F343334

General Info

Members Datasets Scaffolds Average Seq Length
230 140 229 276

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0066110|Ga0495610_0066110_419_1339
Length 294
Sequence LTVDGALRGLRRYRLSFKRCEGEMRWQGGRQSGGIEDRRGLGPVALIGYFVFGISPTTTLNAVGGAGAPVEQPQVVQGRVSDAAGQFVDVISTNVSDVWTPIFRQEDRSYRPPAAVVLYSQATGTGCGLGQSAMGPFYCPNDQKVYLDLAFWQELEGRFGARGDAAKAYVIAHEMGHHVQHLLGADQIAQRMGARGAESGSVRLELQADCYAGVWAAHASDVSNGQVALDPSDIEDGLRAAAAVGDDTLQKQAGGRVAPDSFTHGSSAQRMRWFRAGAQSGDPSACDTFGTDKP

Samples

Sample ID Description Type Environment
1 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
93 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
104 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
105 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
123 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
124 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
127 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
128 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
129 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
130 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
131 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
132 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
133 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
134 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
135 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
136 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
137 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
138 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
139 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
140 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.48
Nodule 0
Rhizoplane 2.61
Rhizosphere 80.43
Stem 0
Stem Tuber 0
Unclassified 3.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10000148 3300003791 Bacteria 63227
2 Ga0055531_10007250 3300003794 Bacteria 6092
3 Ga0065165_1000192 3300005262 Bacteria 106862
4 Ga0070658_10015535 3300005327 Bacteria 6088
5 Ga0070670_100000153 3300005331 Bacteria 63436
6 Ga0070666_10023234 3300005335 Bacteria 4035
7 Ga0070680_100001343 3300005336 Bacteria 17828
8 Ga0070660_100011876 3300005339 Bacteria 6208
9 Ga0070660_100042918 3300005339 Bacteria 3454
10 Ga0070668_100001130 3300005347 Bacteria 18758
11 Ga0070668_100003875 3300005347 Bacteria 11044
12 Ga0070668_100015893 3300005347 Bacteria 5631
13 Ga0070668_100140429 3300005347 Bacteria 1946
14 Ga0070669_100014435 3300005353 Bacteria 5622
15 Ga0070669_100202346 3300005353 Bacteria 1563
16 Ga0070671_100191135 3300005355 Bacteria 1735
17 Ga0070659_100000624 3300005366 Bacteria 25857
18 Ga0070659_100004194 3300005366 Bacteria 10286
19 Ga0070659_100024594 3300005366 Bacteria 4617
20 Ga0070667_100000146 3300005367 Bacteria 88847
21 Ga0070667_100013442 3300005367 Bacteria 6767
22 Ga0070667_100017069 3300005367 Bacteria 6012
23 Ga0070681_10000755 3300005458 Bacteria 26860
24 Ga0070681_10024056 3300005458 Bacteria 6133
25 Ga0070685_10003912 3300005466 Bacteria 7528
26 Ga0070679_100022154 3300005530 Bacteria 6208
27 Ga0068853_100014272 3300005539 Bacteria 6503
28 Ga0068853_100061445 3300005539 Bacteria 3250
29 Ga0068853_100240108 3300005539 Bacteria 1660
30 Ga0068853_100248719 3300005539 Bacteria 1631
31 Ga0070665_100000626 3300005548 Bacteria 48172
32 Ga0070665_100001180 3300005548 Bacteria 31967
33 Ga0070665_100024524 3300005548 Bacteria 6077
34 Ga0070665_100203537 3300005548 Bacteria 1980
35 Ga0070665_100236886 3300005548 Bacteria 1826
36 Ga0068855_100019516 3300005563 Bacteria 8145
37 Ga0068855_100050912 3300005563 Bacteria 4879
38 Ga0068852_100045659 3300005616 Bacteria 3728
39 Ga0068859_100003999 3300005617 Bacteria 15025
40 Ga0068859_100140327 3300005617 Bacteria 2490
41 Ga0068859_100660676 3300005617 Bacteria 1137
42 Ga0068864_100000313 3300005618 Bacteria 42907
43 Ga0068864_100280626 3300005618 Bacteria 1555
44 Ga0068864_100808235 3300005618 Bacteria 922
45 Ga0068863_100000023 3300005841 Bacteria 186490
46 Ga0068863_100000253 3300005841 Bacteria 56367
47 Ga0068863_100003288 3300005841 Bacteria 15955
48 Ga0068858_100000184 3300005842 Bacteria 66104
49 Ga0068858_100006005 3300005842 Bacteria 11860
50 Ga0068858_100059485 3300005842 Bacteria 3531
51 Ga0068860_100000234 3300005843 Bacteria 85182
52 Ga0068860_100000308 3300005843 Bacteria 67784
53 Ga0068860_100074153 3300005843 Bacteria 3235
54 Ga0068862_100000129 3300005844 Bacteria 88141
55 Ga0068862_100033719 3300005844 Bacteria 4330
56 Ga0068862_100121194 3300005844 Bacteria 2305
57 Ga0075364_10066037 3300006051 Bacteria 2376
58 Ga0070712_100048981 3300006175 Bacteria 2932
59 Ga0075362_10108860 3300006177 Bacteria 1302
60 Ga0075370_10192708 3300006353 Bacteria 1201
61 Ga0068865_100002977 3300006881 Bacteria 10104
62 Ga0068865_100584742 3300006881 Bacteria 942
63 Ga0097620_100003999 3300006931 Bacteria 15025
64 Ga0097620_100140328 3300006931 Bacteria 2490
65 Ga0097620_100660572 3300006931 Bacteria 1137
66 Ga0105240_10001262 3300009093 Bacteria 43870
67 Ga0105240_10025646 3300009093 Bacteria 7743
68 Ga0105241_10086456 3300009174 Bacteria 2466
69 Ga0105248_10000619 3300009177 Bacteria 40470
70 Ga0105248_10008676 3300009177 Bacteria 11169
71 Ga0105248_10012416 3300009177 Bacteria 9395
72 Ga0105248_10063810 3300009177 Bacteria 4134
73 Ga0105248_10065608 3300009177 Bacteria 4076
74 Ga0105249_10001621 3300009553 Bacteria 19708
75 Ga0105249_10096399 3300009553 Bacteria 2775
76 Ga0105239_10105594 3300010375 Bacteria 3119
77 Ga0105239_10451720 3300010375 Bacteria 1458
78 Ga0157373_10003383 3300013100 Bacteria 12066
79 Ga0157373_10018230 3300013100 Bacteria 5113
80 Ga0157370_10165603 3300013104 Bacteria 2056
81 Ga0157374_10120920 3300013296 Bacteria 2527
82 Ga0163162_10044256 3300013306 Bacteria 4458
83 Ga0163162_10067112 3300013306 Bacteria 3637
84 Ga0157372_10035754 3300013307 Bacteria 5470
85 Ga0163163_10063415 3300014325 Bacteria 3664
86 Ga0163163_10181237 3300014325 Bacteria 2153
87 Ga0157379_10000577 3300014968 Bacteria 29678
88 Ga0157379_10001749 3300014968 Bacteria 17962
89 Ga0157379_10090530 3300014968 Bacteria 2745
90 Ga0209026_1001528 3300025250 Bacteria 10095
91 Ga0209050_1000029 3300025298 Bacteria 465801
92 Ga0209257_1002024 3300025304 Bacteria 21652
93 Ga0209257_1004588 3300025304 Bacteria 10540
94 Ga0207680_10005545 3300025903 Bacteria 6033
95 Ga0207705_10000378 3300025909 Bacteria 40021
96 Ga0207705_10246759 3300025909 Bacteria 1361
97 Ga0207707_10097714 3300025912 Bacteria 2567
98 Ga0207695_10000841 3300025913 Bacteria 56351
99 Ga0207695_10002805 3300025913 Bacteria 25333
100 Ga0207695_10031022 3300025913 Bacteria 5874
101 Ga0207695_10063585 3300025913 Bacteria 3804
102 Ga0207693_10096794 3300025915 Bacteria 2314
103 Ga0207663_10082592 3300025916 Bacteria 2108
104 Ga0207660_10001084 3300025917 Bacteria 18125
105 Ga0207660_10045109 3300025917 Bacteria 3104
106 Ga0207657_10045214 3300025919 Bacteria 3866
107 Ga0207657_10061280 3300025919 Bacteria 3227
108 Ga0207652_10002687 3300025921 Bacteria 14918
109 Ga0207694_10014059 3300025924 Bacteria 6036
110 Ga0207650_10000064 3300025925 Bacteria 142969
111 Ga0207644_10095350 3300025931 Bacteria 2225
112 Ga0207644_10157501 3300025931 Bacteria 1762
113 Ga0207690_10000206 3300025932 Bacteria 45696
114 Ga0207690_10015146 3300025932 Bacteria 4669
115 Ga0207690_10052468 3300025932 Bacteria 2731
116 Ga0207704_10000786 3300025938 Bacteria 14008
117 Ga0207711_10000670 3300025941 Bacteria 34027
118 Ga0207711_10007117 3300025941 Bacteria 9374
119 Ga0207711_10043265 3300025941 Bacteria 3840
120 Ga0207711_10113334 3300025941 Bacteria 2414
121 Ga0207711_10186206 3300025941 Bacteria 1890
122 Ga0207667_10009501 3300025949 Bacteria 11448
123 Ga0207667_10016449 3300025949 Bacteria 8358
124 Ga0207667_10055639 3300025949 Bacteria 4159
125 Ga0207667_10306607 3300025949 Bacteria 1622
126 Ga0207712_10001631 3300025961 Bacteria 15131
127 Ga0207668_10000154 3300025972 Bacteria 47517
128 Ga0207668_10000379 3300025972 Bacteria 28234
129 Ga0207668_10005237 3300025972 Bacteria 7625
130 Ga0207640_10162931 3300025981 Bacteria 1652
131 Ga0207658_10000390 3300025986 Bacteria 42467
132 Ga0207658_10011353 3300025986 Bacteria 6061
133 Ga0207658_10019057 3300025986 Bacteria 4746
134 Ga0207703_10000273 3300026035 Bacteria 57186
135 Ga0207703_10002812 3300026035 Bacteria 14851
136 Ga0207703_10099608 3300026035 Bacteria 2460
137 Ga0207639_10021260 3300026041 Bacteria 4658
138 Ga0207639_10046413 3300026041 Bacteria 3278
139 Ga0207639_10722079 3300026041 Bacteria 925
140 Ga0207641_10000067 3300026088 Bacteria 155379
141 Ga0207641_10000634 3300026088 Bacteria 38355
142 Ga0207641_10155784 3300026088 Bacteria 2072
143 Ga0207676_10000131 3300026095 Bacteria 66092
144 Ga0207676_10000646 3300026095 Bacteria 27901
145 Ga0207676_10014699 3300026095 Bacteria 5638
146 Ga0207675_100216772 3300026118 Bacteria 1843
147 Ga0209981_1000582 3300027378 Bacteria 4607
148 Ga0209999_1003820 3300027543 Bacteria 2705
149 Ga0209813_10011213 3300027866 Bacteria 2338
150 Ga0268266_10000003 3300028379 Bacteria 1701703
151 Ga0268266_10000812 3300028379 Bacteria 41107
152 Ga0268266_10109454 3300028379 Bacteria 2446
153 Ga0268265_10000933 3300028380 Bacteria 26903
154 Ga0268265_10003496 3300028380 Bacteria 11253
155 Ga0268265_10015378 3300028380 Bacteria 5237
156 Ga0268265_10015897 3300028380 Bacteria 5162
157 Ga0268265_10050508 3300028380 Bacteria 3134
158 Ga0268264_10000008 3300028381 Bacteria 773387
159 Ga0268264_10000360 3300028381 Bacteria 67798
160 Ga0307517_10024399 3300028786 Bacteria 7454
161 Ga0307513_10033981 3300031456 Bacteria 5727
162 Ga0307508_10149602 3300031616 Bacteria 1939
163 Ga0373935_0088814 3300035692 Bacteria 2020
164 Ga0373925_0035201 3300037068 Bacteria 3694
165 Ga0395899_0012270 3300037312 Bacteria 6562
166 Ga0395900_0000052 3300037418 Bacteria 223910
167 Ga0395900_0067888 3300037418 Bacteria 3663
168 Ga0395898_0198595 3300037466 Bacteria 1915
169 Ga0395905_0002282 3300037471 Bacteria 21521
170 Ga0395905_0033330 3300037471 Bacteria 4838
171 Ga0395905_0260431 3300037471 Bacteria 1619
172 Ga0395901_0000001 3300038443 Bacteria 800383
173 Ga0439461_0026059 3300041410 Bacteria 1191
174 Ga0495629_0124998 3300046459 Bacteria 1792
175 Ga0495610_0066110 3300046512 Bacteria 1704
176 Ga0495620_0050760 3300046515 Bacteria 1768
177 Ga0495643_0049280 3300046522 Bacteria 2272
178 Ga0495597_0012190 3300046542 Bacteria 4154
179 Ga0495622_0034679 3300046557 Bacteria 2354
180 Ga0495668_0024140 3300046616 Bacteria 3460
181 Ga0495668_0124570 3300046616 Bacteria 1410
182 Ga0495625_0174891 3300046660 Bacteria 1431
183 Ga0495669_0000012 3300046684 Bacteria 157373
184 Ga0495669_0012191 3300046684 Bacteria 3658
185 Ga0495613_0186447 3300046689 Bacteria 1468
186 Ga0495581_0105885 3300047315 Bacteria 1634
187 Ga0495672_0031633 3300047320 Bacteria 3302
188 Ga0495677_0017572 3300047445 Bacteria 2593
189 Ga0495593_0056694 3300047673 Bacteria 2059
190 Ga0495615_0036197 3300048090 Bacteria 1210
191 Ga0496102_0133078 3300048905 Bacteria 2329
192 Ga0496102_0298485 3300048905 Bacteria 1518
193 Ga0496103_0174158 3300048906 Bacteria 1382
194 Ga0496106_0102468 3300048909 Bacteria 2221
195 Ga0496115_0000277 3300048918 Bacteria 45027
196 Ga0496115_0181592 3300048918 Bacteria 1739
197 Ga0496116_0154639 3300048919 Bacteria 1268
198 Ga0496118_0002955 3300048921 Bacteria 22041
199 Ga0496121_0000152 3300048924 Bacteria 150767
200 Ga0501032_0149245 3300049569 Bacteria 1538
201 Ga0501033_0037810 3300049570 Bacteria 3612
202 Ga0501034_0026720 3300049571 Bacteria 5873
203 Ga0501038_0234919 3300049574 Bacteria 1457
204 Ga0501047_0001465 3300049581 Bacteria 23033
205 Ga0501073_0009103 3300049589 Bacteria 7328
206 Ga0501080_0074552 3300049742 Bacteria 3156
207 Ga0501044_0070143 3300049823 Bacteria 3566
208 Ga0501044_0098152 3300049823 Bacteria 2949
209 nmdc:mga00v17_54815_c1 3300050491 Bacteria 2433
210 nmdc:mga0k408_151862_c1 3300050493 Bacteria 1379
211 nmdc:mga06z11_40837_c2 3300050494 Bacteria 1278
212 nmdc:mga04h51_164498_c1 3300050495 Bacteria 856
213 nmdc:mga07m45_3108_c1 3300050496 Bacteria 7944
214 nmdc:mga07m45_48546_c1 3300050496 Bacteria 2388
215 nmdc:mga0sz30_28011_c1 3300050516 Bacteria 2316
216 Ga0500643_011525 3300053087 Bacteria 3223
217 Ga0500651_0168369 3300053093 Bacteria 1307
218 Ga0500566_0019082 3300053094 Bacteria 4027
219 Ga0500555_004516 3300053103 Bacteria 3952
220 Ga0500562_005710 3300053108 Bacteria 3131
221 Ga0500569_002279 3300053109 Bacteria 3758
222 Ga0500608_007626 3300053122 Bacteria 4491
223 Ga0500642_0055241 3300053130 Bacteria 1766
224 Ga0500655_041212 3300053133 Bacteria 906
225 Ga0500590_097743 3300053148 Bacteria 1414
226 Ga0500636_0139653 3300053177 Bacteria 1342
227 Ga0500625_040478 3300053729 Bacteria 2193
228 Ga0500645_003588 3300053730 Bacteria 6230
229 Ga0500596_003933 3300053735 Bacteria 2775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10451720 Ga0105239_104517201 245
2 3300049589 Ga0501073_0009103 Ga0501073_0009103_6422_7270 246
3 3300049742 Ga0501080_0074552 Ga0501080_0074552_1343_2191 246
4 3300053103 Ga0500555_004516 Ga0500555_004516_1584_2384 251
5 3300050495 nmdc:mga04h51_164498_c1 nmdc:mga04h51_164498_c1_20_799 253
6 3300005466 Ga0070685_10003912 Ga0070685_100039128 255
7 3300005458 Ga0070681_10024056 Ga0070681_100240565 257
8 3300028786 Ga0307517_10024399 Ga0307517_100243993 258
9 3300047673 Ga0495593_0056694 Ga0495593_0056694_48_839 258
10 3300053148 Ga0500590_097743 Ga0500590_097743_595_1386 258
11 iso_pu_bacteria 2643221663 2644352517 258
12 3300006175 Ga0070712_100048981 Ga0070712_1000489813 261
13 3300025915 Ga0207693_10096794 Ga0207693_100967943 261
14 3300025916 Ga0207663_10082592 Ga0207663_100825923 261
15 3300048905 Ga0496102_0298485 Ga0496102_0298485_424_1272 262
16 3300049571 Ga0501034_0026720 Ga0501034_0026720_34_894 263
17 3300049574 Ga0501038_0234919 Ga0501038_0234919_10_870 263
18 3300049823 Ga0501044_0070143 Ga0501044_0070143_1509_2369 263
19 3300037312 Ga0395899_0012270 Ga0395899_0012270_1570_2430 264
20 3300037418 Ga0395900_0000052 Ga0395900_0000052_44385_45245 264
21 3300037466 Ga0395898_0198595 Ga0395898_0198595_1009_1869 264
22 3300037471 Ga0395905_0002282 Ga0395905_0002282_1455_2315 264
23 3300038443 Ga0395901_0000001 Ga0395901_0000001_742755_743615 264
24 3300006051 Ga0075364_10066037 Ga0075364_100660372 265
25 3300006353 Ga0075370_10192708 Ga0075370_101927082 265
26 3300006881 Ga0068865_100584742 Ga0068865_1005847422 265
27 3300013100 Ga0157373_10003383 Ga0157373_100033833 265
28 3300027866 Ga0209813_10011213 Ga0209813_100112133 265
29 3300050491 nmdc:mga00v17_54815_c1 nmdc:mga00v17_54815_c1_333_1178 265
30 3300050493 nmdc:mga0k408_151862_c1 nmdc:mga0k408_151862_c1_342_1187 265
31 3300050494 nmdc:mga06z11_40837_c2 nmdc:mga06z11_40837_c2_93_938 265
32 3300050496 nmdc:mga07m45_3108_c1 nmdc:mga07m45_3108_c1_6805_7650 265
33 3300050496 nmdc:mga07m45_48546_c1 nmdc:mga07m45_48546_c1_1207_2052 265
34 3300050516 nmdc:mga0sz30_28011_c1 nmdc:mga0sz30_28011_c1_145_990 265
35 3300005347 Ga0070668_100001130 Ga0070668_10000113022 266
36 3300005366 Ga0070659_100024594 Ga0070659_1000245943 266
37 3300005539 Ga0068853_100061445 Ga0068853_1000614452 266
38 3300005539 Ga0068853_100248719 Ga0068853_1002487191 266
39 3300005617 Ga0068859_100660676 Ga0068859_1006606762 266
40 3300005843 Ga0068860_100000234 Ga0068860_10000023447 266
41 3300006931 Ga0097620_100660572 Ga0097620_1006605722 266
42 3300013100 Ga0157373_10018230 Ga0157373_100182303 266
43 3300025932 Ga0207690_10015146 Ga0207690_100151463 266
44 3300026041 Ga0207639_10046413 Ga0207639_100464133 266
45 3300028380 Ga0268265_10003496 Ga0268265_100034964 266
46 3300028380 Ga0268265_10015378 Ga0268265_100153785 266
47 3300028381 Ga0268264_10000008 Ga0268264_10000008670 266
48 3300031616 Ga0307508_10149602 Ga0307508_101496023 266
49 3300046522 Ga0495643_0049280 Ga0495643_0049280_1387_2238 266
50 3300046557 Ga0495622_0034679 Ga0495622_0034679_316_1167 266
51 3300048905 Ga0496102_0133078 Ga0496102_0133078_1012_1863 266
52 3300048919 Ga0496116_0154639 Ga0496116_0154639_20_871 266
53 3300048921 Ga0496118_0002955 Ga0496118_0002955_11624_12475 266
54 3300048924 Ga0496121_0000152 Ga0496121_0000152_107617_108468 266
55 3300053094 Ga0500566_0019082 Ga0500566_0019082_1772_2623 266
56 3300053130 Ga0500642_0055241 Ga0500642_0055241_673_1524 266
57 3300053729 Ga0500625_040478 Ga0500625_040478_1278_2129 266
58 3300005331 Ga0070670_100000153 Ga0070670_10000015330 267
59 3300005335 Ga0070666_10023234 Ga0070666_100232345 267
60 3300005336 Ga0070680_100001343 Ga0070680_1000013437 267
61 3300005339 Ga0070660_100011876 Ga0070660_1000118766 267
62 3300005339 Ga0070660_100042918 Ga0070660_1000429183 267
63 3300005347 Ga0070668_100140429 Ga0070668_1001404293 267
64 3300005353 Ga0070669_100202346 Ga0070669_1002023462 267
65 3300005366 Ga0070659_100000624 Ga0070659_1000006248 267
66 3300005366 Ga0070659_100004194 Ga0070659_1000041947 267
67 3300005367 Ga0070667_100000146 Ga0070667_10000014630 267
68 3300005458 Ga0070681_10000755 Ga0070681_1000075521 267
69 3300005530 Ga0070679_100022154 Ga0070679_1000221546 267
70 3300005539 Ga0068853_100014272 Ga0068853_1000142723 267
71 3300005539 Ga0068853_100240108 Ga0068853_1002401082 267
72 3300005548 Ga0070665_100000626 Ga0070665_10000062619 267
73 3300005548 Ga0070665_100024524 Ga0070665_1000245244 267
74 3300005563 Ga0068855_100019516 Ga0068855_1000195161 267
75 3300005563 Ga0068855_100050912 Ga0068855_1000509126 267
76 3300005617 Ga0068859_100140327 Ga0068859_1001403274 267
77 3300005618 Ga0068864_100000313 Ga0068864_10000031323 267
78 3300005618 Ga0068864_100808235 Ga0068864_1008082351 267
79 3300005841 Ga0068863_100000253 Ga0068863_10000025335 267
80 3300005842 Ga0068858_100006005 Ga0068858_10000600510 267
81 3300005843 Ga0068860_100000308 Ga0068860_10000030830 267
82 3300005844 Ga0068862_100000129 Ga0068862_10000012967 267
83 3300006881 Ga0068865_100002977 Ga0068865_1000029777 267
84 3300006931 Ga0097620_100140328 Ga0097620_1001403284 267
85 3300009174 Ga0105241_10086456 Ga0105241_100864562 267
86 3300009177 Ga0105248_10000619 Ga0105248_1000061923 267
87 3300009177 Ga0105248_10063810 Ga0105248_100638104 267
88 3300009553 Ga0105249_10001621 Ga0105249_1000162110 267
89 3300010375 Ga0105239_10105594 Ga0105239_101055942 267
90 3300013104 Ga0157370_10165603 Ga0157370_101656033 267
91 3300013306 Ga0163162_10067112 Ga0163162_100671123 267
92 3300014325 Ga0163163_10181237 Ga0163163_101812372 267
93 3300014968 Ga0157379_10001749 Ga0157379_100017496 267
94 3300025903 Ga0207680_10005545 Ga0207680_100055456 267
95 3300025909 Ga0207705_10000378 Ga0207705_1000037822 267
96 3300025909 Ga0207705_10246759 Ga0207705_102467591 267
97 3300025912 Ga0207707_10097714 Ga0207707_100977142 267
98 3300025917 Ga0207660_10001084 Ga0207660_100010844 267
99 3300025919 Ga0207657_10045214 Ga0207657_100452144 267
100 3300025919 Ga0207657_10061280 Ga0207657_100612803 267
101 3300025921 Ga0207652_10002687 Ga0207652_1000268713 267
102 3300025924 Ga0207694_10014059 Ga0207694_100140596 267
103 3300025925 Ga0207650_10000064 Ga0207650_10000064113 267
104 3300025931 Ga0207644_10095350 Ga0207644_100953502 267
105 3300025932 Ga0207690_10000206 Ga0207690_1000020612 267
106 3300025932 Ga0207690_10052468 Ga0207690_100524682 267
107 3300025938 Ga0207704_10000786 Ga0207704_100007869 267
108 3300025941 Ga0207711_10000670 Ga0207711_100006709 267
109 3300025941 Ga0207711_10113334 Ga0207711_101133345 267
110 3300025949 Ga0207667_10009501 Ga0207667_100095017 267
111 3300025949 Ga0207667_10055639 Ga0207667_100556391 267
112 3300025949 Ga0207667_10306607 Ga0207667_103066072 267
113 3300025961 Ga0207712_10001631 Ga0207712_1000163111 267
114 3300025972 Ga0207668_10000379 Ga0207668_100003797 267
115 3300025986 Ga0207658_10000390 Ga0207658_1000039042 267
116 3300026035 Ga0207703_10002812 Ga0207703_100028123 267
117 3300026041 Ga0207639_10021260 Ga0207639_100212603 267
118 3300026041 Ga0207639_10722079 Ga0207639_107220791 267
119 3300026088 Ga0207641_10000634 Ga0207641_1000063429 267
120 3300026095 Ga0207676_10000131 Ga0207676_1000013144 267
121 3300026118 Ga0207675_100216772 Ga0207675_1002167722 267
122 3300028379 Ga0268266_10000003 Ga0268266_10000003458 267
123 3300028379 Ga0268266_10109454 Ga0268266_101094543 267
124 3300028380 Ga0268265_10000933 Ga0268265_1000093310 267
125 3300028381 Ga0268264_10000360 Ga0268264_1000036029 267
126 3300031456 Ga0307513_10033981 Ga0307513_100339815 267
127 3300037471 Ga0395905_0260431 Ga0395905_0260431_334_1188 267
128 3300046512 Ga0495610_0066110 Ga0495610_0066110_419_1339 267
129 3300046515 Ga0495620_0050760 Ga0495620_0050760_37_888 267
130 3300046542 Ga0495597_0012190 Ga0495597_0012190_1775_2626 267
131 3300046616 Ga0495668_0024140 Ga0495668_0024140_13_864 267
132 3300046616 Ga0495668_0124570 Ga0495668_0124570_543_1391 267
133 3300046684 Ga0495669_0000012 Ga0495669_0000012_819_1670 267
134 3300046684 Ga0495669_0012191 Ga0495669_0012191_1491_2351 267
135 3300046689 Ga0495613_0186447 Ga0495613_0186447_514_1374 267
136 3300047315 Ga0495581_0105885 Ga0495581_0105885_764_1624 267
137 3300047320 Ga0495672_0031633 Ga0495672_0031633_1974_2822 267
138 3300047445 Ga0495677_0017572 Ga0495677_0017572_702_1553 267
139 3300048090 Ga0495615_0036197 Ga0495615_0036197_199_1047 267
140 3300048906 Ga0496103_0174158 Ga0496103_0174158_14_877 267
141 3300049581 Ga0501047_0001465 Ga0501047_0001465_18437_19285 267
142 3300053093 Ga0500651_0168369 Ga0500651_0168369_106_957 267
143 3300053108 Ga0500562_005710 Ga0500562_005710_1236_2084 267
144 3300053109 Ga0500569_002279 Ga0500569_002279_902_1753 267
145 3300053122 Ga0500608_007626 Ga0500608_007626_1374_2225 267
146 3300053133 Ga0500655_041212 Ga0500655_041212_23_895 267
147 3300053177 Ga0500636_0139653 Ga0500636_0139653_391_1242 267
148 3300053735 Ga0500596_003933 Ga0500596_003933_1817_2668 267
149 3300003791 Ga0055530_10000148 Ga0055530_1000014816 268
150 3300003794 Ga0055531_10007250 Ga0055531_100072502 268
151 3300005262 Ga0065165_1000192 Ga0065165_100019287 268
152 3300005327 Ga0070658_10015535 Ga0070658_1001553510 268
153 3300005347 Ga0070668_100003875 Ga0070668_10000387515 268
154 3300005347 Ga0070668_100015893 Ga0070668_1000158936 268
155 3300005353 Ga0070669_100014435 Ga0070669_1000144356 268
156 3300005355 Ga0070671_100191135 Ga0070671_1001911352 268
157 3300005367 Ga0070667_100013442 Ga0070667_1000134426 268
158 3300005367 Ga0070667_100017069 Ga0070667_1000170694 268
159 3300005548 Ga0070665_100001180 Ga0070665_10000118018 268
160 3300005548 Ga0070665_100203537 Ga0070665_1002035373 268
161 3300005548 Ga0070665_100236886 Ga0070665_1002368864 268
162 3300005616 Ga0068852_100045659 Ga0068852_1000456593 268
163 3300005617 Ga0068859_100003999 Ga0068859_1000039999 268
164 3300005618 Ga0068864_100280626 Ga0068864_1002806262 268
165 3300005841 Ga0068863_100000023 Ga0068863_100000023104 268
166 3300005841 Ga0068863_100003288 Ga0068863_1000032884 268
167 3300005842 Ga0068858_100000184 Ga0068858_10000018455 268
168 3300005842 Ga0068858_100059485 Ga0068858_1000594855 268
169 3300005843 Ga0068860_100074153 Ga0068860_1000741534 268
170 3300005844 Ga0068862_100033719 Ga0068862_1000337196 268
171 3300005844 Ga0068862_100121194 Ga0068862_1001211942 268
172 3300006177 Ga0075362_10108860 Ga0075362_101088601 268
173 3300006931 Ga0097620_100003999 Ga0097620_1000039999 268
174 3300009093 Ga0105240_10001262 Ga0105240_1000126223 268
175 3300009093 Ga0105240_10025646 Ga0105240_100256463 268
176 3300009177 Ga0105248_10008676 Ga0105248_100086769 268
177 3300009177 Ga0105248_10012416 Ga0105248_100124169 268
178 3300009177 Ga0105248_10065608 Ga0105248_100656084 268
179 3300009553 Ga0105249_10096399 Ga0105249_100963994 268
180 3300013296 Ga0157374_10120920 Ga0157374_101209203 268
181 3300013306 Ga0163162_10044256 Ga0163162_100442565 268
182 3300013307 Ga0157372_10035754 Ga0157372_100357545 268
183 3300014325 Ga0163163_10063415 Ga0163163_100634155 268
184 3300014968 Ga0157379_10000577 Ga0157379_100005773 268
185 3300014968 Ga0157379_10090530 Ga0157379_100905303 268
186 3300025250 Ga0209026_1001528 Ga0209026_10015284 268
187 3300025298 Ga0209050_1000029 Ga0209050_1000029374 268
188 3300025304 Ga0209257_1002024 Ga0209257_100202417 268
189 3300025304 Ga0209257_1004588 Ga0209257_10045886 268
190 3300025913 Ga0207695_10000841 Ga0207695_1000084139 268
191 3300025913 Ga0207695_10002805 Ga0207695_100028057 268
192 3300025913 Ga0207695_10031022 Ga0207695_100310226 268
193 3300025913 Ga0207695_10063585 Ga0207695_100635853 268
194 3300025917 Ga0207660_10045109 Ga0207660_100451096 268
195 3300025931 Ga0207644_10157501 Ga0207644_101575012 268
196 3300025941 Ga0207711_10007117 Ga0207711_100071178 268
197 3300025941 Ga0207711_10043265 Ga0207711_100432652 268
198 3300025941 Ga0207711_10186206 Ga0207711_101862061 268
199 3300025949 Ga0207667_10016449 Ga0207667_100164497 268
200 3300025972 Ga0207668_10000154 Ga0207668_1000015420 268
201 3300025972 Ga0207668_10005237 Ga0207668_100052373 268
202 3300025981 Ga0207640_10162931 Ga0207640_101629312 268
203 3300025986 Ga0207658_10011353 Ga0207658_100113533 268
204 3300025986 Ga0207658_10019057 Ga0207658_100190574 268
205 3300026035 Ga0207703_10000273 Ga0207703_1000027355 268
206 3300026035 Ga0207703_10099608 Ga0207703_100996082 268
207 3300026088 Ga0207641_10000067 Ga0207641_10000067131 268
208 3300026088 Ga0207641_10155784 Ga0207641_101557842 268
209 3300026095 Ga0207676_10000646 Ga0207676_1000064611 268
210 3300026095 Ga0207676_10014699 Ga0207676_100146993 268
211 3300027378 Ga0209981_1000582 Ga0209981_10005825 268
212 3300027543 Ga0209999_1003820 Ga0209999_10038204 268
213 3300028379 Ga0268266_10000812 Ga0268266_1000081228 268
214 3300028380 Ga0268265_10015897 Ga0268265_100158976 268
215 3300028380 Ga0268265_10050508 Ga0268265_100505083 268
216 3300035692 Ga0373935_0088814 Ga0373935_0088814_206_1057 268
217 3300037068 Ga0373925_0035201 Ga0373925_0035201_2282_3133 268
218 3300037418 Ga0395900_0067888 Ga0395900_0067888_1448_2308 268
219 3300037471 Ga0395905_0033330 Ga0395905_0033330_1876_2736 268
220 3300041410 Ga0439461_0026059 Ga0439461_0026059_84_935 268
221 3300046459 Ga0495629_0124998 Ga0495629_0124998_722_1573 268
222 3300046660 Ga0495625_0174891 Ga0495625_0174891_74_913 268
223 3300048909 Ga0496106_0102468 Ga0496106_0102468_1026_1877 268
224 3300048918 Ga0496115_0000277 Ga0496115_0000277_31935_32792 268
225 3300048918 Ga0496115_0181592 Ga0496115_0181592_405_1283 268
226 3300049569 Ga0501032_0149245 Ga0501032_0149245_550_1404 268
227 3300049570 Ga0501033_0037810 Ga0501033_0037810_1549_2403 268
228 3300049823 Ga0501044_0098152 Ga0501044_0098152_845_1699 268
229 3300053087 Ga0500643_011525 Ga0500643_011525_1537_2388 268
230 3300053730 Ga0500645_003588 Ga0500645_003588_3252_4091 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04228

Zn_peptidase

Putative neutral zinc metallopeptidase

24

289

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.4864 69 165
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.4706 60 168
4aw6-assembly1.cif.gz_A crystal structure of the human nuclear membrane zinc metalloprotease zmpste24 (face1) 0.4693 118 249
2ypt-assembly4.cif.gz_E crystal structure of the human nuclear membrane zinc metalloprotease zmpste24 mutant (e336a) in complex with a synthetic csim tetrapeptide from the c-terminus of prelamin a 0.4637 58 249
4k89-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa strain k solvent tolerant elastase 0.4613 10 260
ID Description Score Start End Superfamily
af_P9WL85_4_287_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8182 11 263 3.40.390.10
af_P64429_1_283_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7881 1 263 3.40.390.10
af_P9WL85_4_287_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7718 11 263 3.40.390.10
af_P64429_1_283_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7713 1 263 3.40.390.10
af_Q2FY02_5_155_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.5704 60 153 3.40.390.30
ID Description Score Start End GO Terms
AF-A0A259IZJ3-F1-model_v4 deleted 0.9845 117 268
AF-A0A259IZJ3-F1-model_v4 deleted 0.9781 117 268
AF-A0A257X5T3-F1-model_v4 Metalloprotease 0.9734 166 268 GO:0016020
AF-A0A257X5T3-F1-model_v4 Metalloprotease 0.9642 166 268 GO:0016020
AF-M3V201-F1-model_v4 Neutral zinc metallopeptidase 0.9526 60 268 GO:0016020

Feature Viewer

pLDDT pTM Quality
84.25 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map