F343146

General Info

Members Datasets Scaffolds Average Seq Length
230 193 207 374

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10037552|Ga0265320_100375521
Length 430
Sequence MGSLHARAAGACYHAQSPHLRGRSCVWTGRSAVRRTHKVFSGSPMNPLKLGMVGGGQGAFIGAVHRMAATLDGCWAVAAGALSSTPEKSLVSARELGLAADRSYGTWREMLARESARPAGHRIDAVSIVTPNSTHFEIALASVEAGFHVICDKPLVVSSSQAEALAVAVEKAGGVFGVTYNYTGYPMVKQAAAMVRGGEIGKIRKVFVEYHQGWLAGKLEATGQKQAAWRHDPALAGAGGAIGDIGSHAENLVATVTGLEIESLAADLTSFVPGRTLDDDASVLLRFKGRDGEGAKGVLTATQIAVGEQNNLTLRVHGETGSLAWRQEEPNTLTWCKGDGSMQILNRAGAGLHLSAAGATRLPPGHPEAFIEAFANIYRGVAQAIRAQRAGTTPSGLGAEFPSVWDGARGVRFIERVVQSSRANGKWTAM

Samples

Sample ID Description Type Environment
1 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2643221733 Bosea sp. Root381 Isolate Unclassified
4 2643221734 Bosea sp. Root670 Isolate Unclassified
5 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
6 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
7 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
8 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
9 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
10 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
11 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
12 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
13 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
14 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
15 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
16 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
17 2932401849 Devosia sp. 2618 Isolate Rhizosphere
18 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
19 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
126 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
181 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
182 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
183 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
184 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
185 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
186 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
189 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
190 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 640753048 Serratia proteamaculans 568 Isolate Endosphere
193 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.17
Nodule 0.43
Rhizoplane 0.87
Rhizosphere 75.22
Stem 0
Stem Tuber 0
Unclassified 11.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000122 3300003187 Bacteria 106087
2 JGI25406J46586_10000039 3300003203 Bacteria 59006
3 Ga0055526_1000151 3300003771 Bacteria 61441
4 Ga0055526_1000495 3300003771 Bacteria 31316
5 Ga0055524_1000136 3300003775 Bacteria 87249
6 Ga0055534_1010922 3300003784 Bacteria 1872
7 Ga0070658_10063513 3300005327 Bacteria 3010
8 Ga0070670_100048660 3300005331 Bacteria 3647
9 Ga0068869_100046657 3300005334 Bacteria 3124
10 Ga0070666_10018761 3300005335 Bacteria 4454
11 Ga0070682_100091524 3300005337 Bacteria 1991
12 Ga0070660_100005933 3300005339 Bacteria 8448
13 Ga0070661_100002905 3300005344 Bacteria 11802
14 Ga0070675_100024830 3300005354 Bacteria 4801
15 Ga0070673_100183853 3300005364 Bacteria 1791
16 Ga0070667_100129388 3300005367 Bacteria 2202
17 Ga0070703_10025470 3300005406 Bacteria 1755
18 Ga0070701_10001929 3300005438 Bacteria 7856
19 Ga0070700_100035529 3300005441 Bacteria 3016
20 Ga0070694_100027248 3300005444 Bacteria 3710
21 Ga0068867_100073702 3300005459 Bacteria 2557
22 Ga0070684_100254232 3300005535 Bacteria 1606
23 Ga0068853_100007172 3300005539 Bacteria 8922
24 Ga0068853_100048240 3300005539 Bacteria 3658
25 Ga0070672_100167458 3300005543 Bacteria 1826
26 Ga0070672_100177510 3300005543 Bacteria 1774
27 Ga0070686_100037510 3300005544 Bacteria 3007
28 Ga0070665_100061652 3300005548 Bacteria 3760
29 Ga0070704_100008721 3300005549 Bacteria 6099
30 Ga0068855_100161481 3300005563 Bacteria 2543
31 Ga0068857_100276674 3300005577 Bacteria 1543
32 Ga0068854_100116241 3300005578 Bacteria 2024
33 Ga0068856_100034527 3300005614 Bacteria 4954
34 Ga0068852_100007547 3300005616 Bacteria 7943
35 Ga0068859_100054510 3300005617 Bacteria 4022
36 Ga0068859_100105354 3300005617 Bacteria 2879
37 Ga0068851_10000846 3300005834 Bacteria 13180
38 Ga0068858_100080635 3300005842 Bacteria 3024
39 Ga0068860_100087214 3300005843 Bacteria 2971
40 Ga0068862_100110384 3300005844 Bacteria 2413
41 Ga0081455_10000368 3300005937 Bacteria 59452
42 Ga0081539_10000169 3300005985 Bacteria 153327
43 Ga0075366_10041195 3300006195 Bacteria 2734
44 Ga0097621_100203504 3300006237 Bacteria 1720
45 Ga0075428_100001349 3300006844 Bacteria 26041
46 Ga0075433_10041457 3300006852 Bacteria 3989
47 Ga0097620_100054509 3300006931 Bacteria 4022
48 Ga0097620_100105350 3300006931 Bacteria 2879
49 Ga0079104_1004003 3300006946 Bacteria 6539
50 Ga0105251_10001025 3300009011 Bacteria 24527
51 Ga0105244_10002461 3300009036 Bacteria 13945
52 Ga0105250_10078114 3300009092 Bacteria 1340
53 Ga0105240_10020972 3300009093 Bacteria 8697
54 Ga0111539_10042078 3300009094 Bacteria 5489
55 Ga0114129_10078454 3300009147 Bacteria 4593
56 Ga0105243_10067869 3300009148 Bacteria 2872
57 Ga0105237_10000735 3300009545 Bacteria 45164
58 Ga0105238_10016319 3300009551 Bacteria 7516
59 Ga0105249_10133969 3300009553 Bacteria 2369
60 Ga0105239_10001013 3300010375 Bacteria 39266
61 Ga0171462_1011 3300013250 Bacteria 229282
62 Ga0157374_10022022 3300013296 Bacteria 5679
63 Ga0157378_10413145 3300013297 Bacteria 1332
64 Ga0163162_10103826 3300013306 Bacteria 2936
65 Ga0157375_10038742 3300013308 Bacteria 4579
66 Ga0157380_10002665 3300014326 Bacteria 12104
67 Ga0157380_10113169 3300014326 Bacteria 2284
68 Ga0182008_10000041 3300014497 Bacteria 118254
69 Ga0163161_10081982 3300017792 Bacteria 2376
70 Ga0163161_10140422 3300017792 Bacteria 1829
71 Ga0209233_1000675 3300025261 Bacteria 16414
72 Ga0209675_1003055 3300025291 Bacteria 8205
73 Ga0209025_1000014 3300025294 Bacteria 865448
74 Ga0209564_1000074 3300025295 Bacteria 286043
75 Ga0209564_1000077 3300025295 Bacteria 281592
76 Ga0209256_1000057 3300025299 Bacteria 281592
77 Ga0209256_1000109 3300025299 Bacteria 184928
78 Ga0207655_1000106 3300025728 Bacteria 181416
79 Ga0207713_1001081 3300025735 Bacteria 23431
80 Ga0207680_10016356 3300025903 Bacteria 3893
81 Ga0207643_10090073 3300025908 Bacteria 1788
82 Ga0207705_10007498 3300025909 Bacteria 8017
83 Ga0207671_10000367 3300025914 Bacteria 64385
84 Ga0207660_10039044 3300025917 Bacteria 3317
85 Ga0207657_10002181 3300025919 Bacteria 21210
86 Ga0207649_10001929 3300025920 Bacteria 11827
87 Ga0207681_10250798 3300025923 Bacteria 1382
88 Ga0207650_10171510 3300025925 Bacteria 1724
89 Ga0207691_10099027 3300025940 Bacteria 2604
90 Ga0207711_10121827 3300025941 Bacteria 2329
91 Ga0207689_10196883 3300025942 Bacteria 1663
92 Ga0207667_10006031 3300025949 Bacteria 14745
93 Ga0207667_10164937 3300025949 Bacteria 2278
94 Ga0207640_10060972 3300025981 Bacteria 2496
95 Ga0207677_10189986 3300026023 Bacteria 1623
96 Ga0207639_10001242 3300026041 Bacteria 17273
97 Ga0207639_10001485 3300026041 Bacteria 15773
98 Ga0207708_10009005 3300026075 Bacteria 7389
99 Ga0207708_10048661 3300026075 Bacteria 3228
100 Ga0207702_10023039 3300026078 Bacteria 5165
101 Ga0207648_10048811 3300026089 Bacteria 3705
102 Ga0207648_10178906 3300026089 Bacteria 1877
103 Ga0207674_10342873 3300026116 Bacteria 1445
104 Ga0207675_100094686 3300026118 Bacteria 2809
105 Ga0207675_100105536 3300026118 Bacteria 2656
106 Ga0207683_10013471 3300026121 Bacteria 6976
107 Ga0207683_10077818 3300026121 Bacteria 2938
108 Ga0207698_10017609 3300026142 Bacteria 4854
109 Ga0268265_10035947 3300028380 Bacteria 3624
110 Ga0268264_10069733 3300028381 Bacteria 2974
111 Ga0265318_10006161 3300028577 Bacteria 5552
112 Ga0307515_10041055 3300028794 Bacteria 7291
113 Ga0307515_10080842 3300028794 Bacteria 4230
114 Ga0307515_10088349 3300028794 Bacteria 3918
115 Ga0307515_10131841 3300028794 Bacteria 2746
116 Ga0265338_10011307 3300028800 Bacteria 10330
117 Ga0265320_10037552 3300031240 Bacteria 2439
118 Ga0265340_10000518 3300031247 Bacteria 21218
119 Ga0265340_10055397 3300031247 Bacteria 1910
120 Ga0265327_10031263 3300031251 Bacteria 2994
121 Ga0307513_10011998 3300031456 Bacteria 10729
122 Ga0307513_10015242 3300031456 Bacteria 9329
123 Ga0307513_10115125 3300031456 Bacteria 2672
124 Ga0307513_10156057 3300031456 Bacteria 2182
125 Ga0307509_10120414 3300031507 Bacteria 2603
126 Ga0307408_100023208 3300031548 Bacteria 4224
127 Ga0307508_10000134 3300031616 Bacteria 87501
128 Ga0307514_10165986 3300031649 Bacteria 1452
129 Ga0316575_10007357 3300031665 Bacteria 3984
130 Ga0307516_10000286 3300031730 Bacteria 65447
131 Ga0307516_10002748 3300031730 Bacteria 23188
132 Ga0307405_10141400 3300031731 Bacteria 1679
133 Ga0307413_10121213 3300031824 Bacteria 1772
134 Ga0307406_10076447 3300031901 Bacteria 2212
135 Ga0307409_100033100 3300031995 Bacteria 3757
136 Ga0307409_100389821 3300031995 Bacteria 1327
137 Ga0307415_100210467 3300032126 Bacteria 1551
138 Ga0307510_10199414 3300033180 Bacteria 1538
139 Ga0373937_0324095 3300036401 Bacteria 1458
140 Ga0395899_0013623 3300037312 Bacteria 6217
141 Ga0439436_0016817 3300041404 Bacteria 2192
142 Ga0466965_0144525 3300044683 Bacteria 1240
143 Ga0453684_0139810 3300044712 Bacteria 2894
144 Ga0451576_0203294 3300045051 Bacteria 2069
145 Ga0495629_0287653 3300046459 Bacteria 1127
146 Ga0495664_0103513 3300046477 Bacteria 1716
147 Ga0495585_0123978 3300046492 Bacteria 1365
148 Ga0495610_0036824 3300046512 Bacteria 2497
149 Ga0495610_0053162 3300046512 Bacteria 1963
150 Ga0495620_0032019 3300046515 Bacteria 2401
151 Ga0495630_0117190 3300046517 Bacteria 2019
152 Ga0495631_0020443 3300046518 Bacteria 3093
153 Ga0495632_0015232 3300046519 Bacteria 4322
154 Ga0495643_0061204 3300046522 Bacteria 1997
155 Ga0495648_0038997 3300046524 Bacteria 3029
156 Ga0495663_0004235 3300046525 Bacteria 4048
157 Ga0495609_0025907 3300046538 Bacteria 2686
158 Ga0495597_0015577 3300046542 Bacteria 3598
159 Ga0495645_0192473 3300046543 Bacteria 1389
160 Ga0495622_0025109 3300046557 Bacteria 2784
161 Ga0495633_0032321 3300046558 Bacteria 2529
162 Ga0495668_0030345 3300046616 Bacteria 3052
163 Ga0495625_0006546 3300046660 Bacteria 10346
164 Ga0495671_0038950 3300046692 Bacteria 2401
165 Ga0495649_0133663 3300046694 Bacteria 1308
166 Ga0495589_0000010 3300046794 Bacteria 250407
167 Ga0495589_0022512 3300046794 Bacteria 3215
168 Ga0496110_0045089 3300048913 Bacteria 3852
169 Ga0496111_0143189 3300048914 Bacteria 1771
170 Ga0496117_0020507 3300048920 Bacteria 5385
171 Ga0496117_0042549 3300048920 Bacteria 3313
172 Ga0496123_0081016 3300048926 Bacteria 1975
173 Ga0496125_0103631 3300048928 Bacteria 2087
174 Ga0501034_0043088 3300049571 Bacteria 4568
175 Ga0501034_0081434 3300049571 Bacteria 3240
176 Ga0501034_0143546 3300049571 Bacteria 2366
177 Ga0501034_0308614 3300049571 Bacteria 1517
178 Ga0501036_0281855 3300049572 Bacteria 1391
179 Ga0501043_0154233 3300049579 Bacteria 1797
180 Ga0501073_0004525 3300049589 Bacteria 10454
181 Ga0501073_0198805 3300049589 Bacteria 1386
182 Ga0501225_0008334 3300049705 Bacteria 2977
183 Ga0501083_0007061 3300049744 Bacteria 7971
184 Ga0501083_0009860 3300049744 Bacteria 6743
185 Ga0501035_0158443 3300049822 Bacteria 1961
186 Ga0501044_0337176 3300049823 Bacteria 1429
187 Ga0501044_0384258 3300049823 Bacteria 1319
188 nmdc:mga0k408_49597_c1 3300050493 Bacteria 2430
189 nmdc:mga07m45_53654_c1 3300050496 Bacteria 2278
190 nmdc:mga07m45_58345_c1 3300050496 Bacteria 2184
191 nmdc:mga05p37_119621_c1 3300050507 Bacteria 3236
192 nmdc:mga08y16_101832_c1 3300050511 Bacteria 2990
193 nmdc:mga0rr50_80094_c1 3300050513 Bacteria 2517
194 nmdc:mga0a205_104957_c1 3300050515 Bacteria 2725
195 nmdc:mga0sz30_50818_c1 3300050516 Bacteria 1758
196 Ga0495655_0004109 3300053083 Bacteria 2465
197 Ga0500644_0041235 3300053088 Bacteria 1532
198 Ga0500646_0017724 3300053090 Bacteria 1870
199 Ga0500658_0069227 3300053134 Bacteria 1485
200 Ga0500573_0030598 3300053140 Bacteria 3104
201 Ga0500577_0023335 3300053142 Bacteria 2066
202 Ga0500616_0000414 3300053153 Bacteria 57594
203 Ga0500616_0047142 3300053153 Bacteria 2289
204 Ga0500622_0129226 3300053156 Bacteria 1216
205 Ga0500633_0059562 3300053160 Bacteria 1340
206 Ga0500587_000164 3300053739 Bacteria 6551
207 Ga0501084_0150031 3300054114 Bacteria 1964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10141400 Ga0307405_101414002 296
2 3300006852 Ga0075433_10041457 Ga0075433_100414573 346
3 3300050515 nmdc:mga0a205_104957_c1 nmdc:mga0a205_104957_c1_940_2079 346
4 3300031995 Ga0307409_100389821 Ga0307409_1003898211 347
5 3300013306 Ga0163162_10103826 Ga0163162_101038262 348
6 3300006195 Ga0075366_10041195 Ga0075366_100411952 349
7 3300050493 nmdc:mga0k408_49597_c1 nmdc:mga0k408_49597_c1_349_1506 349
8 3300046512 Ga0495610_0036824 Ga0495610_0036824_1285_2406 350
9 3300046524 Ga0495648_0038997 Ga0495648_0038997_948_2069 350
10 3300046616 Ga0495668_0030345 Ga0495668_0030345_1578_2699 350
11 3300046692 Ga0495671_0038950 Ga0495671_0038950_821_1942 350
12 3300053083 Ga0495655_0004109 Ga0495655_0004109_86_1207 350
13 3300053134 Ga0500658_0069227 Ga0500658_0069227_416_1471 350
14 3300053160 Ga0500633_0059562 Ga0500633_0059562_205_1326 350
15 3300003203 JGI25406J46586_10000039 JGI25406J46586_1000003928 351
16 3300005985 Ga0081539_10000169 Ga0081539_1000016973 351
17 3300009148 Ga0105243_10067869 Ga0105243_100678692 351
18 3300046459 Ga0495629_0287653 Ga0495629_0287653_17_1117 351
19 3300046515 Ga0495620_0032019 Ga0495620_0032019_278_1399 351
20 3300046518 Ga0495631_0020443 Ga0495631_0020443_499_1620 351
21 3300046519 Ga0495632_0015232 Ga0495632_0015232_1526_2647 351
22 3300046522 Ga0495643_0061204 Ga0495643_0061204_409_1530 351
23 3300046525 Ga0495663_0004235 Ga0495663_0004235_1416_2537 351
24 3300046538 Ga0495609_0025907 Ga0495609_0025907_69_1190 351
25 3300046694 Ga0495649_0133663 Ga0495649_0133663_95_1216 351
26 3300046794 Ga0495589_0022512 Ga0495589_0022512_1288_2409 351
27 3300049571 Ga0501034_0308614 Ga0501034_0308614_337_1506 351
28 3300049823 Ga0501044_0337176 Ga0501044_0337176_183_1352 351
29 3300053090 Ga0500646_0017724 Ga0500646_0017724_366_1487 351
30 3300053142 Ga0500577_0023335 Ga0500577_0023335_311_1432 351
31 3300053156 Ga0500622_0129226 Ga0500622_0129226_26_1147 351
32 3300049589 Ga0501073_0198805 Ga0501073_0198805_191_1360 352
33 3300005459 Ga0068867_100073702 Ga0068867_1000737022 353
34 3300009092 Ga0105250_10078114 Ga0105250_100781141 353
35 3300009553 Ga0105249_10133969 Ga0105249_101339692 353
36 3300046557 Ga0495622_0025109 Ga0495622_0025109_1500_2621 353
37 3300046558 Ga0495633_0032321 Ga0495633_0032321_1378_2499 353
38 3300046477 Ga0495664_0103513 Ga0495664_0103513_433_1557 354
39 3300046517 Ga0495630_0117190 Ga0495630_0117190_286_1410 354
40 3300014326 Ga0157380_10002665 Ga0157380_1000266512 355
41 3300013297 Ga0157378_10413145 Ga0157378_104131451 357
42 3300017792 Ga0163161_10081982 Ga0163161_100819821 357
43 3300025925 Ga0207650_10171510 Ga0207650_101715102 357
44 3300025941 Ga0207711_10121827 Ga0207711_101218271 357
45 3300005344 Ga0070661_100002905 Ga0070661_1000029056 359
46 3300005406 Ga0070703_10025470 Ga0070703_100254702 359
47 3300005438 Ga0070701_10001929 Ga0070701_100019292 359
48 3300005441 Ga0070700_100035529 Ga0070700_1000355292 359
49 3300005444 Ga0070694_100027248 Ga0070694_1000272482 359
50 3300005549 Ga0070704_100008721 Ga0070704_1000087216 359
51 3300005617 Ga0068859_100054510 Ga0068859_1000545102 359
52 3300005844 Ga0068862_100110384 Ga0068862_1001103843 359
53 3300006931 Ga0097620_100054509 Ga0097620_1000545092 359
54 3300026075 Ga0207708_10009005 Ga0207708_100090056 359
55 3300026089 Ga0207648_10048811 Ga0207648_100488114 359
56 3300026118 Ga0207675_100105536 Ga0207675_1001055363 359
57 3300028380 Ga0268265_10035947 Ga0268265_100359472 359
58 3300025903 Ga0207680_10016356 Ga0207680_100163563 360
59 3300026075 Ga0207708_10048661 Ga0207708_100486612 360
60 3300026121 Ga0207683_10077818 Ga0207683_100778182 360
61 3300031456 Ga0307513_10115125 Ga0307513_101151252 360
62 3300031507 Ga0307509_10120414 Ga0307509_101204141 360
63 3300032126 Ga0307415_100210467 Ga0307415_1002104671 360
64 3300044683 Ga0466965_0144525 Ga0466965_0144525_17_1150 360
65 3300049823 Ga0501044_0384258 Ga0501044_0384258_15_1166 361
66 3300005335 Ga0070666_10018761 Ga0070666_100187613 362
67 3300025908 Ga0207643_10090073 Ga0207643_100900732 362
68 3300025917 Ga0207660_10039044 Ga0207660_100390442 362
69 3300025923 Ga0207681_10250798 Ga0207681_102507982 362
70 3300026089 Ga0207648_10178906 Ga0207648_101789062 362
71 3300026118 Ga0207675_100094686 Ga0207675_1000946862 362
72 3300033180 Ga0307510_10199414 Ga0307510_101994142 362
73 3300046542 Ga0495597_0015577 Ga0495597_0015577_1535_2656 362
74 3300045051 Ga0451576_0203294 Ga0451576_0203294_510_1634 363
75 iso_pu_bacteria 2899275550 2899275750 363
76 3300006844 Ga0075428_100001349 Ga0075428_1000013497 364
77 3300009094 Ga0111539_10042078 Ga0111539_100420784 364
78 3300050511 nmdc:mga08y16_101832_c1 nmdc:mga08y16_101832_c1_722_1864 364
79 3300028794 Ga0307515_10080842 Ga0307515_100808422 365
80 3300005543 Ga0070672_100167458 Ga0070672_1001674582 366
81 3300005843 Ga0068860_100087214 Ga0068860_1000872142 366
82 3300028381 Ga0268264_10069733 Ga0268264_100697332 366
83 3300031247 Ga0265340_10000518 Ga0265340_100005184 366
84 3300046794 Ga0495589_0000010 Ga0495589_0000010_233207_234310 366
85 3300009011 Ga0105251_10001025 Ga0105251_1000102517 367
86 3300009036 Ga0105244_10002461 Ga0105244_1000246112 367
87 3300048920 Ga0496117_0020507 Ga0496117_0020507_3872_4990 367
88 3300049579 Ga0501043_0154233 Ga0501043_0154233_303_1469 367
89 3300049744 Ga0501083_0007061 Ga0501083_0007061_6023_7198 367
90 3300050513 nmdc:mga0rr50_80094_c1 nmdc:mga0rr50_80094_c1_394_1536 367
91 3300049571 Ga0501034_0143546 Ga0501034_0143546_1237_2346 368
92 iso_pu_bacteria 2508501071 2508854574 368
93 iso_pu_bacteria 2806310673 2807179232 368
94 iso_pu_bacteria 640753048 640940133 368
95 3300005539 Ga0068853_100007172 Ga0068853_1000071722 369
96 3300005563 Ga0068855_100161481 Ga0068855_1001614812 369
97 3300005577 Ga0068857_100276674 Ga0068857_1002766742 369
98 3300005578 Ga0068854_100116241 Ga0068854_1001162413 369
99 3300005614 Ga0068856_100034527 Ga0068856_1000345272 369
100 3300005616 Ga0068852_100007547 Ga0068852_1000075477 369
101 3300005834 Ga0068851_10000846 Ga0068851_1000084611 369
102 3300009551 Ga0105238_10016319 Ga0105238_100163195 369
103 3300025920 Ga0207649_10001929 Ga0207649_100019293 369
104 3300025949 Ga0207667_10164937 Ga0207667_101649373 369
105 3300025981 Ga0207640_10060972 Ga0207640_100609722 369
106 3300026041 Ga0207639_10001485 Ga0207639_100014858 369
107 3300026078 Ga0207702_10023039 Ga0207702_100230397 369
108 3300026142 Ga0207698_10017609 Ga0207698_100176097 369
109 3300053153 Ga0500616_0047142 Ga0500616_0047142_19_1131 369
110 iso_pu_bacteria 2869551831 2869556747 369
111 3300025299 Ga0209256_1000109 Ga0209256_100010937 370
112 3300031901 Ga0307406_10076447 Ga0307406_100764472 370
113 3300036401 Ga0373937_0324095 Ga0373937_0324095_238_1389 370
114 3300049572 Ga0501036_0281855 Ga0501036_0281855_16_1170 370
115 iso_pu_bacteria 2738543031 2739351271 370
116 3300028577 Ga0265318_10006161 Ga0265318_100061613 371
117 3300028794 Ga0307515_10131841 Ga0307515_101318412 371
118 3300049589 Ga0501073_0004525 Ga0501073_0004525_7657_8775 371
119 3300049744 Ga0501083_0009860 Ga0501083_0009860_3884_5002 371
120 3300054114 Ga0501084_0150031 Ga0501084_0150031_459_1577 371
121 iso_pu_bacteria 2738543031 2739347889 371
122 iso_pu_bacteria 2738543031 2739351287 371
123 3300006946 Ga0079104_1004003 Ga0079104_10040032 372
124 3300014326 Ga0157380_10113169 Ga0157380_101131692 372
125 3300048913 Ga0496110_0045089 Ga0496110_0045089_1525_2646 372
126 3300048914 Ga0496111_0143189 Ga0496111_0143189_89_1210 372
127 3300049571 Ga0501034_0043088 Ga0501034_0043088_3374_4543 372
128 3300049571 Ga0501034_0081434 Ga0501034_0081434_637_1806 372
129 3300005337 Ga0070682_100091524 Ga0070682_1000915242 373
130 3300025728 Ga0207655_1000106 Ga0207655_1000106139 373
131 3300025735 Ga0207713_1001081 Ga0207713_100108117 373
132 3300003771 Ga0055526_1000495 Ga0055526_100049524 374
133 3300003775 Ga0055524_1000136 Ga0055524_100013654 374
134 3300003784 Ga0055534_1010922 Ga0055534_10109222 374
135 3300025291 Ga0209675_1003055 Ga0209675_10030557 374
136 3300025295 Ga0209564_1000077 Ga0209564_100007751 374
137 3300025299 Ga0209256_1000057 Ga0209256_100005751 374
138 3300031456 Ga0307513_10011998 Ga0307513_100119988 374
139 3300041404 Ga0439436_0016817 Ga0439436_0016817_491_1639 374
140 iso_pu_bacteria 2852103415 2852106887 374
141 3300031665 Ga0316575_10007357 Ga0316575_100073573 375
142 3300044712 Ga0453684_0139810 Ga0453684_0139810_1506_2693 375
143 3300048928 Ga0496125_0103631 Ga0496125_0103631_758_1924 375
144 3300005327 Ga0070658_10063513 Ga0070658_100635131 376
145 3300005339 Ga0070660_100005933 Ga0070660_1000059337 376
146 3300005535 Ga0070684_100254232 Ga0070684_1002542321 376
147 3300005539 Ga0068853_100048240 Ga0068853_1000482403 376
148 3300005548 Ga0070665_100061652 Ga0070665_1000616521 376
149 3300009545 Ga0105237_10000735 Ga0105237_1000073535 376
150 3300010375 Ga0105239_10001013 Ga0105239_1000101331 376
151 3300013296 Ga0157374_10022022 Ga0157374_100220226 376
152 3300025261 Ga0209233_1000675 Ga0209233_10006753 376
153 3300025909 Ga0207705_10007498 Ga0207705_1000749811 376
154 3300025914 Ga0207671_10000367 Ga0207671_100003676 376
155 3300025919 Ga0207657_10002181 Ga0207657_1000218121 376
156 3300025949 Ga0207667_10006031 Ga0207667_100060318 376
157 3300026041 Ga0207639_10001242 Ga0207639_1000124217 376
158 3300031251 Ga0265327_10031263 Ga0265327_100312632 376
159 3300037312 Ga0395899_0013623 Ga0395899_0013623_1675_2820 376
160 3300053140 Ga0500573_0030598 Ga0500573_0030598_450_1583 376
161 iso_pu_bacteria 2932401849 2932403595 376
162 3300009093 Ga0105240_10020972 Ga0105240_100209726 377
163 3300049705 Ga0501225_0008334 Ga0501225_0008334_864_2006 378
164 iso_pu_bacteria 2915650412 2915650777 378
165 iso_pu_bacteria 3005506211 3005511229 379
166 3300028800 Ga0265338_10011307 Ga0265338_100113078 380
167 3300031247 Ga0265340_10055397 Ga0265340_100553972 380
168 iso_pu_bacteria 2808606386 2808983704 380
169 iso_pu_bacteria 2808606415 2809129368 380
170 iso_pu_bacteria 2808606419 2809149577 380
171 iso_pu_bacteria 2852618963 2852619729 380
172 iso_pu_bacteria 2995392953 2995394071 380
173 3300005331 Ga0070670_100048660 Ga0070670_1000486602 381
174 3300005334 Ga0068869_100046657 Ga0068869_1000466573 381
175 3300005354 Ga0070675_100024830 Ga0070675_1000248305 381
176 3300005364 Ga0070673_100183853 Ga0070673_1001838532 381
177 3300005367 Ga0070667_100129388 Ga0070667_1001293882 381
178 3300005543 Ga0070672_100177510 Ga0070672_1001775102 381
179 3300005544 Ga0070686_100037510 Ga0070686_1000375101 381
180 3300005617 Ga0068859_100105354 Ga0068859_1001053542 381
181 3300005842 Ga0068858_100080635 Ga0068858_1000806352 381
182 3300006237 Ga0097621_100203504 Ga0097621_1002035042 381
183 3300006931 Ga0097620_100105350 Ga0097620_1001053503 381
184 3300013250 Ga0171462_1011 Ga0171462_101172 381
185 3300014497 Ga0182008_10000041 Ga0182008_100000418 381
186 3300025940 Ga0207691_10099027 Ga0207691_100990272 381
187 3300025942 Ga0207689_10196883 Ga0207689_101968831 381
188 3300026023 Ga0207677_10189986 Ga0207677_101899862 381
189 3300026116 Ga0207674_10342873 Ga0207674_103428732 381
190 3300031824 Ga0307413_10121213 Ga0307413_101212132 381
191 3300031995 Ga0307409_100033100 Ga0307409_1000331003 381
192 3300050516 nmdc:mga0sz30_50818_c1 nmdc:mga0sz30_50818_c1_377_1567 381
193 3300053153 Ga0500616_0000414 Ga0500616_0000414_30876_32024 381
194 iso_pu_bacteria 2891048133 2891050114 381
195 iso_pu_bacteria 8054563764 8054567699 381
196 3300013308 Ga0157375_10038742 Ga0157375_100387422 382
197 3300017792 Ga0163161_10140422 Ga0163161_101404222 382
198 3300026121 Ga0207683_10013471 Ga0207683_100134713 382
199 3300031730 Ga0307516_10000286 Ga0307516_1000028656 382
200 3300046492 Ga0495585_0123978 Ga0495585_0123978_66_1226 382
201 3300005937 Ga0081455_10000368 Ga0081455_1000036810 383
202 3300009147 Ga0114129_10078454 Ga0114129_100784543 383
203 3300031548 Ga0307408_100023208 Ga0307408_1000232083 383
204 3300046543 Ga0495645_0192473 Ga0495645_0192473_14_1222 383
205 3300050507 nmdc:mga05p37_119621_c1 nmdc:mga05p37_119621_c1_46_1299 383
206 iso_pu_bacteria 2585428062 2587758227 383
207 3300049822 Ga0501035_0158443 Ga0501035_0158443_386_1567 384
208 iso_pu_bacteria 2643221734 2644735660 384
209 iso_pu_bacteria 2917699015 2917700673 384
210 3300031240 Ga0265320_10037552 Ga0265320_100375521 386
211 3300003771 Ga0055526_1000151 Ga0055526_10001514 387
212 3300025295 Ga0209564_1000074 Ga0209564_1000074214 387
213 3300028794 Ga0307515_10041055 Ga0307515_100410556 387
214 3300028794 Ga0307515_10088349 Ga0307515_100883492 387
215 3300031456 Ga0307513_10015242 Ga0307513_100152428 387
216 3300031456 Ga0307513_10156057 Ga0307513_101560572 387
217 3300031616 Ga0307508_10000134 Ga0307508_1000013457 387
218 3300031649 Ga0307514_10165986 Ga0307514_101659861 387
219 3300031730 Ga0307516_10002748 Ga0307516_1000274810 387
220 3300046512 Ga0495610_0053162 Ga0495610_0053162_235_1401 387
221 3300046660 Ga0495625_0006546 Ga0495625_0006546_3072_4238 387
222 3300050496 nmdc:mga07m45_53654_c1 nmdc:mga07m45_53654_c1_813_1979 387
223 3300050496 nmdc:mga07m45_58345_c1 nmdc:mga07m45_58345_c1_177_1343 387
224 3300053088 Ga0500644_0041235 Ga0500644_0041235_254_1420 387
225 3300053739 Ga0500587_000164 Ga0500587_000164_1194_2360 387
226 3300003187 JGI25151J46595_10000122 JGI25151J46595_1000012225 388
227 3300025294 Ga0209025_1000014 Ga0209025_1000014410 388
228 3300048920 Ga0496117_0042549 Ga0496117_0042549_777_2057 388
229 3300048926 Ga0496123_0081016 Ga0496123_0081016_586_1866 388
230 iso_pu_bacteria 2643221733 2644729737 388

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

188

324

0.98

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

48

180

0.85

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

192

430

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v5n-assembly1.cif.gz_D the crystal structure of oxidoreductase from sinorhizobium meliloti 0.9575 7 384
3v5n-assembly1.cif.gz_C the crystal structure of oxidoreductase from sinorhizobium meliloti 0.9548 7 384
3v5n-assembly1.cif.gz_A the crystal structure of oxidoreductase from sinorhizobium meliloti 0.954 7 384
3v5n-assembly1.cif.gz_B the crystal structure of oxidoreductase from sinorhizobium meliloti 0.9537 7 384
3dty-assembly1.cif.gz_D crystal structure of an oxidoreductase from pseudomonas syringae 0.9522 8 387
ID Description Score Start End Superfamily
3dtyD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 8 144 3.40.50.720
3v5nB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9378 7 144 3.40.50.720
3v5nD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9228 146 384 3.30.360.10
af_B0S5N7_5_117_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9191 73 137 3.40.50.720
3dtyB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9154 147 385 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A4Q3EUD5-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9867 13 140 GO:0000166
AF-A0A7X3V2R7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9862 13 388 GO:0000166
GO:0016491
AF-A0A3D5HQC3-F1-model_v4 Oxidoreductase 0.9841 13 222 GO:0000166
GO:0016491
AF-A0A4Q3EUD5-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9791 13 140 GO:0000166
AF-A0A520FR04-F1-model_v4 deleted 0.9785 13 361

Feature Viewer

pLDDT pTM Quality
95 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map