F343355

General Info

Members Datasets Scaffolds Average Seq Length
230 123 229 247

Family's Representative Sequence

Representative Sequence 3300046648|Ga0495611_0000280|Ga0495611_0000280_23836_24741
Length 282
Sequence MPIARWCCVNRPPPLRQPPAGSVAALNHYLCSMQIIPLSEGAFTIDKTKRFVPFDTEKDDLQQRPTGSLLVEIQPFAIITSDDILVIDTGLGYEKDGVLQIHRNLLDAGIDPGKVTKVLMSHLHKDHAGGISGDCADGAQPPASGLSFPNATYYVQRRELEYAFEKGPTSYIPEELGCLKNSSQVSFLDGDGIIDGYIKYEITGAHCPWHQVFWIVDGGETAFFGGDVAPQLQQMKSRFVAKYDYDGKKAMELRQQWWEKGQAEGWNFMFYHDVKTPLYSNR

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
74 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
75 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
76 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
77 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
78 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
81 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
103 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
109 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
112 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
113 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
114 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
115 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
116 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
117 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
118 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
119 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
120 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
121 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
122 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
123 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.13
Nodule 0
Rhizoplane 0.87
Rhizosphere 77.83
Stem 0
Stem Tuber 0
Unclassified 12.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10036764 3300003316 Bacteria 1041
2 rootH1_10151455 3300003316 Bacteria 1124
3 rootH2_10060361 3300003320 Bacteria 22290
4 rootH2_10061197 3300003320 Bacteria 21713
5 rootH2_10121801 3300003320 Bacteria 2286
6 rootL2_10173679 3300003322 Bacteria 2994
7 rootL2_10352461 3300003322 Bacteria 1302
8 rootH1_10000732 3300003323 Bacteria 17056
9 rootH1_10021511 3300003323 Unclassified 1823
10 rootH1_10234605 3300003323 Unclassified 1140
11 rootH1_10321629 3300003323 Bacteria 1390
12 Ga0070683_100003529 3300005329 Bacteria 12728
13 Ga0070677_10023330 3300005333 Bacteria 2290
14 Ga0070666_10003981 3300005335 Bacteria 8963
15 Ga0070666_10169207 3300005335 Bacteria 1530
16 Ga0070667_100143323 3300005367 Bacteria 2094
17 Ga0070700_100547747 3300005441 Unclassified 898
18 Ga0070681_10126994 3300005458 Bacteria 2483
19 Ga0068867_100005852 3300005459 Bacteria 8721
20 Ga0068867_100106214 3300005459 Bacteria 2151
21 Ga0070684_100005147 3300005535 Bacteria 9999
22 Ga0068853_100005832 3300005539 Bacteria 9700
23 Ga0068853_100014006 3300005539 Bacteria 6562
24 Ga0068853_100075505 3300005539 Bacteria 2941
25 Ga0068853_100187717 3300005539 Bacteria 1877
26 Ga0068853_100619420 3300005539 Bacteria 1029
27 Ga0070665_100000018 3300005548 Bacteria 434118
28 Ga0070665_100540782 3300005548 Bacteria 1177
29 Ga0068855_100000304 3300005563 Bacteria 61250
30 Ga0068855_100008198 3300005563 Bacteria 12629
31 Ga0068855_100105736 3300005563 Bacteria 3236
32 Ga0068857_100000270 3300005577 Bacteria 35248
33 Ga0068857_100017330 3300005577 Bacteria 6309
34 Ga0068854_100057821 3300005578 Bacteria 2798
35 Ga0068856_100017824 3300005614 Bacteria 6887
36 Ga0068856_100072018 3300005614 Bacteria 3422
37 Ga0068856_100337007 3300005614 Bacteria 1526
38 Ga0068852_100000506 3300005616 Bacteria 25661
39 Ga0068852_100022021 3300005616 Bacteria 5101
40 Ga0068852_100043460 3300005616 Bacteria 3812
41 Ga0068852_100190424 3300005616 Unclassified 1935
42 Ga0068864_100186495 3300005618 Bacteria 1899
43 Ga0068860_100000328 3300005843 Bacteria 64568
44 Ga0068860_100003551 3300005843 Bacteria 16040
45 Ga0068860_100004885 3300005843 Bacteria 13661
46 Ga0068860_100060026 3300005843 Bacteria 3615
47 Ga0081540_1029318 3300005983 Unclassified 3068
48 Ga0097621_100094101 3300006237 Bacteria 2512
49 Ga0097621_100187861 3300006237 Bacteria 1788
50 Ga0068871_100005175 3300006358 Bacteria 9117
51 Ga0105240_10001887 3300009093 Bacteria 34847
52 Ga0105240_10004214 3300009093 Bacteria 21995
53 Ga0105240_10015052 3300009093 Bacteria 10529
54 Ga0105240_10039571 3300009093 Bacteria 6037
55 Ga0105240_10039878 3300009093 Bacteria 6010
56 Ga0105240_10057714 3300009093 Bacteria 4847
57 Ga0105240_10116481 3300009093 Bacteria 3223
58 Ga0111539_10206677 3300009094 Bacteria 2288
59 Ga0114129_10004170 3300009147 Bacteria 20413
60 Ga0105241_10000460 3300009174 Bacteria 30681
61 Ga0105241_10011763 3300009174 Bacteria 6425
62 Ga0105241_10130189 3300009174 Bacteria 2036
63 Ga0105241_10554702 3300009174 Bacteria 1032
64 Ga0105241_10851759 3300009174 Unclassified 843
65 Ga0105237_10000191 3300009545 Bacteria 87065
66 Ga0105237_10003918 3300009545 Bacteria 17436
67 Ga0105237_10008644 3300009545 Bacteria 11004
68 Ga0105237_10017643 3300009545 Bacteria 7396
69 Ga0105237_10018778 3300009545 Bacteria 7150
70 Ga0105237_10028300 3300009545 Bacteria 5710
71 Ga0105237_10054841 3300009545 Bacteria 3993
72 Ga0105238_10000488 3300009551 Bacteria 41712
73 Ga0105238_10110392 3300009551 Bacteria 2731
74 Ga0105249_10301080 3300009553 Bacteria 1608
75 Ga0105239_10000468 3300010375 Bacteria 59019
76 Ga0105239_10004934 3300010375 Bacteria 15748
77 Ga0105239_10005764 3300010375 Bacteria 14448
78 Ga0105239_10006037 3300010375 Bacteria 14096
79 Ga0105239_10006519 3300010375 Bacteria 13526
80 Ga0105239_10039076 3300010375 Bacteria 5199
81 Ga0105239_10132933 3300010375 Bacteria 2769
82 Ga0105239_10136461 3300010375 Bacteria 2731
83 Ga0105239_10351308 3300010375 Bacteria 1665
84 Ga0157373_10022607 3300013100 Bacteria 4561
85 Ga0157370_10002445 3300013104 Bacteria 22405
86 Ga0157370_10123203 3300013104 Bacteria 2420
87 Ga0157369_10105707 3300013105 Bacteria 2996
88 Ga0157374_10000011 3300013296 Bacteria 466749
89 Ga0157374_10029755 3300013296 Bacteria 4952
90 Ga0157374_10084112 3300013296 Bacteria 3024
91 Ga0163162_10002532 3300013306 Bacteria 17288
92 Ga0163162_10007827 3300013306 Bacteria 10417
93 Ga0157372_10000656 3300013307 Bacteria 37971
94 Ga0157372_10019685 3300013307 Bacteria 7274
95 Ga0157372_10037250 3300013307 Bacteria 5363
96 Ga0157372_10615629 3300013307 Bacteria 1265
97 Ga0157375_10124979 3300013308 Bacteria 2686
98 Ga0157375_10390319 3300013308 Bacteria 1559
99 Ga0163163_10047951 3300014325 Bacteria 4199
100 Ga0163163_11305440 3300014325 Bacteria 788
101 Ga0157380_10004722 3300014326 Bacteria 9482
102 Ga0157376_10003138 3300014969 Bacteria 11352
103 Ga0209646_1001123 3300025246 Bacteria 7879
104 Ga0207680_10004318 3300025903 Bacteria 6738
105 Ga0207647_10027985 3300025904 Bacteria 3669
106 Ga0207647_10048661 3300025904 Bacteria 2632
107 Ga0207654_10000410 3300025911 Bacteria 24779
108 Ga0207695_10000248 3300025913 Bacteria 140288
109 Ga0207695_10000351 3300025913 Bacteria 105891
110 Ga0207695_10012543 3300025913 Bacteria 10160
111 Ga0207695_10013252 3300025913 Bacteria 9838
112 Ga0207695_10030135 3300025913 Bacteria 5977
113 Ga0207695_10033500 3300025913 Bacteria 5601
114 Ga0207671_10000950 3300025914 Bacteria 35986
115 Ga0207671_10001185 3300025914 Bacteria 30947
116 Ga0207671_10001741 3300025914 Bacteria 24461
117 Ga0207671_10007269 3300025914 Bacteria 9634
118 Ga0207671_10016637 3300025914 Bacteria 5710
119 Ga0207671_10027410 3300025914 Bacteria 4259
120 Ga0207694_10012253 3300025924 Bacteria 6462
121 Ga0207694_10155917 3300025924 Bacteria 1842
122 Ga0207694_10227115 3300025924 Bacteria 1524
123 Ga0207667_10001219 3300025949 Bacteria 32210
124 Ga0207667_10001760 3300025949 Bacteria 27253
125 Ga0207667_10009503 3300025949 Bacteria 11446
126 Ga0207667_10083333 3300025949 Bacteria 3311
127 Ga0207667_10109633 3300025949 Bacteria 2847
128 Ga0207639_10135880 3300026041 Bacteria 2042
129 Ga0207639_10155448 3300026041 Bacteria 1921
130 Ga0207639_10185818 3300026041 Bacteria 1772
131 Ga0207639_10596778 3300026041 Bacteria 1018
132 Ga0207702_10026038 3300026078 Bacteria 4856
133 Ga0207702_10336458 3300026078 Bacteria 1441
134 Ga0207648_10024041 3300026089 Bacteria 5446
135 Ga0207674_10002382 3300026116 Bacteria 23767
136 Ga0207674_10046601 3300026116 Bacteria 4450
137 Ga0207683_10515280 3300026121 Bacteria 1105
138 Ga0207698_10000340 3300026142 Bacteria 27673
139 Ga0207698_10067001 3300026142 Bacteria 2829
140 Ga0207698_10372417 3300026142 Bacteria 1356
141 Ga0268266_10000026 3300028379 Bacteria 434485
142 Ga0268264_10001824 3300028381 Bacteria 19489
143 Ga0268264_10004527 3300028381 Bacteria 11845
144 Ga0268264_10028287 3300028381 Bacteria 4584
145 Ga0268264_10038473 3300028381 Bacteria 3949
146 Ga0307517_10009664 3300028786 Bacteria 13641
147 Ga0307515_10318150 3300028794 Unclassified 1225
148 Ga0307511_10001204 3300030521 Bacteria 27440
149 Ga0265327_10002699 3300031251 Bacteria 18200
150 Ga0307513_10066003 3300031456 Bacteria 3805
151 Ga0307513_10123164 3300031456 Bacteria 2555
152 Ga0307513_10197284 3300031456 Bacteria 1858
153 Ga0307509_10063379 3300031507 Bacteria 3892
154 Ga0307509_10103411 3300031507 Bacteria 2876
155 Ga0307509_10292392 3300031507 Unclassified 1383
156 Ga0307508_10000606 3300031616 Bacteria 42966
157 Ga0307516_10001745 3300031730 Bacteria 29897
158 Ga0307414_10009749 3300032004 Bacteria 5534
159 Ga0307414_10161577 3300032004 Bacteria 1780
160 Ga0307414_10608899 3300032004 Unclassified 980
161 Ga0307411_10044512 3300032005 Bacteria 2848
162 Ga0307415_100228565 3300032126 Bacteria 1497
163 Ga0307507_10175148 3300033179 Bacteria 1548
164 Ga0436365_1374412 3300039437 Bacteria 2265
165 Ga0439436_0004608 3300041404 Bacteria 4226
166 Ga0439436_0075325 3300041404 Bacteria 940
167 Ga0451791_1032324 3300041451 Bacteria 1718
168 Ga0451802_1679066 3300041460 Bacteria 1146
169 Ga0451833_0941021 3300041491 Bacteria 1038
170 Ga0451849_0831424 3300041505 Bacteria 967
171 Ga0439448_0023215 3300042005 Bacteria 1933
172 Ga0439449_0018081 3300042007 Bacteria 2646
173 Ga0439457_000635 3300042014 Bacteria 10368
174 Ga0439462_0000977 3300042015 Bacteria 6095
175 Ga0451577_0089977 3300042876 Unclassified 2739
176 Ga0466969_0000172 3300044656 Bacteria 34716
177 Ga0466972_0000143 3300044658 Bacteria 58694
178 Ga0466972_0000591 3300044658 Bacteria 17623
179 Ga0466972_0004739 3300044658 Bacteria 6810
180 Ga0466966_0000038 3300044684 Bacteria 97255
181 Ga0466961_0022939 3300044693 Bacteria 4015
182 Ga0466971_0058105 3300044719 Bacteria 1746
183 Ga0466971_0072422 3300044719 Bacteria 1566
184 Ga0466968_0239752 3300044735 Bacteria 858
185 Ga0466970_0082764 3300044765 Bacteria 1736
186 Ga0466957_0005302 3300044842 Bacteria 7228
187 Ga0466960_0214419 3300044901 Bacteria 1057
188 Ga0466959_0000698 3300045049 Bacteria 19638
189 Ga0466959_0012536 3300045049 Bacteria 6129
190 Ga0495606_0004455 3300046507 Bacteria 13983
191 Ga0495648_0001596 3300046524 Bacteria 22083
192 Ga0495668_0000099 3300046616 Bacteria 137915
193 Ga0495668_0004679 3300046616 Bacteria 9605
194 Ga0495611_0000280 3300046648 Bacteria 34841
195 Ga0495625_0026123 3300046660 Bacteria 4416
196 Ga0495687_000058 3300047443 Bacteria 185830
197 Ga0495686_0000005 3300047472 Bacteria 827143
198 Ga0501034_0079979 3300049571 Bacteria 3272
199 Ga0501047_0013235 3300049581 Bacteria 7814
200 Ga0501047_0033924 3300049581 Bacteria 4927
201 Ga0501219_000177 3300049703 Bacteria 11733
202 Ga0501225_0002309 3300049705 Bacteria 5897
203 Ga0501080_0119330 3300049742 Bacteria 2445
204 Ga0501241_025455 3300049758 Bacteria 1102
205 Ga0501035_0269108 3300049822 Unclassified 1443
206 Ga0501044_0004908 3300049823 Bacteria 14948
207 Ga0501284_00051 3300050005 Bacteria 43498
208 nmdc:mga0k408_199831_c1 3300050493 Unclassified 1193
209 nmdc:mga0k408_35743_c1 3300050493 Bacteria 2849
210 nmdc:mga0k408_69867_c1 3300050493 Bacteria 2050
211 nmdc:mga05p37_4275_c1 3300050507 Bacteria 16686
212 Ga0500578_0000961 3300053086 Bacteria 31954
213 Ga0500578_0279625 3300053086 Bacteria 996
214 Ga0500581_156823 3300053089 Bacteria 1062
215 Ga0500583_0000111 3300053092 Bacteria 40256
216 Ga0500583_0000860 3300053092 Bacteria 8760
217 Ga0500583_0092078 3300053092 Bacteria 1476
218 Ga0500556_0052212 3300053104 Bacteria 1483
219 Ga0500642_0045459 3300053130 Bacteria 1916
220 Ga0500642_0050627 3300053130 Bacteria 1832
221 Ga0500658_0092684 3300053134 Bacteria 1309
222 Ga0500658_0105057 3300053134 Bacteria 1237
223 Ga0500559_0006375 3300053136 Bacteria 5328
224 Ga0500568_0004392 3300053139 Bacteria 7547
225 Ga0500588_0023548 3300053146 Unclassified 1689
226 Ga0500622_0001238 3300053156 Bacteria 20912
227 Ga0500636_0135186 3300053177 Bacteria 1370
228 Ga0500637_0048787 3300053178 Bacteria 2409
229 Ga0500611_000078 3300053727 Bacteria 36716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044735 Ga0466968_0239752 Ga0466968_0239752_16_645 205
2 3300013296 Ga0157374_10084112 Ga0157374_100841122 214
3 3300053134 Ga0500658_0092684 Ga0500658_0092684_207_920 233
4 3300003320 rootH2_10121801 rootH2_101218012 234
5 3300005983 Ga0081540_1029318 Ga0081540_10293181 236
6 3300053136 Ga0500559_0006375 Ga0500559_0006375_3200_4015 237
7 iso_pu_bacteria 2738541278 2738725892 237
8 3300005329 Ga0070683_100003529 Ga0070683_10000352910 239
9 3300005441 Ga0070700_100547747 Ga0070700_1005477471 239
10 3300005458 Ga0070681_10126994 Ga0070681_101269943 239
11 3300005535 Ga0070684_100005147 Ga0070684_1000051472 239
12 3300005539 Ga0068853_100187717 Ga0068853_1001877172 239
13 3300005563 Ga0068855_100000304 Ga0068855_10000030427 239
14 3300005616 Ga0068852_100022021 Ga0068852_1000220214 239
15 3300009093 Ga0105240_10001887 Ga0105240_1000188724 239
16 3300010375 Ga0105239_10039076 Ga0105239_100390763 239
17 3300013100 Ga0157373_10022607 Ga0157373_100226073 239
18 3300013104 Ga0157370_10123203 Ga0157370_101232033 239
19 3300013306 Ga0163162_10002532 Ga0163162_100025324 239
20 3300025913 Ga0207695_10000248 Ga0207695_1000024816 239
21 3300025949 Ga0207667_10001219 Ga0207667_1000121919 239
22 3300026041 Ga0207639_10185818 Ga0207639_101858182 239
23 3300026142 Ga0207698_10372417 Ga0207698_103724171 239
24 3300005616 Ga0068852_100190424 Ga0068852_1001904242 240
25 3300009094 Ga0111539_10206677 Ga0111539_102066772 240
26 3300013307 Ga0157372_10615629 Ga0157372_106156292 240
27 3300046507 Ga0495606_0004455 Ga0495606_0004455_9664_10431 240
28 3300003322 rootL2_10173679 rootL2_101736793 241
29 3300003323 rootH1_10000732 rootH1_100007329 241
30 3300005563 Ga0068855_100008198 Ga0068855_1000081983 241
31 3300005577 Ga0068857_100017330 Ga0068857_1000173303 241
32 3300005614 Ga0068856_100017824 Ga0068856_1000178246 241
33 3300005843 Ga0068860_100060026 Ga0068860_1000600262 241
34 3300006237 Ga0097621_100187861 Ga0097621_1001878613 241
35 3300009147 Ga0114129_10004170 Ga0114129_100041702 241
36 3300009174 Ga0105241_10011763 Ga0105241_100117637 241
37 3300009545 Ga0105237_10017643 Ga0105237_100176433 241
38 3300010375 Ga0105239_10005764 Ga0105239_1000576413 241
39 3300010375 Ga0105239_10006519 Ga0105239_100065193 241
40 3300013296 Ga0157374_10029755 Ga0157374_100297558 241
41 3300014325 Ga0163163_11305440 Ga0163163_113054401 241
42 3300025246 Ga0209646_1001123 Ga0209646_10011237 241
43 3300025949 Ga0207667_10009503 Ga0207667_100095038 241
44 3300026041 Ga0207639_10135880 Ga0207639_101358802 241
45 3300026078 Ga0207702_10026038 Ga0207702_100260383 241
46 3300026116 Ga0207674_10046601 Ga0207674_100466013 241
47 3300031456 Ga0307513_10123164 Ga0307513_101231642 241
48 3300031507 Ga0307509_10063379 Ga0307509_100633794 241
49 3300041404 Ga0439436_0004608 Ga0439436_0004608_2128_2865 241
50 3300041404 Ga0439436_0075325 Ga0439436_0075325_59_796 241
51 3300041451 Ga0451791_1032324 Ga0451791_1032324_94_831 241
52 3300041460 Ga0451802_1679066 Ga0451802_1679066_175_912 241
53 3300041505 Ga0451849_0831424 Ga0451849_0831424_188_925 241
54 3300042007 Ga0439449_0018081 Ga0439449_0018081_85_822 241
55 3300042014 Ga0439457_000635 Ga0439457_000635_8180_8917 241
56 3300042015 Ga0439462_0000977 Ga0439462_0000977_2131_2868 241
57 3300044656 Ga0466969_0000172 Ga0466969_0000172_29054_29791 241
58 3300044658 Ga0466972_0000143 Ga0466972_0000143_6060_6797 241
59 3300044658 Ga0466972_0004739 Ga0466972_0004739_2207_2944 241
60 3300044684 Ga0466966_0000038 Ga0466966_0000038_27562_28299 241
61 3300044719 Ga0466971_0072422 Ga0466971_0072422_635_1372 241
62 3300044765 Ga0466970_0082764 Ga0466970_0082764_490_1227 241
63 3300044842 Ga0466957_0005302 Ga0466957_0005302_1756_2493 241
64 3300045049 Ga0466959_0000698 Ga0466959_0000698_17429_18166 241
65 3300049581 Ga0501047_0013235 Ga0501047_0013235_2212_2949 241
66 3300049581 Ga0501047_0033924 Ga0501047_0033924_4040_4777 241
67 3300049705 Ga0501225_0002309 Ga0501225_0002309_1500_2237 241
68 3300050493 nmdc:mga0k408_199831_c1 nmdc:mga0k408_199831_c1_236_973 241
69 3300050493 nmdc:mga0k408_35743_c1 nmdc:mga0k408_35743_c1_1975_2712 241
70 3300050493 nmdc:mga0k408_69867_c1 nmdc:mga0k408_69867_c1_616_1353 241
71 3300050507 nmdc:mga05p37_4275_c1 nmdc:mga05p37_4275_c1_14873_15610 241
72 3300053086 Ga0500578_0000961 Ga0500578_0000961_26994_27731 241
73 3300053086 Ga0500578_0279625 Ga0500578_0279625_186_923 241
74 3300053089 Ga0500581_156823 Ga0500581_156823_122_859 241
75 3300053092 Ga0500583_0000111 Ga0500583_0000111_26575_27312 241
76 3300053092 Ga0500583_0092078 Ga0500583_0092078_566_1303 241
77 3300053104 Ga0500556_0052212 Ga0500556_0052212_179_916 241
78 3300053130 Ga0500642_0045459 Ga0500642_0045459_354_1091 241
79 3300053134 Ga0500658_0105057 Ga0500658_0105057_137_874 241
80 3300053177 Ga0500636_0135186 Ga0500636_0135186_497_1234 241
81 3300053178 Ga0500637_0048787 Ga0500637_0048787_989_1732 241
82 3300003316 rootH1_10151455 rootH1_101514552 242
83 3300003320 rootH2_10060361 rootH2_1006036125 242
84 3300003320 rootH2_10061197 rootH2_1006119720 242
85 3300003323 rootH1_10234605 rootH1_102346051 242
86 3300005333 Ga0070677_10023330 Ga0070677_100233302 242
87 3300005563 Ga0068855_100105736 Ga0068855_1001057363 242
88 3300005614 Ga0068856_100337007 Ga0068856_1003370071 242
89 3300009093 Ga0105240_10039571 Ga0105240_100395715 242
90 3300009545 Ga0105237_10000191 Ga0105237_1000019149 242
91 3300009545 Ga0105237_10028300 Ga0105237_100283004 242
92 3300010375 Ga0105239_10000468 Ga0105239_1000046836 242
93 3300013307 Ga0157372_10019685 Ga0157372_100196857 242
94 3300014325 Ga0163163_10047951 Ga0163163_100479512 242
95 3300014326 Ga0157380_10004722 Ga0157380_100047221 242
96 3300025904 Ga0207647_10027985 Ga0207647_100279851 242
97 3300025913 Ga0207695_10000351 Ga0207695_1000035167 242
98 3300025914 Ga0207671_10001741 Ga0207671_100017413 242
99 3300025914 Ga0207671_10016637 Ga0207671_100166373 242
100 3300025924 Ga0207694_10227115 Ga0207694_102271151 242
101 3300025949 Ga0207667_10083333 Ga0207667_100833332 242
102 3300032004 Ga0307414_10009749 Ga0307414_100097492 242
103 3300032004 Ga0307414_10161577 Ga0307414_101615773 242
104 3300032004 Ga0307414_10608899 Ga0307414_106088991 242
105 3300032005 Ga0307411_10044512 Ga0307411_100445122 242
106 3300032126 Ga0307415_100228565 Ga0307415_1002285652 242
107 3300042005 Ga0439448_0023215 Ga0439448_0023215_650_1396 242
108 3300044693 Ga0466961_0022939 Ga0466961_0022939_164_919 242
109 3300044719 Ga0466971_0058105 Ga0466971_0058105_634_1389 242
110 3300045049 Ga0466959_0012536 Ga0466959_0012536_1274_2029 242
111 3300046648 Ga0495611_0000280 Ga0495611_0000280_23836_24741 242
112 3300047472 Ga0495686_0000005 Ga0495686_0000005_286909_287688 242
113 3300053727 Ga0500611_000078 Ga0500611_000078_1021_1764 242
114 3300005335 Ga0070666_10169207 Ga0070666_101692072 243
115 3300005459 Ga0068867_100005852 Ga0068867_1000058527 243
116 3300005459 Ga0068867_100106214 Ga0068867_1001062143 243
117 3300005843 Ga0068860_100004885 Ga0068860_1000048859 243
118 3300006237 Ga0097621_100094101 Ga0097621_1000941012 243
119 3300006358 Ga0068871_100005175 Ga0068871_1000051752 243
120 3300009174 Ga0105241_10130189 Ga0105241_101301892 243
121 3300009174 Ga0105241_10554702 Ga0105241_105547022 243
122 3300010375 Ga0105239_10136461 Ga0105239_101364612 243
123 3300010375 Ga0105239_10351308 Ga0105239_103513081 243
124 3300013306 Ga0163162_10007827 Ga0163162_100078277 243
125 3300013308 Ga0157375_10124979 Ga0157375_101249793 243
126 3300013308 Ga0157375_10390319 Ga0157375_103903191 243
127 3300026089 Ga0207648_10024041 Ga0207648_100240413 243
128 3300026121 Ga0207683_10515280 Ga0207683_105152801 243
129 3300028381 Ga0268264_10001824 Ga0268264_100018249 243
130 3300028381 Ga0268264_10028287 Ga0268264_100282872 243
131 3300028794 Ga0307515_10318150 Ga0307515_103181502 243
132 3300031251 Ga0265327_10002699 Ga0265327_1000269911 243
133 3300031456 Ga0307513_10066003 Ga0307513_100660033 243
134 3300031507 Ga0307509_10103411 Ga0307509_101034111 243
135 3300031507 Ga0307509_10292392 Ga0307509_102923922 243
136 3300031616 Ga0307508_10000606 Ga0307508_1000060615 243
137 3300033179 Ga0307507_10175148 Ga0307507_101751482 243
138 3300039437 Ga0436365_1374412 Ga0436365_1374412_1427_2176 243
139 3300041491 Ga0451833_0941021 Ga0451833_0941021_194_934 243
140 3300042876 Ga0451577_0089977 Ga0451577_0089977_407_1153 243
141 3300046616 Ga0495668_0000099 Ga0495668_0000099_96866_97609 243
142 3300046660 Ga0495625_0026123 Ga0495625_0026123_1355_2098 243
143 3300053146 Ga0500588_0023548 Ga0500588_0023548_245_991 243
144 3300003323 rootH1_10021511 rootH1_100215111 244
145 3300005367 Ga0070667_100143323 Ga0070667_1001433232 244
146 3300005539 Ga0068853_100014006 Ga0068853_1000140063 244
147 3300005577 Ga0068857_100000270 Ga0068857_1000002706 244
148 3300005578 Ga0068854_100057821 Ga0068854_1000578211 244
149 3300005616 Ga0068852_100000506 Ga0068852_10000050620 244
150 3300005618 Ga0068864_100186495 Ga0068864_1001864952 244
151 3300005843 Ga0068860_100003551 Ga0068860_1000035515 244
152 3300009093 Ga0105240_10057714 Ga0105240_100577145 244
153 3300009093 Ga0105240_10116481 Ga0105240_101164812 244
154 3300009174 Ga0105241_10851759 Ga0105241_108517592 244
155 3300009545 Ga0105237_10008644 Ga0105237_100086446 244
156 3300009551 Ga0105238_10110392 Ga0105238_101103921 244
157 3300010375 Ga0105239_10006037 Ga0105239_1000603712 244
158 3300013104 Ga0157370_10002445 Ga0157370_1000244511 244
159 3300013105 Ga0157369_10105707 Ga0157369_101057073 244
160 3300013307 Ga0157372_10000656 Ga0157372_1000065627 244
161 3300025904 Ga0207647_10048661 Ga0207647_100486611 244
162 3300025913 Ga0207695_10012543 Ga0207695_100125437 244
163 3300025914 Ga0207671_10001185 Ga0207671_1000118523 244
164 3300025924 Ga0207694_10155917 Ga0207694_101559172 244
165 3300025949 Ga0207667_10001760 Ga0207667_100017607 244
166 3300025949 Ga0207667_10109633 Ga0207667_101096333 244
167 3300026078 Ga0207702_10336458 Ga0207702_103364581 244
168 3300026116 Ga0207674_10002382 Ga0207674_1000238216 244
169 3300026142 Ga0207698_10000340 Ga0207698_1000034021 244
170 3300028381 Ga0268264_10038473 Ga0268264_100384735 244
171 3300028786 Ga0307517_10009664 Ga0307517_100096643 244
172 3300049571 Ga0501034_0079979 Ga0501034_0079979_1250_1999 244
173 3300049742 Ga0501080_0119330 Ga0501080_0119330_1392_2141 244
174 3300049822 Ga0501035_0269108 Ga0501035_0269108_42_791 244
175 3300049823 Ga0501044_0004908 Ga0501044_0004908_2000_2749 244
176 3300005548 Ga0070665_100540782 Ga0070665_1005407821 245
177 3300030521 Ga0307511_10001204 Ga0307511_100012045 245
178 3300031456 Ga0307513_10197284 Ga0307513_101972842 245
179 3300046616 Ga0495668_0004679 Ga0495668_0004679_7146_7910 245
180 3300049703 Ga0501219_000177 Ga0501219_000177_2933_3679 245
181 3300049758 Ga0501241_025455 Ga0501241_025455_26_772 245
182 3300050005 Ga0501284_00051 Ga0501284_00051_14416_15162 245
183 3300003322 rootL2_10352461 rootL2_103524611 246
184 3300003323 rootH1_10321629 rootH1_103216292 246
185 3300005335 Ga0070666_10003981 Ga0070666_100039813 246
186 3300005539 Ga0068853_100005832 Ga0068853_1000058324 246
187 3300005539 Ga0068853_100075505 Ga0068853_1000755053 246
188 3300005539 Ga0068853_100619420 Ga0068853_1006194201 246
189 3300005548 Ga0070665_100000018 Ga0070665_100000018356 246
190 3300005614 Ga0068856_100072018 Ga0068856_1000720184 246
191 3300005616 Ga0068852_100043460 Ga0068852_1000434602 246
192 3300005843 Ga0068860_100000328 Ga0068860_10000032841 246
193 3300009093 Ga0105240_10004214 Ga0105240_1000421418 246
194 3300009093 Ga0105240_10015052 Ga0105240_100150526 246
195 3300009093 Ga0105240_10039878 Ga0105240_100398785 246
196 3300009174 Ga0105241_10000460 Ga0105241_1000046021 246
197 3300009545 Ga0105237_10003918 Ga0105237_100039183 246
198 3300009545 Ga0105237_10018778 Ga0105237_100187782 246
199 3300009545 Ga0105237_10054841 Ga0105237_100548415 246
200 3300009551 Ga0105238_10000488 Ga0105238_1000048829 246
201 3300009553 Ga0105249_10301080 Ga0105249_103010802 246
202 3300010375 Ga0105239_10004934 Ga0105239_100049348 246
203 3300010375 Ga0105239_10132933 Ga0105239_101329333 246
204 3300013296 Ga0157374_10000011 Ga0157374_1000001188 246
205 3300013307 Ga0157372_10037250 Ga0157372_100372503 246
206 3300014969 Ga0157376_10003138 Ga0157376_1000313812 246
207 3300025903 Ga0207680_10004318 Ga0207680_100043184 246
208 3300025911 Ga0207654_10000410 Ga0207654_1000041010 246
209 3300025913 Ga0207695_10013252 Ga0207695_100132527 246
210 3300025913 Ga0207695_10030135 Ga0207695_100301355 246
211 3300025913 Ga0207695_10033500 Ga0207695_100335005 246
212 3300025914 Ga0207671_10000950 Ga0207671_1000095014 246
213 3300025914 Ga0207671_10007269 Ga0207671_100072692 246
214 3300025914 Ga0207671_10027410 Ga0207671_100274102 246
215 3300025924 Ga0207694_10012253 Ga0207694_100122532 246
216 3300026041 Ga0207639_10155448 Ga0207639_101554482 246
217 3300026041 Ga0207639_10596778 Ga0207639_105967782 246
218 3300026142 Ga0207698_10067001 Ga0207698_100670012 246
219 3300028379 Ga0268266_10000026 Ga0268266_100000264 246
220 3300028381 Ga0268264_10004527 Ga0268264_100045274 246
221 3300031730 Ga0307516_10001745 Ga0307516_1000174510 246
222 3300044658 Ga0466972_0000591 Ga0466972_0000591_9270_10019 246
223 3300044901 Ga0466960_0214419 Ga0466960_0214419_159_908 246
224 3300046524 Ga0495648_0001596 Ga0495648_0001596_10646_11392 246
225 3300047443 Ga0495687_000058 Ga0495687_000058_103669_104415 246
226 3300053092 Ga0500583_0000860 Ga0500583_0000860_427_1173 246
227 3300053130 Ga0500642_0050627 Ga0500642_0050627_383_1129 246
228 3300053139 Ga0500568_0004392 Ga0500568_0004392_1958_2704 246
229 3300053156 Ga0500622_0001238 Ga0500622_0001238_16713_17459 246
230 3300003316 rootH1_10036764 rootH1_100367641 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

70

133

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o98-assembly1.cif.gz_A crystal structure of pseudomonas oleovorans pooph mutant h250i/i263w 0.7391 3 245
3esh-assembly1.cif.gz_A crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314 0.7323 2 247
5hif-assembly1.cif.gz_B crystal structure of a reconstructed lactonase ancestor, anc1-mph, of the bacterial methyl parathion hydrolase, mph. 0.7298 3 245
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.7284 3 242
3esh-assembly1.cif.gz_A crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314 0.727 2 247
ID Description Score Start End Superfamily
3eshC01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.743 2 246 3.60.15.10
3eshC01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7321 2 246 3.60.15.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7314 3 245 3.60.15.10
4xukA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7293 3 239 3.60.15.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.718 3 245 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A1J5SU33-F1-model_v4 Putative quorum-quenching lactonase YtnP (EC 3.1.1.-) 0.9712 39 246 GO:0016787
AF-A0A3C1R6M1-F1-model_v4 deleted 0.9634 1 164
AF-A0A7V3XAN3-F1-model_v4 MBL fold metallo-hydrolase 0.9566 2 246 GO:0016787
AF-A0A3C1R4L3-F1-model_v4 deleted 0.9559 111 246
AF-A0A842PZZ0-F1-model_v4 deleted 0.9556 3 80

Feature Viewer

pLDDT pTM Quality
92.4 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map