F343256

General Info

Members Datasets Scaffolds Average Seq Length
230 146 201 215

Family's Representative Sequence

Representative Sequence 3300042002|Ga0439442_000524|Ga0439442_000524_3312_4001
Length 229
Sequence MSALTSLWPLFGLTLTTPRLVLRPITDDDIPAAVAAALSGVHEPGRNPFSTPWAELPAEELGPKMAQYYWRCRSEAAPHAWTLLLGIWQGSDFIGCQDIGARDFATLRTVSTGSWLKQSVHGRGLGKEMRAAVVLYAFDWLNAEVAESEAAAWNAASLGVSRALGYELNGTTRTAWGDKAEDVQKVRLTPGTFNRPDWTLKVEGHEAAARFLGAGGRGPTNRTTAPHTP

Samples

Sample ID Description Type Environment
1 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
2 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
3 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
4 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
5 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
6 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
7 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
8 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
9 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
10 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
11 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
12 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
13 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
14 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
15 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
16 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
17 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
18 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
19 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
20 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
21 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
22 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
23 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
24 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
25 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
26 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
27 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
28 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
81 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
82 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
83 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
84 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
85 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
86 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
87 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
88 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
89 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
90 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
91 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
92 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
93 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
94 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
145 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
146 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.96
Metatranscriptomes 0.43
Isolates 12.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 12.17
Rhizosphere 78.7
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1006668 3300003578 Bacteria 3244
2 Ga0055542_1007163 3300003762 Bacteria 2300
3 Ga0065714_10145238 3300005288 Bacteria 1143
4 Ga0070676_10141827 3300005328 Bacteria 1530
5 Ga0070670_100348579 3300005331 Bacteria 1300
6 Ga0070677_10011293 3300005333 Bacteria 3077
7 Ga0070666_10085379 3300005335 Bacteria 2162
8 Ga0070669_100024199 3300005353 Bacteria 4353
9 Ga0070674_100027323 3300005356 Bacteria 3739
10 Ga0070673_100069788 3300005364 Bacteria 2818
11 Ga0070672_100213061 3300005543 Bacteria 1618
12 Ga0075367_10189847 3300006178 Bacteria 1282
13 Ga0105251_10108377 3300009011 Bacteria 1266
14 Ga0105244_10032974 3300009036 Bacteria 2735
15 Ga0105244_10035243 3300009036 Bacteria 2630
16 Ga0105244_10042993 3300009036 Bacteria 2333
17 Ga0105244_10045871 3300009036 Bacteria 2247
18 Ga0105244_10081433 3300009036 Bacteria 1602
19 Ga0114129_10541381 3300009147 Bacteria 1515
20 Ga0105243_10101497 3300009148 Bacteria 2389
21 Ga0105242_10349834 3300009176 Bacteria 1364
22 Ga0105248_10680241 3300009177 Bacteria 1161
23 Ga0105246_10008286 3300011119 Bacteria 6383
24 Ga0105246_10018575 3300011119 Bacteria 4433
25 Ga0105246_10268767 3300011119 Bacteria 1362
26 Ga0105246_10605504 3300011119 Bacteria 947
27 Ga0157373_10019526 3300013100 Bacteria 4930
28 Ga0157369_11182705 3300013105 Bacteria 781
29 Ga0163162_10060835 3300013306 Bacteria 3813
30 Ga0163162_11045091 3300013306 Bacteria 924
31 Ga0157375_10018471 3300013308 Bacteria 6324
32 Ga0157375_10544683 3300013308 Bacteria 1322
33 Ga0209148_1004954 3300025254 Bacteria 3142
34 Ga0209148_1010181 3300025254 Bacteria 1795
35 Ga0209051_1002951 3300025303 Bacteria 11598
36 Ga0207697_10006481 3300025315 Bacteria 5292
37 Ga0207697_10006509 3300025315 Bacteria 5278
38 Ga0207655_1012726 3300025728 Bacteria 4888
39 Ga0207655_1048025 3300025728 Bacteria 1756
40 Ga0207655_1074302 3300025728 Bacteria 1251
41 Ga0207645_10183670 3300025907 Bacteria 1372
42 Ga0207681_10257695 3300025923 Bacteria 1364
43 Ga0207650_10176168 3300025925 Bacteria 1702
44 Ga0207691_10000200 3300025940 Bacteria 57566
45 Ga0207711_10298040 3300025941 Bacteria 1487
46 Ga0207683_10002731 3300026121 Bacteria 15413
47 Ga0207428_10014333 3300027907 Bacteria 6897
48 Ga0265326_10116580 3300028558 Bacteria 759
49 Ga0265319_1048315 3300028563 Bacteria 1413
50 Ga0307408_100016621 3300031548 Bacteria 4915
51 Ga0307408_100040278 3300031548 Bacteria 3308
52 Ga0307408_100063979 3300031548 Bacteria 2693
53 Ga0307408_100091481 3300031548 Bacteria 2297
54 Ga0307408_100302417 3300031548 Bacteria 1340
55 Ga0307408_100303436 3300031548 Bacteria 1338
56 Ga0307408_100472247 3300031548 Bacteria 1092
57 Ga0307408_100519313 3300031548 Bacteria 1046
58 Ga0307408_100529392 3300031548 Bacteria 1036
59 Ga0307405_10007255 3300031731 Bacteria 5526
60 Ga0307405_10062021 3300031731 Bacteria 2366
61 Ga0307405_10084191 3300031731 Bacteria 2087
62 Ga0307405_10136335 3300031731 Bacteria 1704
63 Ga0307405_10165353 3300031731 Bacteria 1572
64 Ga0307405_10248412 3300031731 Bacteria 1322
65 Ga0307413_10035078 3300031824 Bacteria 2874
66 Ga0307413_10041577 3300031824 Bacteria 2692
67 Ga0307413_10339152 3300031824 Bacteria 1155
68 Ga0307413_10398388 3300031824 Bacteria 1078
69 Ga0307410_10002887 3300031852 Bacteria 8461
70 Ga0307410_10016418 3300031852 Bacteria 4416
71 Ga0307410_10505228 3300031852 Bacteria 995
72 Ga0307406_10056948 3300031901 Bacteria 2506
73 Ga0307406_10060247 3300031901 Bacteria 2447
74 Ga0307406_10342894 3300031901 Bacteria 1164
75 Ga0307407_10026785 3300031903 Bacteria 3058
76 Ga0307407_10036126 3300031903 Bacteria 2720
77 Ga0307407_10416947 3300031903 Bacteria 967
78 Ga0307407_10442584 3300031903 Bacteria 941
79 Ga0307407_10490344 3300031903 Bacteria 899
80 Ga0307412_10005640 3300031911 Bacteria 7029
81 Ga0307412_10074104 3300031911 Bacteria 2331
82 Ga0307412_10075879 3300031911 Bacteria 2307
83 Ga0307412_10095258 3300031911 Bacteria 2092
84 Ga0307412_10119074 3300031911 Bacteria 1898
85 Ga0307412_10146607 3300031911 Bacteria 1736
86 Ga0307412_10247067 3300031911 Bacteria 1383
87 Ga0307412_10335304 3300031911 Bacteria 1208
88 Ga0307412_10380536 3300031911 Bacteria 1142
89 Ga0307412_10507314 3300031911 Bacteria 1005
90 Ga0307412_10520524 3300031911 Bacteria 994
91 Ga0307409_100009788 3300031995 Bacteria 5911
92 Ga0307409_100059696 3300031995 Bacteria 2969
93 Ga0307409_100073598 3300031995 Bacteria 2726
94 Ga0307409_100130419 3300031995 Bacteria 2147
95 Ga0307416_100029509 3300032002 Bacteria 4099
96 Ga0307416_100108144 3300032002 Bacteria 2442
97 Ga0307416_100116557 3300032002 Bacteria 2368
98 Ga0307416_100140198 3300032002 Bacteria 2196
99 Ga0307416_100164528 3300032002 Bacteria 2056
100 Ga0307416_100180343 3300032002 Bacteria 1978
101 Ga0307414_10877018 3300032004 Bacteria 822
102 Ga0307411_10007938 3300032005 Bacteria 5455
103 Ga0307411_10176050 3300032005 Bacteria 1619
104 Ga0307415_100669286 3300032126 Bacteria 933
105 Ga0395899_0048229 3300037312 Bacteria 3170
106 Ga0395900_0032526 3300037418 Bacteria 5364
107 Ga0395898_0144015 3300037466 Bacteria 2281
108 Ga0395898_0322957 3300037466 Bacteria 1472
109 Ga0395901_0328244 3300038443 Bacteria 1582
110 Ga0439436_0020719 3300041404 Bacteria 1957
111 Ga0439436_0051290 3300041404 Bacteria 1165
112 Ga0439436_0074182 3300041404 Bacteria 948
113 Ga0439438_025922 3300041405 Bacteria 1592
114 Ga0439439_0092291 3300041406 Bacteria 828
115 Ga0439439_0102639 3300041406 Bacteria 788
116 Ga0439465_0096526 3300041413 Bacteria 1016
117 Ga0451793_1118708 3300041452 Bacteria 789
118 Ga0439433_0009171 3300041999 Bacteria 2153
119 Ga0439433_0009449 3300041999 Bacteria 2124
120 Ga0439442_000021 3300042002 Bacteria 41937
121 Ga0439442_000524 3300042002 Bacteria 8544
122 Ga0439449_0098824 3300042007 Bacteria 1078
123 Ga0439457_030755 3300042014 Bacteria 1190
124 Ga0439457_062852 3300042014 Bacteria 842
125 Ga0439462_0156921 3300042015 Bacteria 641
126 Ga0450920_000578 3300042122 Bacteria 5852
127 Ga0450907_000741 3300042146 Bacteria 8326
128 Ga0450908_046197 3300042184 Bacteria 756
129 Ga0439434_0000589 3300042435 Bacteria 10481
130 Ga0450918_002198 3300042531 Bacteria 3714
131 Ga0495639_0006850 3300046475 Bacteria 4898
132 Ga0495662_0136511 3300046476 Bacteria 1206
133 Ga0495664_0207936 3300046477 Bacteria 1185
134 Ga0495594_0099511 3300046499 Bacteria 1635
135 Ga0495594_0119057 3300046499 Bacteria 1492
136 Ga0495630_0170838 3300046517 Bacteria 1656
137 Ga0495631_0072345 3300046518 Bacteria 1489
138 Ga0495643_0217992 3300046522 Bacteria 907
139 Ga0495644_0143395 3300046523 Bacteria 913
140 Ga0495665_0002444 3300046531 Bacteria 10031
141 Ga0495586_0014982 3300046535 Bacteria 4120
142 Ga0495586_0052237 3300046535 Bacteria 2212
143 Ga0495587_0033428 3300046536 Bacteria 3105
144 Ga0495645_0026096 3300046543 Bacteria 4240
145 Ga0495633_0050995 3300046558 Bacteria 1950
146 Ga0495667_0026277 3300046559 Bacteria 3922
147 Ga0495656_0004102 3300046615 Bacteria 4962
148 Ga0495634_0425430 3300046642 Bacteria 786
149 Ga0495588_0004169 3300046674 Bacteria 6373
150 Ga0495588_0025402 3300046674 Bacteria 2951
151 Ga0495588_0030355 3300046674 Bacteria 2716
152 Ga0495588_0105554 3300046674 Bacteria 1482
153 Ga0495588_0280607 3300046674 Bacteria 878
154 Ga0495657_0127622 3300046675 Bacteria 1596
155 Ga0495623_0078514 3300046679 Bacteria 2046
156 Ga0495670_0004211 3300046691 Bacteria 7049
157 Ga0495581_0006000 3300047315 Bacteria 7040
158 Ga0495581_0017300 3300047315 Bacteria 4187
159 Ga0495636_0007839 3300047318 Bacteria 4204
160 Ga0495636_0336525 3300047318 Bacteria 711
161 Ga0495674_0682709 3300047319 Bacteria 807
162 Ga0495675_0021418 3300047444 Bacteria 4115
163 Ga0495681_0193689 3300047470 Bacteria 828
164 Ga0495684_0341256 3300047471 Bacteria 1066
165 Ga0495593_0216718 3300047673 Bacteria 961
166 Ga0495615_0044840 3300048090 Bacteria 1118
167 Ga0496100_0056863 3300048903 Bacteria 2560
168 Ga0496100_0290920 3300048903 Bacteria 1220
169 Ga0496101_0094294 3300048904 Bacteria 2230
170 Ga0496101_0186455 3300048904 Bacteria 1599
171 Ga0496102_0162056 3300048905 Bacteria 2104
172 Ga0496102_0203611 3300048905 Bacteria 1865
173 Ga0496102_0258293 3300048905 Bacteria 1642
174 Ga0496103_0047324 3300048906 Bacteria 2657
175 Ga0496103_0130670 3300048906 Bacteria 1603
176 Ga0496104_1006146 3300048907 Bacteria 737
177 Ga0496105_0156652 3300048908 Bacteria 1870
178 Ga0496105_0254588 3300048908 Bacteria 1421
179 Ga0496106_0336257 3300048909 Bacteria 1212
180 Ga0496107_0062779 3300048910 Bacteria 2691
181 Ga0496107_0140847 3300048910 Bacteria 1782
182 Ga0496107_0237753 3300048910 Bacteria 1355
183 Ga0496107_0680228 3300048910 Bacteria 757
184 Ga0496108_0063921 3300048911 Bacteria 3099
185 Ga0496109_0308201 3300048912 Bacteria 1493
186 Ga0496109_0966419 3300048912 Bacteria 789
187 Ga0496110_0176250 3300048913 Bacteria 1940
188 Ga0496111_0028938 3300048914 Bacteria 3929
189 Ga0496111_0142616 3300048914 Bacteria 1775
190 Ga0496112_0197477 3300048915 Bacteria 1972
191 Ga0496113_0410469 3300048916 Bacteria 1087
192 Ga0496114_0156485 3300048917 Bacteria 1979
193 Ga0496114_0347069 3300048917 Bacteria 1312
194 Ga0496118_0185339 3300048921 Bacteria 1252
195 Ga0496124_0078025 3300048927 Bacteria 2730
196 Ga0496125_0070799 3300048928 Bacteria 2728
197 Ga0501032_0009538 3300049569 Bacteria 7036
198 Ga0501037_0038690 3300049573 Bacteria 3513
199 Ga0501037_0105686 3300049573 Bacteria 2029
200 Ga0501038_0317484 3300049574 Bacteria 1219
201 Ga0501279_002552 3300049775 Bacteria 2385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042015 Ga0439462_0156921 Ga0439462_0156921_15_599 194
2 3300031903 Ga0307407_10490344 Ga0307407_104903441 195
3 iso_pu_bacteria 2910809715 2910811235 200
4 iso_pu_bacteria 2844852863 2844853968 207
5 iso_pu_bacteria 2808606366 2808875860 208
6 iso_pu_bacteria 2808606371 2808895682 208
7 3300048912 Ga0496109_0966419 Ga0496109_0966419_79_729 209
8 3300048916 Ga0496113_0410469 Ga0496113_0410469_356_1006 209
9 3300028558 Ga0265326_10116580 Ga0265326_101165801 210
10 3300028563 Ga0265319_1048315 Ga0265319_10483152 210
11 iso_pu_bacteria 2857740372 2857740491 210
12 iso_pu_bacteria 2904497146 2904499368 210
13 iso_pu_bacteria 2904776348 2904778471 210
14 iso_pu_bacteria 2919034639 2919035828 210
15 iso_pu_bacteria 2919538618 2919538961 210
16 iso_pu_bacteria 2932426870 2932427542 210
17 iso_pu_bacteria 2933418574 2933418869 210
18 iso_pu_bacteria 2939647034 2939648199 210
19 iso_pu_bacteria 2939674588 2939677123 210
20 iso_pu_bacteria 8054107350 8054109919 210
21 iso_pu_bacteria 8056037122 8056040208 210
22 iso_pu_bacteria 2690315906 2691513222 211
23 iso_pu_bacteria 2775506735 2775656417 211
24 iso_pu_bacteria 2808606357 2808830467 211
25 iso_pu_bacteria 2808606360 2808851660 211
26 iso_pu_bacteria 2808606370 2808894729 211
27 iso_pu_bacteria 2811994871 2812317777 211
28 iso_pu_bacteria 2939598168 2939599776 211
29 iso_pu_bacteria 2945916053 2945919845 211
30 iso_pu_bacteria 2945920336 2945924253 211
31 iso_pu_bacteria 2945941187 2945944028 211
32 iso_pu_bacteria 2946037020 2946039984 211
33 iso_pu_bacteria 2946059875 2946063571 211
34 iso_pu_bacteria 2953998280 2954001213 211
35 iso_pu_bacteria 2974302888 2974303480 211
36 3300037312 Ga0395899_0048229 Ga0395899_0048229_1153_1791 212
37 3300037418 Ga0395900_0032526 Ga0395900_0032526_962_1600 212
38 3300037466 Ga0395898_0144015 Ga0395898_0144015_444_1082 212
39 3300037466 Ga0395898_0322957 Ga0395898_0322957_434_1072 212
40 3300038443 Ga0395901_0328244 Ga0395901_0328244_659_1297 212
41 3300009036 Ga0105244_10032974 Ga0105244_100329742 214
42 3300009036 Ga0105244_10035243 Ga0105244_100352434 214
43 3300009147 Ga0114129_10541381 Ga0114129_105413812 214
44 3300011119 Ga0105246_10018575 Ga0105246_100185756 214
45 3300011119 Ga0105246_10268767 Ga0105246_102687672 214
46 3300013105 Ga0157369_11182705 Ga0157369_111827051 214
47 3300025303 Ga0209051_1002951 Ga0209051_100295112 214
48 3300025315 Ga0207697_10006509 Ga0207697_100065094 214
49 3300025728 Ga0207655_1012726 Ga0207655_10127266 214
50 3300025728 Ga0207655_1048025 Ga0207655_10480252 214
51 3300027907 Ga0207428_10014333 Ga0207428_100143334 214
52 3300031548 Ga0307408_100016621 Ga0307408_1000166212 214
53 3300031731 Ga0307405_10062021 Ga0307405_100620213 214
54 3300031852 Ga0307410_10002887 Ga0307410_100028876 214
55 3300031852 Ga0307410_10505228 Ga0307410_105052281 214
56 3300031903 Ga0307407_10026785 Ga0307407_100267855 214
57 3300031903 Ga0307407_10416947 Ga0307407_104169472 214
58 3300031911 Ga0307412_10005640 Ga0307412_100056402 214
59 3300031911 Ga0307412_10095258 Ga0307412_100952582 214
60 3300031911 Ga0307412_10119074 Ga0307412_101190742 214
61 3300031911 Ga0307412_10146607 Ga0307412_101466072 214
62 3300031995 Ga0307409_100009788 Ga0307409_1000097886 214
63 3300031995 Ga0307409_100073598 Ga0307409_1000735984 214
64 3300041404 Ga0439436_0020719 Ga0439436_0020719_556_1200 214
65 3300041405 Ga0439438_025922 Ga0439438_025922_897_1541 214
66 3300041406 Ga0439439_0092291 Ga0439439_0092291_141_785 214
67 3300041413 Ga0439465_0096526 Ga0439465_0096526_36_680 214
68 3300041999 Ga0439433_0009449 Ga0439433_0009449_514_1158 214
69 3300048905 Ga0496102_0162056 Ga0496102_0162056_1260_1904 214
70 3300048915 Ga0496112_0197477 Ga0496112_0197477_261_905 214
71 3300003762 Ga0055542_1007163 Ga0055542_10071632 215
72 3300011119 Ga0105246_10008286 Ga0105246_100082864 215
73 3300013100 Ga0157373_10019526 Ga0157373_100195265 215
74 3300025254 Ga0209148_1004954 Ga0209148_10049542 215
75 3300025254 Ga0209148_1010181 Ga0209148_10101811 215
76 3300031548 Ga0307408_100063979 Ga0307408_1000639793 215
77 3300031548 Ga0307408_100091481 Ga0307408_1000914811 215
78 3300031548 Ga0307408_100302417 Ga0307408_1003024172 215
79 3300031548 Ga0307408_100472247 Ga0307408_1004722471 215
80 3300031548 Ga0307408_100519313 Ga0307408_1005193131 215
81 3300031548 Ga0307408_100529392 Ga0307408_1005293922 215
82 3300031731 Ga0307405_10007255 Ga0307405_100072552 215
83 3300031731 Ga0307405_10136335 Ga0307405_101363352 215
84 3300031731 Ga0307405_10165353 Ga0307405_101653532 215
85 3300031731 Ga0307405_10248412 Ga0307405_102484122 215
86 3300031824 Ga0307413_10035078 Ga0307413_100350783 215
87 3300031824 Ga0307413_10041577 Ga0307413_100415771 215
88 3300031824 Ga0307413_10339152 Ga0307413_103391522 215
89 3300031824 Ga0307413_10398388 Ga0307413_103983881 215
90 3300031852 Ga0307410_10016418 Ga0307410_100164184 215
91 3300031901 Ga0307406_10056948 Ga0307406_100569483 215
92 3300031901 Ga0307406_10060247 Ga0307406_100602473 215
93 3300031903 Ga0307407_10036126 Ga0307407_100361262 215
94 3300031903 Ga0307407_10442584 Ga0307407_104425841 215
95 3300031911 Ga0307412_10074104 Ga0307412_100741043 215
96 3300031911 Ga0307412_10075879 Ga0307412_100758792 215
97 3300031911 Ga0307412_10247067 Ga0307412_102470672 215
98 3300031911 Ga0307412_10335304 Ga0307412_103353041 215
99 3300031911 Ga0307412_10507314 Ga0307412_105073142 215
100 3300031995 Ga0307409_100059696 Ga0307409_1000596962 215
101 3300031995 Ga0307409_100130419 Ga0307409_1001304193 215
102 3300032002 Ga0307416_100108144 Ga0307416_1001081444 215
103 3300032002 Ga0307416_100140198 Ga0307416_1001401982 215
104 3300032002 Ga0307416_100164528 Ga0307416_1001645282 215
105 3300032002 Ga0307416_100180343 Ga0307416_1001803432 215
106 3300032004 Ga0307414_10877018 Ga0307414_108770181 215
107 3300032005 Ga0307411_10007938 Ga0307411_100079382 215
108 3300032005 Ga0307411_10176050 Ga0307411_101760502 215
109 3300032126 Ga0307415_100669286 Ga0307415_1006692861 215
110 3300041404 Ga0439436_0074182 Ga0439436_0074182_74_721 215
111 3300041406 Ga0439439_0102639 Ga0439439_0102639_129_776 215
112 3300042002 Ga0439442_000021 Ga0439442_000021_40519_41166 215
113 3300042014 Ga0439457_062852 Ga0439457_062852_162_809 215
114 3300042184 Ga0450908_046197 Ga0450908_046197_38_685 215
115 3300049569 Ga0501032_0009538 Ga0501032_0009538_2593_3240 215
116 3300049573 Ga0501037_0038690 Ga0501037_0038690_2732_3379 215
117 3300049573 Ga0501037_0105686 Ga0501037_0105686_1352_1999 215
118 3300049574 Ga0501038_0317484 Ga0501038_0317484_542_1189 215
119 3300049775 Ga0501279_002552 Ga0501279_002552_88_735 215
120 3300003578 Ga0006562J51391_1006668 Ga0006562J51391_10066683 216
121 3300005288 Ga0065714_10145238 Ga0065714_101452381 216
122 3300005328 Ga0070676_10141827 Ga0070676_101418272 216
123 3300005331 Ga0070670_100348579 Ga0070670_1003485792 216
124 3300005333 Ga0070677_10011293 Ga0070677_100112934 216
125 3300005335 Ga0070666_10085379 Ga0070666_100853793 216
126 3300005353 Ga0070669_100024199 Ga0070669_1000241991 216
127 3300005356 Ga0070674_100027323 Ga0070674_1000273231 216
128 3300005364 Ga0070673_100069788 Ga0070673_1000697881 216
129 3300005543 Ga0070672_100213061 Ga0070672_1002130612 216
130 3300006178 Ga0075367_10189847 Ga0075367_101898471 216
131 3300009011 Ga0105251_10108377 Ga0105251_101083772 216
132 3300009036 Ga0105244_10042993 Ga0105244_100429931 216
133 3300009036 Ga0105244_10045871 Ga0105244_100458713 216
134 3300009036 Ga0105244_10081433 Ga0105244_100814332 216
135 3300009148 Ga0105243_10101497 Ga0105243_101014973 216
136 3300009176 Ga0105242_10349834 Ga0105242_103498341 216
137 3300009177 Ga0105248_10680241 Ga0105248_106802412 216
138 3300011119 Ga0105246_10605504 Ga0105246_106055041 216
139 3300013306 Ga0163162_10060835 Ga0163162_100608352 216
140 3300013306 Ga0163162_11045091 Ga0163162_110450911 216
141 3300013308 Ga0157375_10018471 Ga0157375_100184714 216
142 3300013308 Ga0157375_10544683 Ga0157375_105446831 216
143 3300025315 Ga0207697_10006481 Ga0207697_100064814 216
144 3300025728 Ga0207655_1074302 Ga0207655_10743023 216
145 3300025907 Ga0207645_10183670 Ga0207645_101836702 216
146 3300025923 Ga0207681_10257695 Ga0207681_102576951 216
147 3300025925 Ga0207650_10176168 Ga0207650_101761682 216
148 3300025940 Ga0207691_10000200 Ga0207691_100002007 216
149 3300025941 Ga0207711_10298040 Ga0207711_102980402 216
150 3300026121 Ga0207683_10002731 Ga0207683_1000273114 216
151 3300031548 Ga0307408_100040278 Ga0307408_1000402781 216
152 3300031548 Ga0307408_100303436 Ga0307408_1003034362 216
153 3300031731 Ga0307405_10084191 Ga0307405_100841912 216
154 3300031901 Ga0307406_10342894 Ga0307406_103428941 216
155 3300031911 Ga0307412_10380536 Ga0307412_103805361 216
156 3300031911 Ga0307412_10520524 Ga0307412_105205242 216
157 3300032002 Ga0307416_100029509 Ga0307416_1000295092 216
158 3300032002 Ga0307416_100116557 Ga0307416_1001165574 216
159 3300041404 Ga0439436_0051290 Ga0439436_0051290_339_1013 216
160 3300041452 Ga0451793_1118708 Ga0451793_1118708_64_726 216
161 3300041999 Ga0439433_0009171 Ga0439433_0009171_37_711 216
162 3300042002 Ga0439442_000524 Ga0439442_000524_3312_4001 216
163 3300042007 Ga0439449_0098824 Ga0439449_0098824_249_923 216
164 3300042014 Ga0439457_030755 Ga0439457_030755_133_807 216
165 3300042122 Ga0450920_000578 Ga0450920_000578_391_1080 216
166 3300042146 Ga0450907_000741 Ga0450907_000741_3937_4626 216
167 3300042435 Ga0439434_0000589 Ga0439434_0000589_3751_4440 216
168 3300042531 Ga0450918_002198 Ga0450918_002198_1628_2317 216
169 3300046475 Ga0495639_0006850 Ga0495639_0006850_158_808 216
170 3300046476 Ga0495662_0136511 Ga0495662_0136511_323_973 216
171 3300046477 Ga0495664_0207936 Ga0495664_0207936_464_1114 216
172 3300046499 Ga0495594_0099511 Ga0495594_0099511_943_1593 216
173 3300046499 Ga0495594_0119057 Ga0495594_0119057_588_1238 216
174 3300046517 Ga0495630_0170838 Ga0495630_0170838_825_1475 216
175 3300046518 Ga0495631_0072345 Ga0495631_0072345_458_1108 216
176 3300046522 Ga0495643_0217992 Ga0495643_0217992_161_811 216
177 3300046523 Ga0495644_0143395 Ga0495644_0143395_244_894 216
178 3300046531 Ga0495665_0002444 Ga0495665_0002444_77_727 216
179 3300046535 Ga0495586_0014982 Ga0495586_0014982_1178_1828 216
180 3300046535 Ga0495586_0052237 Ga0495586_0052237_1348_1998 216
181 3300046536 Ga0495587_0033428 Ga0495587_0033428_2087_2737 216
182 3300046543 Ga0495645_0026096 Ga0495645_0026096_1935_2585 216
183 3300046558 Ga0495633_0050995 Ga0495633_0050995_1218_1868 216
184 3300046559 Ga0495667_0026277 Ga0495667_0026277_1928_2578 216
185 3300046615 Ga0495656_0004102 Ga0495656_0004102_424_1074 216
186 3300046642 Ga0495634_0425430 Ga0495634_0425430_69_719 216
187 3300046674 Ga0495588_0004169 Ga0495588_0004169_327_977 216
188 3300046674 Ga0495588_0025402 Ga0495588_0025402_1260_1910 216
189 3300046674 Ga0495588_0030355 Ga0495588_0030355_352_1002 216
190 3300046674 Ga0495588_0105554 Ga0495588_0105554_321_971 216
191 3300046674 Ga0495588_0280607 Ga0495588_0280607_68_718 216
192 3300046675 Ga0495657_0127622 Ga0495657_0127622_560_1210 216
193 3300046679 Ga0495623_0078514 Ga0495623_0078514_1194_1844 216
194 3300046691 Ga0495670_0004211 Ga0495670_0004211_3435_4085 216
195 3300047315 Ga0495581_0006000 Ga0495581_0006000_1879_2529 216
196 3300047315 Ga0495581_0017300 Ga0495581_0017300_1175_1825 216
197 3300047318 Ga0495636_0007839 Ga0495636_0007839_1420_2070 216
198 3300047318 Ga0495636_0336525 Ga0495636_0336525_50_700 216
199 3300047319 Ga0495674_0682709 Ga0495674_0682709_106_756 216
200 3300047444 Ga0495675_0021418 Ga0495675_0021418_2236_2886 216
201 3300047470 Ga0495681_0193689 Ga0495681_0193689_115_765 216
202 3300047471 Ga0495684_0341256 Ga0495684_0341256_308_958 216
203 3300047673 Ga0495593_0216718 Ga0495593_0216718_104_754 216
204 3300048090 Ga0495615_0044840 Ga0495615_0044840_87_737 216
205 3300048903 Ga0496100_0056863 Ga0496100_0056863_174_824 216
206 3300048903 Ga0496100_0290920 Ga0496100_0290920_35_685 216
207 3300048904 Ga0496101_0094294 Ga0496101_0094294_351_1001 216
208 3300048904 Ga0496101_0186455 Ga0496101_0186455_769_1419 216
209 3300048905 Ga0496102_0203611 Ga0496102_0203611_332_982 216
210 3300048905 Ga0496102_0258293 Ga0496102_0258293_750_1400 216
211 3300048906 Ga0496103_0047324 Ga0496103_0047324_110_760 216
212 3300048906 Ga0496103_0130670 Ga0496103_0130670_26_676 216
213 3300048907 Ga0496104_1006146 Ga0496104_1006146_35_685 216
214 3300048908 Ga0496105_0156652 Ga0496105_0156652_247_897 216
215 3300048908 Ga0496105_0254588 Ga0496105_0254588_486_1136 216
216 3300048909 Ga0496106_0336257 Ga0496106_0336257_239_889 216
217 3300048910 Ga0496107_0062779 Ga0496107_0062779_471_1121 216
218 3300048910 Ga0496107_0140847 Ga0496107_0140847_286_936 216
219 3300048910 Ga0496107_0237753 Ga0496107_0237753_94_744 216
220 3300048910 Ga0496107_0680228 Ga0496107_0680228_13_663 216
221 3300048911 Ga0496108_0063921 Ga0496108_0063921_1476_2126 216
222 3300048912 Ga0496109_0308201 Ga0496109_0308201_558_1208 216
223 3300048913 Ga0496110_0176250 Ga0496110_0176250_318_968 216
224 3300048914 Ga0496111_0028938 Ga0496111_0028938_1009_1659 216
225 3300048914 Ga0496111_0142616 Ga0496111_0142616_667_1317 216
226 3300048917 Ga0496114_0156485 Ga0496114_0156485_126_776 216
227 3300048917 Ga0496114_0347069 Ga0496114_0347069_37_687 216
228 3300048921 Ga0496118_0185339 Ga0496118_0185339_26_676 216
229 3300048927 Ga0496124_0078025 Ga0496124_0078025_1817_2467 216
230 3300048928 Ga0496125_0070799 Ga0496125_0070799_1515_2165 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

19

167

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vzz-assembly1.cif.gz_D crystal structure of rv0802c from mycobacterium tuberculosis in complex with succinyl-coa 0.9666 6 211
2vzy-assembly1.cif.gz_C crystal structure of rv0802c from mycobacterium tuberculosis in an unliganded form. 0.9609 6 213
2vzy-assembly1.cif.gz_C crystal structure of rv0802c from mycobacterium tuberculosis in an unliganded form. 0.951 6 213
2vzy-assembly1.cif.gz_D crystal structure of rv0802c from mycobacterium tuberculosis in an unliganded form. 0.9495 6 211
2vzz-assembly1.cif.gz_D crystal structure of rv0802c from mycobacterium tuberculosis in complex with succinyl-coa 0.9443 6 211
ID Description Score Start End Superfamily
2vzyB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9627 6 213 3.40.630.30
2vzyB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9529 6 213 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9303 124 191 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8894 144 189 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8597 124 191 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7V8Y135-F1-model_v4 GNAT family N-acetyltransferase 0.9815 106 213 GO:0005737
GO:0008999
GO:1990189
AF-A0A849AEU3-F1-model_v4 GNAT family N-acetyltransferase 0.9793 2 216 GO:0005737
GO:0008999
GO:1990189
AF-A0A4P7C7A4-F1-model_v4 deleted 0.9756 3 150
AF-A0A849AEU3-F1-model_v4 GNAT family N-acetyltransferase 0.9704 2 216 GO:0005737
GO:0008999
GO:1990189
AF-A0A0D7CIX1-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9701 67 215 GO:0016747

Feature Viewer

pLDDT pTM Quality
94.26 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map