 Unclassified 502
169 Ga0207709_10572044 3300025935 Bacteria 891
170 Ga0207670_10007968 3300025936 Bacteria 5951
171 Ga0207670_10152554 3300025936 Bacteria 1716
172 Ga0207704_10072963 3300025938 Bacteria 2184
173 Ga0207665_10285512 3300025939 Bacteria 1229
174 Ga0207665_10430032 3300025939 Unclassified 1010
175 Ga0207691_10000344 3300025940 Bacteria 46784
176 Ga0207711_10933939 3300025941 Bacteria 806
177 Ga0207689_10122993 3300025942 Bacteria 2134
178 Ga0207689_10175278 3300025942 Bacteria 1768
179 Ga0207661_10000002 3300025944 Bacteria 816104
180 Ga0207661_10264274 3300025944 Bacteria 1534
181 Ga0207661_11237922 3300025944 Unclassified 686
182 Ga0207651_10473976 3300025960 Unclassified 1078
183 Ga0207640_10091404 3300025981 Bacteria 2108
184 Ga0207640_11804056 3300025981 Bacteria 553
185 Ga0207677_10000001 3300026023 Bacteria 534789
186 Ga0207677_10000243 3300026023 Bacteria 42167
187 Ga0207703_10000069 3300026035 Bacteria 124592
188 Ga0207703_10604084 3300026035 Unclassified 1038
189 Ga0207639_10000005 3300026041 Bacteria 579948
190 Ga0207639_10099544 3300026041 Bacteria 2346
191 Ga0207648_10118777 3300026089 Bacteria 2324
192 Ga0207648_10721717 3300026089 Bacteria 924
193 Ga0207676_10000002 3300026095 Bacteria 1198607
194 Ga0207674_10024365 3300026116 Bacteria 6469
195 Ga0207683_10889556 3300026121 Bacteria 827
196 Ga0307511_10002631 3300030521 Bacteria 18733
197 Ga0307407_10838446 3300031903 Unclassified 702
198 Ga0307409_102548776 3300031995 Unclassified 540
199 Ga0307416_100297937 3300032002 Bacteria 1601
200 Ga0307416_100805578 3300032002 Bacteria 1035
201 Ga0307416_101322275 3300032002 Bacteria 827
202 Ga0373941_0200819 3300035115 Unclassified 758
203 Ga0373941_0215444 3300035115 Unclassified 736
204 Ga0373943_0366176 3300035170 Bacteria 828
205 Ga0436364_0061423 3300037853 Bacteria 2717
206 Ga0436365_0084958 3300039437 Bacteria 74213
207 Ga0436365_0301508 3300039437 Bacteria 65589
208 Ga0436365_0783717 3300039437 Unclassified 646
209 Ga0436365_1624712 3300039437 Bacteria 7676
210 Ga0436363_0475440 3300039450 Bacteria 1062
211 Ga0436362_0953689 3300039453 Bacteria 9265
212 Ga0436362_0984254 3300039453 Bacteria 405590
213 Ga0451807_0524224 3300041486 Bacteria 615
214 Ga0451577_0028628 3300042876 Bacteria 5036
215 Ga0451577_0520032 3300042876 Unclassified 1080
216 Ga0453683_0637031 3300044673 Bacteria 696
217 Ga0453684_0102769 3300044712 Bacteria 3493
218 Ga0453684_1102528 3300044712 Unclassified 838
219 Ga0451576_1039655 3300045051 Unclassified 858
220 Ga0496100_0656120 3300048903 Bacteria 817
221 Ga0501073_0096355 3300049589 Bacteria 2054
222 Ga0501080_0040733 3300049742 Bacteria 4332
223 nmdc:mga05p37_414280_c1 3300050507 Unclassified 1570
224 nmdc:mga05p37_865833_c1 3300050507 Unclassified 979
225 nmdc:mga06r32_275026_c1 3300050510 Bacteria 1671
226 nmdc:mga0n895_510888_c1 3300050512 Unclassified 1210
227 nmdc:mga0n895_56729_c1 3300050512 Bacteria 3859
228 nmdc:mga0rr50_11193_c1 3300050513 Bacteria 5726
229 nmdc:mga0rr50_50864_c1 3300050513 Bacteria 3072
230 nmdc:mga08x19_1032087_c1 3300050514 Unclassified 584
231 nmdc:mga08x19_555550_c1 3300050514 Bacteria 812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_0524224 Ga0451807_0524224_36_350 104
2 3300025939 Ga0207665_10430032 Ga0207665_104300323 106
3 3300009147 Ga0114129_10565844 Ga0114129_105658443 111
4 3300013102 Ga0157371_10923043 Ga0157371_109230432 115
5 3300005329 Ga0070683_100254497 Ga0070683_1002544973 116
6 3300025944 Ga0207661_10264274 Ga0207661_102642743 116
7 3300031995 Ga0307409_102548776 Ga0307409_1025487762 122
8 3300032002 Ga0307416_100297937 Ga0307416_1002979372 122
9 3300042876 Ga0451577_0520032 Ga0451577_0520032_423_791 122
10 3300044712 Ga0453684_1102528 Ga0453684_1102528_32_400 122
11 3300005293 Ga0065715_10147811 Ga0065715_101478113 123
12 3300005293 Ga0065715_10433350 Ga0065715_104333502 123
13 3300005295 Ga0065707_10825474 Ga0065707_108254742 123
14 3300005331 Ga0070670_101170697 Ga0070670_1011706972 123
15 3300005337 Ga0070682_100000007 Ga0070682_10000000748 123
16 3300005338 Ga0068868_100000050 Ga0068868_10000005059 123
17 3300005340 Ga0070689_100001060 Ga0070689_10000106015 123
18 3300005341 Ga0070691_10325831 Ga0070691_103258312 123
19 3300005344 Ga0070661_100366098 Ga0070661_1003660982 123
20 3300005354 Ga0070675_102218983 Ga0070675_1022189831 123
21 3300005356 Ga0070674_101171544 Ga0070674_1011715441 123
22 3300005364 Ga0070673_100690104 Ga0070673_1006901042 123
23 3300005364 Ga0070673_102035908 Ga0070673_1020359081 123
24 3300005435 Ga0070714_100554877 Ga0070714_1005548772 123
25 3300005436 Ga0070713_101570048 Ga0070713_1015700482 123
26 3300005438 Ga0070701_10001341 Ga0070701_100013413 123
27 3300005445 Ga0070708_100042184 Ga0070708_1000421843 123
28 3300005445 Ga0070708_100216233 Ga0070708_1002162331 123
29 3300005445 Ga0070708_100421473 Ga0070708_1004214733 123
30 3300005459 Ga0068867_100060638 Ga0068867_1000606382 123
31 3300005459 Ga0068867_100639379 Ga0068867_1006393792 123
32 3300005467 Ga0070706_100007628 Ga0070706_1000076283 123
33 3300005467 Ga0070706_100014555 Ga0070706_1000145552 123
34 3300005467 Ga0070706_100099785 Ga0070706_1000997852 123
35 3300005467 Ga0070706_100215588 Ga0070706_1002155882 123
36 3300005468 Ga0070707_100016150 Ga0070707_1000161505 123
37 3300005468 Ga0070707_100017016 Ga0070707_1000170164 123
38 3300005468 Ga0070707_100542778 Ga0070707_1005427783 123
39 3300005471 Ga0070698_100029530 Ga0070698_1000295303 123
40 3300005471 Ga0070698_100554560 Ga0070698_1005545601 123
41 3300005518 Ga0070699_100005363 Ga0070699_1000053636 123
42 3300005518 Ga0070699_100054053 Ga0070699_1000540533 123
43 3300005518 Ga0070699_100217144 Ga0070699_1002171442 123
44 3300005536 Ga0070697_100182369 Ga0070697_1001823692 123
45 3300005536 Ga0070697_100242849 Ga0070697_1002428492 123
46 3300005536 Ga0070697_100401703 Ga0070697_1004017031 123
47 3300005536 Ga0070697_101135071 Ga0070697_1011350712 123
48 3300005539 Ga0068853_100465789 Ga0068853_1004657892 123
49 3300005543 Ga0070672_100000044 Ga0070672_10000004423 123
50 3300005544 Ga0070686_100328070 Ga0070686_1003280701 123
51 3300005549 Ga0070704_100901804 Ga0070704_1009018041 123
52 3300005577 Ga0068857_100558778 Ga0068857_1005587782 123
53 3300005578 Ga0068854_102146850 Ga0068854_1021468502 123
54 3300005615 Ga0070702_100018140 Ga0070702_1000181403 123
55 3300005615 Ga0070702_100527264 Ga0070702_1005272641 123
56 3300005617 Ga0068859_100575428 Ga0068859_1005754281 123
57 3300005618 Ga0068864_100000028 Ga0068864_100000028185 123
58 3300005834 Ga0068851_10071365 Ga0068851_100713653 123
59 3300005841 Ga0068863_100702502 Ga0068863_1007025023 123
60 3300005842 Ga0068858_100001208 Ga0068858_1000012088 123
61 3300005842 Ga0068858_101513361 Ga0068858_1015133612 123
62 3300005842 Ga0068858_102082273 Ga0068858_1020822731 123
63 3300005843 Ga0068860_100881895 Ga0068860_1008818952 123
64 3300006028 Ga0070717_10000088 Ga0070717_1000008840 123
65 3300006028 Ga0070717_10460985 Ga0070717_104609852 123
66 3300006173 Ga0070716_100299529 Ga0070716_1002995292 123
67 3300006844 Ga0075428_100014081 Ga0075428_1000140815 123
68 3300006847 Ga0075431_100305149 Ga0075431_1003051492 123
69 3300006871 Ga0075434_100186933 Ga0075434_1001869332 123
70 3300006871 Ga0075434_100290789 Ga0075434_1002907892 123
71 3300006881 Ga0068865_100044100 Ga0068865_1000441003 123
72 3300006914 Ga0075436_100744210 Ga0075436_1007442101 123
73 3300006931 Ga0097620_100575465 Ga0097620_1005754651 123
74 3300007076 Ga0075435_100013147 Ga0075435_1000131473 123
75 3300007076 Ga0075435_100027867 Ga0075435_1000278674 123
76 3300009098 Ga0105245_10001085 Ga0105245_1000108513 123
77 3300009098 Ga0105245_10004147 Ga0105245_1000414710 123
78 3300009098 Ga0105245_10189126 Ga0105245_101891262 123
79 3300009098 Ga0105245_11266698 Ga0105245_112666981 123
80 3300009147 Ga0114129_10303536 Ga0114129_103035361 123
81 3300009147 Ga0114129_10555293 Ga0114129_105552932 123
82 3300009147 Ga0114129_10589297 Ga0114129_105892972 123
83 3300009176 Ga0105242_10239814 Ga0105242_102398143 123
84 3300009176 Ga0105242_10724480 Ga0105242_107244801 123
85 3300010375 Ga0105239_10262811 Ga0105239_102628112 123
86 3300013297 Ga0157378_10031483 Ga0157378_100314832 123
87 3300013297 Ga0157378_10427390 Ga0157378_104273903 123
88 3300013297 Ga0157378_11544158 Ga0157378_115441582 123
89 3300013306 Ga0163162_10001652 Ga0163162_1000165210 123
90 3300013308 Ga0157375_10000003 Ga0157375_10000003410 123
91 3300014326 Ga0157380_10005793 Ga0157380_100057933 123
92 3300014745 Ga0157377_10692475 Ga0157377_106924751 123
93 3300021358 Ga0213873_10000001 Ga0213873_10000001928 123
94 3300021384 Ga0213876_10000002 Ga0213876_10000002614 123
95 3300025321 Ga0207656_10170059 Ga0207656_101700592 123
96 3300025908 Ga0207643_10031247 Ga0207643_100312472 123
97 3300025910 Ga0207684_10055234 Ga0207684_100552342 123
98 3300025910 Ga0207684_10099941 Ga0207684_100999412 123
99 3300025910 Ga0207684_10123307 Ga0207684_101233073 123
100 3300025910 Ga0207684_10429257 Ga0207684_104292571 123
101 3300025910 Ga0207684_10855565 Ga0207684_108555651 123
102 3300025918 Ga0207662_10163299 Ga0207662_101632992 123
103 3300025920 Ga0207649_10322858 Ga0207649_103228582 123
104 3300025922 Ga0207646_10007567 Ga0207646_100075674 123
105 3300025922 Ga0207646_10371421 Ga0207646_103714212 123
106 3300025922 Ga0207646_11447811 Ga0207646_114478111 123
107 3300025925 Ga0207650_10570922 Ga0207650_105709222 123
108 3300025927 Ga0207687_10000581 Ga0207687_1000058113 123
109 3300025927 Ga0207687_10006956 Ga0207687_1000695610 123
110 3300025929 Ga0207664_10158433 Ga0207664_101584332 123
111 3300025931 Ga0207644_10088641 Ga0207644_100886413 123
112 3300025931 Ga0207644_10372857 Ga0207644_103728572 123
113 3300025934 Ga0207686_11831691 Ga0207686_118316911 123
114 3300025936 Ga0207670_10007968 Ga0207670_100079685 123
115 3300025938 Ga0207704_10072963 Ga0207704_100729634 123
116 3300025940 Ga0207691_10000344 Ga0207691_1000034416 123
117 3300025981 Ga0207640_11804056 Ga0207640_118040562 123
118 3300026023 Ga0207677_10000001 Ga0207677_10000001470 123
119 3300026035 Ga0207703_10000069 Ga0207703_1000006963 123
120 3300026035 Ga0207703_10604084 Ga0207703_106040842 123
121 3300026089 Ga0207648_10118777 Ga0207648_101187774 123
122 3300026089 Ga0207648_10721717 Ga0207648_107217172 123
123 3300026095 Ga0207676_10000002 Ga0207676_1000000237 123
124 3300026116 Ga0207674_10024365 Ga0207674_100243652 123
125 3300031903 Ga0307407_10838446 Ga0307407_108384461 123
126 3300032002 Ga0307416_100805578 Ga0307416_1008055782 123
127 3300032002 Ga0307416_101322275 Ga0307416_1013222752 123
128 3300035115 Ga0373941_0215444 Ga0373941_0215444_205_576 123
129 3300035170 Ga0373943_0366176 Ga0373943_0366176_216_587 123
130 3300039437 Ga0436365_0301508 Ga0436365_0301508_50283_50654 123
131 3300039437 Ga0436365_0783717 Ga0436365_0783717_171_542 123
132 3300039437 Ga0436365_1624712 Ga0436365_1624712_3019_3390 123
133 3300039453 Ga0436362_0984254 Ga0436362_0984254_7358_7729 123
134 3300042876 Ga0451577_0028628 Ga0451577_0028628_951_1322 123
135 3300044673 Ga0453683_0637031 Ga0453683_0637031_72_443 123
136 3300044712 Ga0453684_0102769 Ga0453684_0102769_2062_2433 123
137 3300045051 Ga0451576_1039655 Ga0451576_1039655_417_788 123
138 3300048903 Ga0496100_0656120 Ga0496100_0656120_101_472 123
139 3300049589 Ga0501073_0096355 Ga0501073_0096355_1015_1386 123
140 3300049742 Ga0501080_0040733 Ga0501080_0040733_3520_3891 123
141 3300050507 nmdc:mga05p37_414280_c1 nmdc:mga05p37_414280_c1_1169_1540 123
142 3300050507 nmdc:mga05p37_865833_c1 nmdc:mga05p37_865833_c1_510_881 123
143 3300050510 nmdc:mga06r32_275026_c1 nmdc:mga06r32_275026_c1_887_1258 123
144 3300050512 nmdc:mga0n895_510888_c1 nmdc:mga0n895_510888_c1_567_938 123
145 3300050512 nmdc:mga0n895_56729_c1 nmdc:mga0n895_56729_c1_1184_1558 123
146 3300050513 nmdc:mga0rr50_11193_c1 nmdc:mga0rr50_11193_c1_4225_4596 123
147 3300050513 nmdc:mga0rr50_50864_c1 nmdc:mga0rr50_50864_c1_547_918 123
148 3300050514 nmdc:mga08x19_1032087_c1 nmdc:mga08x19_1032087_c1_92_463 123
149 3300050514 nmdc:mga08x19_555550_c1 nmdc:mga08x19_555550_c1_303_674 123
150 3300005334 Ga0068869_100195470 Ga0068869_1001954702 124
151 3300005434 Ga0070709_10304538 Ga0070709_103045383 124
152 3300005439 Ga0070711_100144925 Ga0070711_1001449252 124
153 3300005539 Ga0068853_100458517 Ga0068853_1004585173 124
154 3300005547 Ga0070693_100019418 Ga0070693_1000194181 124
155 3300005615 Ga0070702_100185893 Ga0070702_1001858931 124
156 3300006237 Ga0097621_102033350 Ga0097621_1020333502 124
157 3300006871 Ga0075434_100881361 Ga0075434_1008813612 124
158 3300009093 Ga0105240_10036780 Ga0105240_100367803 124
159 3300009147 Ga0114129_10706540 Ga0114129_107065403 124
160 3300009551 Ga0105238_11244621 Ga0105238_112446212 124
161 3300013105 Ga0157369_10278238 Ga0157369_102782382 124
162 3300014326 Ga0157380_11890176 Ga0157380_118901761 124
163 3300021388 Ga0213875_10113490 Ga0213875_101134902 124
164 3300025913 Ga0207695_10010656 Ga0207695_100106569 124
165 3300025925 Ga0207650_10439030 Ga0207650_104390302 124
166 3300025935 Ga0207709_10572044 Ga0207709_105720442 124
167 3300025942 Ga0207689_10122993 Ga0207689_101229932 124
168 3300025960 Ga0207651_10473976 Ga0207651_104739762 124
169 3300026041 Ga0207639_10000005 Ga0207639_10000005575 124
170 3300026121 Ga0207683_10889556 Ga0207683_108895561 124
171 3300035115 Ga0373941_0200819 Ga0373941_0200819_235_609 124
172 3300037853 Ga0436364_0061423 Ga0436364_0061423_537_911 124
173 3300005544 Ga0070686_100222371 Ga0070686_1002223712 125
174 3300025936 Ga0207670_10152554 Ga0207670_101525542 125
175 3300039450 Ga0436363_0475440 Ga0436363_0475440_651_1028 125
176 3300005327 Ga0070658_10070689 Ga0070658_100706892 126
177 3300005334 Ga0068869_100082344 Ga0068869_1000823443 126
178 3300005336 Ga0070680_101661169 Ga0070680_1016611691 126
179 3300005458 Ga0070681_10671413 Ga0070681_106714132 126
180 3300005539 Ga0068853_100140449 Ga0068853_1001404493 126
181 3300005543 Ga0070672_100556834 Ga0070672_1005568341 126
182 3300005544 Ga0070686_101482631 Ga0070686_1014826312 126
183 3300006358 Ga0068871_100662461 Ga0068871_1006624612 126
184 3300009098 Ga0105245_12539934 Ga0105245_125399341 126
185 3300009177 Ga0105248_10945229 Ga0105248_109452291 126
186 3300011119 Ga0105246_11079049 Ga0105246_110790491 126
187 3300013297 Ga0157378_10000281 Ga0157378_100002812 126
188 3300013297 Ga0157378_10010204 Ga0157378_100102042 126
189 3300013308 Ga0157375_10000010 Ga0157375_10000010168 126
190 3300025909 Ga0207705_10028662 Ga0207705_100286624 126
191 3300025912 Ga0207707_11639262 Ga0207707_116392621 126
192 3300025917 Ga0207660_11061432 Ga0207660_110614321 126
193 3300025939 Ga0207665_10285512 Ga0207665_102855123 126
194 3300025941 Ga0207711_10933939 Ga0207711_109339391 126
195 3300025942 Ga0207689_10175278 Ga0207689_101752782 126
196 3300026041 Ga0207639_10099544 Ga0207639_100995443 126
197 3300030521 Ga0307511_10002631 Ga0307511_1000263114 126
198 3300001991 JGI24743J22301_10027398 JGI24743J22301_100273982 127
199 3300005329 Ga0070683_100000061 Ga0070683_10000006156 127
200 3300005331 Ga0070670_100000205 Ga0070670_10000020512 127
201 3300005337 Ga0070682_100064174 Ga0070682_1000641742 127
202 3300005338 Ga0068868_100000179 Ga0068868_10000017913 127
203 3300005345 Ga0070692_10031710 Ga0070692_100317103 127
204 3300005345 Ga0070692_10487893 Ga0070692_104878932 127
205 3300005535 Ga0070684_100001160 Ga0070684_10000116013 127
206 3300005578 Ga0068854_100001312 Ga0068854_1000013129 127
207 3300005578 Ga0068854_100035648 Ga0068854_1000356483 127
208 3300006237 Ga0097621_100450426 Ga0097621_1004504262 127
209 3300009098 Ga0105245_10000035 Ga0105245_1000003517 127
210 3300009174 Ga0105241_10517168 Ga0105241_105171681 127
211 3300009551 Ga0105238_10000008 Ga0105238_10000008109 127
212 3300011119 Ga0105246_10387463 Ga0105246_103874632 127
213 3300013105 Ga0157369_10000317 Ga0157369_1000031712 127
214 3300013296 Ga0157374_10000072 Ga0157374_1000007286 127
215 3300013307 Ga0157372_10408992 Ga0157372_104089922 127
216 3300013308 Ga0157375_10001496 Ga0157375_100014962 127
217 3300014325 Ga0163163_10304343 Ga0163163_103043432 127
218 3300014745 Ga0157377_10000011 Ga0157377_10000011267 127
219 3300014969 Ga0157376_10000002 Ga0157376_10000002518 127
220 3300021384 Ga0213876_10000439 Ga0213876_100004396 127
221 3300025908 Ga0207643_10004901 Ga0207643_100049013 127
222 3300025924 Ga0207694_10000001 Ga0207694_100000013481 127
223 3300025925 Ga0207650_10000251 Ga0207650_1000025113 127
224 3300025925 Ga0207650_10051710 Ga0207650_100517103 127
225 3300025927 Ga0207687_10000009 Ga0207687_10000009276 127
226 3300025944 Ga0207661_10000002 Ga0207661_10000002726 127
227 3300025944 Ga0207661_11237922 Ga0207661_112379221 127
228 3300025981 Ga0207640_10091404 Ga0207640_100914042 127
229 3300026023 Ga0207677_10000243 Ga0207677_1000024320 127
230 3300039437 Ga0436365_0084958 Ga0436365_0084958_67374_67757 127
231 3300039453 Ga0436362_0953689 Ga0436362_0953689_3056_3439 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

88

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ijj-assembly1.cif.gz_A structure of transcription factor dksa2 from pseudomonas aeruginosa 0.7277 18 124
4ijj-assembly3.cif.gz_C structure of transcription factor dksa2 from pseudomonas aeruginosa 0.7167 13 124
6ptg-assembly3.cif.gz_B structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.6675 47 127
7khe-assembly1.cif.gz_M escherichia coli rna polymerase and rrnbp1 promoter pre-open complex with dksa/ppgpp 0.6651 17 127
6ptg-assembly2.cif.gz_A structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.6642 47 127
ID Description Score Start End Superfamily
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.7277 18 124 1.20.120.910
2kq9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.6346 8 119 1.20.120.910
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.617 18 124 1.20.120.910
2kq9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.6137 8 119 1.20.120.910
af_Q8WXH0_6238_6351_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.583 15 89 1.20.58.60
ID Description Score Start End GO Terms
AF-A0A6L4AXM4-F1-model_v4 TraR/DksA family transcriptional regulator 0.8994 17 126 GO:0008270
AF-A0A833HEE4-F1-model_v4 TraR/DksA family transcriptional regulator 0.8837 13 127 GO:0008270
AF-A0A6L4AXM4-F1-model_v4 TraR/DksA family transcriptional regulator 0.8229 17 126 GO:0008270
AF-A0A833HEE4-F1-model_v4 TraR/DksA family transcriptional regulator 0.7997 13 127 GO:0008270
AF-A0A2V7YNP2-F1-model_v4 RNA polymerase-binding protein DksA 0.7994 5 127 GO:0008270

Feature Viewer

pLDDT pTM Quality
82.88 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map