F343086

General Info

Members Datasets Scaffolds Average Seq Length
230 168 460 235

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10043803|Ga0207664_100438034
Length 268
Sequence MLPLVTMHVNFCRQMALGRGFSGDKIHSPPQKLMLDLRHSMDMLGSHMGTVLSRTIARLVVAAILGGAIGLERQLRHKPAGLRTNMFICFGAAMFTVLSDQLAGGMGGDHTRVAAQIIPGIGFIGAGSILHARGSVVGLTTAATLFVVASVGMATGGGLYVTAIFATMVILIALALLGRLERKFGMRSMLVTYELTGASAETVLVEANRVLDEVHSSMQAVRIAGSAGHVRVLFNVDGPHEDQEQINLLLHQSTVFSTVGSLGAVEHE

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
82 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
83 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 2.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.91
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 25.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10043803 3300025929 Bacteria 3503
2 LJNas_1012834 3300000546 Unclassified 893
3 JGI24034J26672_10004198 3300002239 Unclassified 2032
4 Ga0070658_10431745 3300005327 Bacteria 1134
5 Ga0070676_10129389 3300005328 Unclassified 1594
6 Ga0070683_100009652 3300005329 Bacteria 8260
7 Ga0070677_10064742 3300005333 Bacteria 1519
8 Ga0070680_100089059 3300005336 Unclassified 2554
9 Ga0070682_100015853 3300005337 Unclassified 4374
10 Ga0068868_100067431 3300005338 Unclassified 2848
11 Ga0070660_100010642 3300005339 Bacteria 6504
12 Ga0070689_100009473 3300005340 Bacteria 6904
13 Ga0070687_100003095 3300005343 Bacteria 6397
14 Ga0070661_100031373 3300005344 Unclassified 3843
15 Ga0070674_100008909 3300005356 Bacteria 5992
16 Ga0070688_100002892 3300005365 Bacteria 8753
17 Ga0070659_100054844 3300005366 Bacteria 3140
18 Ga0070709_10019563 3300005434 Bacteria 3916
19 Ga0070714_100088961 3300005435 Bacteria 2702
20 Ga0070714_100463254 3300005435 Unclassified 1205
21 Ga0070713_100368411 3300005436 Bacteria 1336
22 Ga0070710_10003026 3300005437 Bacteria 7994
23 Ga0070710_10024303 3300005437 Bacteria 3195
24 Ga0070701_10433163 3300005438 Bacteria 840
25 Ga0070711_100001945 3300005439 Bacteria 11581
26 Ga0070711_100017764 3300005439 Unclassified 4532
27 Ga0070711_100021933 3300005439 Bacteria 4133
28 Ga0070708_100014144 3300005445 Bacteria 6560
29 Ga0070708_100080283 3300005445 Bacteria 2952
30 Ga0070708_100100164 3300005445 Bacteria 2651
31 Ga0070708_100225889 3300005445 Bacteria 1756
32 Ga0070663_100044253 3300005455 Unclassified 3137
33 Ga0070678_100628308 3300005456 Unclassified 961
34 Ga0070662_100008358 3300005457 Bacteria 6746
35 Ga0070681_10059036 3300005458 Unclassified 3815
36 Ga0068867_100002611 3300005459 Bacteria 12706
37 Ga0070685_10002276 3300005466 Bacteria 9898
38 Ga0070706_100421604 3300005467 Bacteria 1242
39 Ga0070707_100029517 3300005468 Bacteria 5221
40 Ga0070707_100038935 3300005468 Bacteria 4542
41 Ga0070707_100056284 3300005468 Bacteria 3772
42 Ga0070707_100160097 3300005468 Bacteria 2193
43 Ga0070707_100291828 3300005468 Bacteria 1585
44 Ga0070707_100525090 3300005468 Bacteria 1146
45 Ga0070707_100749915 3300005468 Unclassified 939
46 Ga0070698_100200419 3300005471 Unclassified 1932
47 Ga0070699_100137653 3300005518 Bacteria 2154
48 Ga0070699_100198400 3300005518 Bacteria 1784
49 Ga0070679_100012778 3300005530 Bacteria 8033
50 Ga0070684_100078256 3300005535 Unclassified 2921
51 Ga0070697_100282440 3300005536 Bacteria 1425
52 Ga0070697_100512692 3300005536 Bacteria 1049
53 Ga0068853_100107321 3300005539 Unclassified 2476
54 Ga0070672_100015040 3300005543 Bacteria 5499
55 Ga0070686_100007722 3300005544 Bacteria 6014
56 Ga0070664_100052227 3300005564 Unclassified 3461
57 Ga0068854_100026835 3300005578 Bacteria 3963
58 Ga0068856_100103863 3300005614 Unclassified 2835
59 Ga0070702_100027294 3300005615 Unclassified 3079
60 Ga0068864_100087938 3300005618 Bacteria 2736
61 Ga0068866_10001073 3300005718 Bacteria 12054
62 Ga0068851_10005150 3300005834 Bacteria 5930
63 Ga0068870_10002197 3300005840 Bacteria 8082
64 Ga0070717_10009995 3300006028 Bacteria 7140
65 Ga0070717_10060316 3300006028 Bacteria 3141
66 Ga0070717_10116776 3300006028 Bacteria 2282
67 Ga0070717_10537485 3300006028 Unclassified 1058
68 Ga0070716_100001082 3300006173 Bacteria 11947
69 Ga0070716_100593571 3300006173 Bacteria 832
70 Ga0070712_100001573 3300006175 Bacteria 13964
71 Ga0070712_100230135 3300006175 Bacteria 1472
72 Ga0070712_100321051 3300006175 Unclassified 1259
73 Ga0075433_10005473 3300006852 Bacteria 9975
74 Ga0075433_10022979 3300006852 Bacteria 5243
75 Ga0075434_100000123 3300006871 Bacteria 45651
76 Ga0068865_100005233 3300006881 Bacteria 7843
77 Ga0075436_100012663 3300006914 Bacteria 5780
78 Ga0075435_100000170 3300007076 Bacteria 38099
79 Ga0099794_10094073 3300007265 Bacteria 1490
80 Ga0099794_10113468 3300007265 Bacteria 1359
81 Ga0099795_10032332 3300007788 Bacteria 1809
82 Ga0111539_10574715 3300009094 Bacteria 1313
83 Ga0105245_10032452 3300009098 Bacteria 4623
84 Ga0105247_10053190 3300009101 Bacteria 2497
85 Ga0114129_10526392 3300009147 Unclassified 1541
86 Ga0105242_10047736 3300009176 Unclassified 3477
87 Ga0105237_10049032 3300009545 Unclassified 4246
88 Ga0105249_10033064 3300009553 Unclassified 4682
89 Ga0105239_10004620 3300010375 Bacteria 16372
90 Ga0105246_10003985 3300011119 Bacteria 8954
91 Ga0157326_1010370 3300012513 Unclassified 1038
92 Ga0157373_10003844 3300013100 Bacteria 11352
93 Ga0157371_10015021 3300013102 Bacteria 5821
94 Ga0157369_10018906 3300013105 Bacteria 7721
95 Ga0157374_10065653 3300013296 Bacteria 3408
96 Ga0163162_10292287 3300013306 Bacteria 1761
97 Ga0157372_10003879 3300013307 Bacteria 16063
98 Ga0163163_10003076 3300014325 Bacteria 14126
99 Ga0157380_10120581 3300014326 Unclassified 2221
100 Ga0157377_10000340 3300014745 Bacteria 20866
101 Ga0157379_10029279 3300014968 Unclassified 4897
102 Ga0157376_10003116 3300014969 Bacteria 11394
103 Ga0163161_10003073 3300017792 Bacteria 11772
104 Ga0224570_102454 3300022730 Bacteria 1240
105 Ga0224569_102081 3300022732 Bacteria 1652
106 Ga0224569_102392 3300022732 Unclassified 1531
107 Ga0228598_1000116 3300024227 Bacteria 13491
108 Ga0228598_1001221 3300024227 Bacteria 5675
109 Ga0228598_1012690 3300024227 Bacteria 1672
110 Ga0228598_1015762 3300024227 Bacteria 1491
111 Ga0207697_10003645 3300025315 Bacteria 7547
112 Ga0207682_10187714 3300025893 Bacteria 946
113 Ga0207692_10003431 3300025898 Bacteria 6191
114 Ga0207692_10006399 3300025898 Bacteria 4774
115 Ga0207710_10042176 3300025900 Bacteria 2026
116 Ga0207688_10013434 3300025901 Unclassified 4450
117 Ga0207685_10054077 3300025905 Unclassified 1562
118 Ga0207699_10020787 3300025906 Bacteria 3525
119 Ga0207699_10128118 3300025906 Bacteria 1651
120 Ga0207645_10000073 3300025907 Bacteria 71786
121 Ga0207643_10001180 3300025908 Bacteria 15512
122 Ga0207684_10190637 3300025910 Bacteria 1768
123 Ga0207684_10364721 3300025910 Unclassified 1243
124 Ga0207693_10001326 3300025915 Bacteria 21912
125 Ga0207693_10092538 3300025915 Bacteria 2369
126 Ga0207663_10001294 3300025916 Bacteria 11603
127 Ga0207663_10035124 3300025916 Bacteria 3004
128 Ga0207660_10070881 3300025917 Unclassified 2534
129 Ga0207662_10001315 3300025918 Bacteria 11968
130 Ga0207657_10012792 3300025919 Bacteria 8259
131 Ga0207649_10006519 3300025920 Bacteria 6341
132 Ga0207652_10099477 3300025921 Unclassified 2566
133 Ga0207646_10035233 3300025922 Bacteria 4521
134 Ga0207646_10045070 3300025922 Bacteria 3959
135 Ga0207646_10045279 3300025922 Unclassified 3949
136 Ga0207646_10071803 3300025922 Bacteria 3092
137 Ga0207646_10245443 3300025922 Bacteria 1617
138 Ga0207646_10374924 3300025922 Bacteria 1285
139 Ga0207646_10462169 3300025922 Unclassified 1145
140 Ga0207646_10506300 3300025922 Unclassified 1088
141 Ga0207646_10514873 3300025922 Unclassified 1077
142 Ga0207650_10000045 3300025925 Bacteria 181507
143 Ga0207659_10017249 3300025926 Unclassified 4713
144 Ga0207687_10032051 3300025927 Unclassified 3557
145 Ga0207700_10064504 3300025928 Bacteria 2790
146 Ga0207644_10052981 3300025931 Unclassified 2918
147 Ga0207690_10161126 3300025932 Bacteria 1672
148 Ga0207706_10000213 3300025933 Bacteria 63821
149 Ga0207670_10003534 3300025936 Bacteria 8292
150 Ga0207669_10003050 3300025937 Bacteria 7215
151 Ga0207665_10000054 3300025939 Bacteria 73528
152 Ga0207665_10191108 3300025939 Bacteria 1487
153 Ga0207665_10453902 3300025939 Unclassified 984
154 Ga0207691_10000556 3300025940 Bacteria 37289
155 Ga0207689_10000780 3300025942 Bacteria 30597
156 Ga0207661_10000992 3300025944 Bacteria 18770
157 Ga0207661_10274621 3300025944 Bacteria 1505
158 Ga0207679_10000525 3300025945 Bacteria 25943
159 Ga0207712_10124817 3300025961 Unclassified 1953
160 Ga0207640_10035690 3300025981 Bacteria 3114
161 Ga0207677_10132334 3300026023 Bacteria 1896
162 Ga0207678_10000026 3300026067 Bacteria 116850
163 Ga0207641_10000075 3300026088 Bacteria 145149
164 Ga0207648_10000679 3300026089 Bacteria 38160
165 Ga0207676_10000669 3300026095 Bacteria 27440
166 Ga0207674_10000559 3300026116 Bacteria 48687
167 Ga0207675_100015010 3300026118 Bacteria 7228
168 Ga0207683_10000438 3300026121 Bacteria 38515
169 Ga0207683_10452305 3300026121 Bacteria 1184
170 Ga0265355_1001041 3300028036 Unclassified 1693
171 Ga0268266_10001444 3300028379 Bacteria 28286
172 Ga0268265_10017979 3300028380 Unclassified 4891
173 Ga0268264_10005658 3300028381 Bacteria 10591
174 Ga0268264_10451948 3300028381 Unclassified 1245
175 Ga0265338_10039560 3300028800 Bacteria 4446
176 Ga0265338_10047135 3300028800 Bacteria 3940
177 Ga0265338_10073208 3300028800 Bacteria 2921
178 Ga0265762_1005254 3300030760 Bacteria 2320
179 Ga0265760_10001034 3300031090 Bacteria 8094
180 Ga0265760_10001998 3300031090 Bacteria 5997
181 Ga0265760_10002469 3300031090 Bacteria 5396
182 Ga0265760_10011672 3300031090 Unclassified 2510
183 Ga0265760_10022224 3300031090 Bacteria 1838
184 Ga0265328_10092006 3300031239 Unclassified 1121
185 Ga0265325_10012074 3300031241 Bacteria 4948
186 Ga0265339_10082103 3300031249 Unclassified 1702
187 Ga0265339_10169401 3300031249 Bacteria 1094
188 Ga0265316_10027510 3300031344 Bacteria 4707
189 Ga0265316_10028576 3300031344 Bacteria 4598
190 Ga0265314_10037832 3300031711 Bacteria 3492
191 Ga0307412_10089199 3300031911 Unclassified 2153
192 Ga0307409_100079343 3300031995 Unclassified 2645
193 Ga0373935_0478542 3300035692 Bacteria 902
194 Ga0373933_0091975 3300035724 Bacteria 1873
195 Ga0373937_0032001 3300036401 Bacteria 4769
196 Ga0373937_0181415 3300036401 Unclassified 1977
197 Ga0436363_0380184 3300039450 Bacteria 821
198 Ga0436362_0758452 3300039453 Bacteria 3740
199 Ga0466968_0091323 3300044735 Bacteria 1350
200 Ga0466957_0307784 3300044842 Bacteria 1066
201 Ga0451576_0794225 3300045051 Bacteria 994
202 Ga0495590_0027536 3300046457 Bacteria 1994
203 Ga0495580_0002901 3300046472 Bacteria 14734
204 Ga0495580_0003297 3300046472 Bacteria 13795
205 Ga0495580_0004476 3300046472 Bacteria 11738
206 Ga0495580_0021223 3300046472 Bacteria 4795
207 Ga0495580_0023514 3300046472 Unclassified 4524
208 Ga0495580_0057747 3300046472 Unclassified 2731
209 Ga0495659_0027422 3300046664 Unclassified 1965
210 Ga0495659_0063025 3300046664 Unclassified 1373
211 Ga0495657_0248282 3300046675 Bacteria 1072
212 Ga0495669_0003332 3300046684 Bacteria 6612
213 Ga0495670_0237407 3300046691 Unclassified 970
214 Ga0496101_0045797 3300048904 Unclassified 3135
215 Ga0496104_0170941 3300048907 Unclassified 2084
216 Ga0496106_0315753 3300048909 Bacteria 1254
217 Ga0496108_0000957 3300048911 Bacteria 22443
218 Ga0496109_0000164 3300048912 Bacteria 65491
219 Ga0496110_0017520 3300048913 Bacteria 5992
220 Ga0496111_0413436 3300048914 Bacteria 996
221 Ga0496112_0000078 3300048915 Bacteria 64712
222 Ga0496113_0005389 3300048916 Bacteria 7975
223 Ga0501298_054327 3300049521 Bacteria 836
224 nmdc:mga08y16_511824_c1 3300050511 Bacteria 1218
225 nmdc:mga0n895_1237_c1 3300050512 Bacteria 18843
226 nmdc:mga0n895_1909_c1 3300050512 Bacteria 15964
227 nmdc:mga0rr50_800_c1 3300050513 Bacteria 16967
228 nmdc:mga08x19_50243_c1 3300050514 Bacteria 2676
229 nmdc:mga0a205_3232_c1 3300050515 Bacteria 14491
230 nmdc:mga0a205_36950_c1 3300050515 Bacteria 4695
231 Ga0207664_10043803
232 LJNas_1012834
233 JGI24034J26672_10004198
234 Ga0070658_10431745
235 Ga0070676_10129389
236 Ga0070683_100009652
237 Ga0070677_10064742
238 Ga0070680_100089059
239 Ga0070682_100015853
240 Ga0068868_100067431
241 Ga0070660_100010642
242 Ga0070689_100009473
243 Ga0070687_100003095
244 Ga0070661_100031373
245 Ga0070674_100008909
246 Ga0070688_100002892
247 Ga0070659_100054844
248 Ga0070709_10019563
249 Ga0070714_100088961
250 Ga0070714_100463254
251 Ga0070713_100368411
252 Ga0070710_10003026
253 Ga0070710_10024303
254 Ga0070701_10433163
255 Ga0070711_100001945
256 Ga0070711_100017764
257 Ga0070711_100021933
258 Ga0070708_100014144
259 Ga0070708_100080283
260 Ga0070708_100100164
261 Ga0070708_100225889
262 Ga0070663_100044253
263 Ga0070678_100628308
264 Ga0070662_100008358
265 Ga0070681_10059036
266 Ga0068867_100002611
267 Ga0070685_10002276
268 Ga0070706_100421604
269 Ga0070707_100029517
270 Ga0070707_100038935
271 Ga0070707_100056284
272 Ga0070707_100160097
273 Ga0070707_100291828
274 Ga0070707_100525090
275 Ga0070707_100749915
276 Ga0070698_100200419
277 Ga0070699_100137653
278 Ga0070699_100198400
279 Ga0070679_100012778
280 Ga0070684_100078256
281 Ga0070697_100282440
282 Ga0070697_100512692
283 Ga0068853_100107321
284 Ga0070672_100015040
285 Ga0070686_100007722
286 Ga0070664_100052227
287 Ga0068854_100026835
288 Ga0068856_100103863
289 Ga0070702_100027294
290 Ga0068864_100087938
291 Ga0068866_10001073
292 Ga0068851_10005150
293 Ga0068870_10002197
294 Ga0070717_10009995
295 Ga0070717_10060316
296 Ga0070717_10116776
297 Ga0070717_10537485
298 Ga0070716_100001082
299 Ga0070716_100593571
300 Ga0070712_100001573
301 Ga0070712_100230135
302 Ga0070712_100321051
303 Ga0075433_10005473
304 Ga0075433_10022979
305 Ga0075434_100000123
306 Ga0068865_100005233
307 Ga0075436_100012663
308 Ga0075435_100000170
309 Ga0099794_10094073
310 Ga0099794_10113468
311 Ga0099795_10032332
312 Ga0111539_10574715
313 Ga0105245_10032452
314 Ga0105247_10053190
315 Ga0114129_10526392
316 Ga0105242_10047736
317 Ga0105237_10049032
318 Ga0105249_10033064
319 Ga0105239_10004620
320 Ga0105246_10003985
321 Ga0157326_1010370
322 Ga0157373_10003844
323 Ga0157371_10015021
324 Ga0157369_10018906
325 Ga0157374_10065653
326 Ga0163162_10292287
327 Ga0157372_10003879
328 Ga0163163_10003076
329 Ga0157380_10120581
330 Ga0157377_10000340
331 Ga0157379_10029279
332 Ga0157376_10003116
333 Ga0163161_10003073
334 Ga0224570_102454
335 Ga0224569_102081
336 Ga0224569_102392
337 Ga0228598_1000116
338 Ga0228598_1001221
339 Ga0228598_1012690
340 Ga0228598_1015762
341 Ga0207697_10003645
342 Ga0207682_10187714
343 Ga0207692_10003431
344 Ga0207692_10006399
345 Ga0207710_10042176
346 Ga0207688_10013434
347 Ga0207685_10054077
348 Ga0207699_10020787
349 Ga0207699_10128118
350 Ga0207645_10000073
351 Ga0207643_10001180
352 Ga0207684_10190637
353 Ga0207684_10364721
354 Ga0207693_10001326
355 Ga0207693_10092538
356 Ga0207663_10001294
357 Ga0207663_10035124
358 Ga0207660_10070881
359 Ga0207662_10001315
360 Ga0207657_10012792
361 Ga0207649_10006519
362 Ga0207652_10099477
363 Ga0207646_10035233
364 Ga0207646_10045070
365 Ga0207646_10045279
366 Ga0207646_10071803
367 Ga0207646_10245443
368 Ga0207646_10374924
369 Ga0207646_10462169
370 Ga0207646_10506300
371 Ga0207646_10514873
372 Ga0207650_10000045
373 Ga0207659_10017249
374 Ga0207687_10032051
375 Ga0207700_10064504
376 Ga0207644_10052981
377 Ga0207690_10161126
378 Ga0207706_10000213
379 Ga0207670_10003534
380 Ga0207669_10003050
381 Ga0207665_10000054
382 Ga0207665_10191108
383 Ga0207665_10453902
384 Ga0207691_10000556
385 Ga0207689_10000780
386 Ga0207661_10000992
387 Ga0207661_10274621
388 Ga0207679_10000525
389 Ga0207712_10124817
390 Ga0207640_10035690
391 Ga0207677_10132334
392 Ga0207678_10000026
393 Ga0207641_10000075
394 Ga0207648_10000679
395 Ga0207676_10000669
396 Ga0207674_10000559
397 Ga0207675_100015010
398 Ga0207683_10000438
399 Ga0207683_10452305
400 Ga0265355_1001041
401 Ga0268266_10001444
402 Ga0268265_10017979
403 Ga0268264_10005658
404 Ga0268264_10451948
405 Ga0265338_10039560
406 Ga0265338_10047135
407 Ga0265338_10073208
408 Ga0265762_1005254
409 Ga0265760_10001034
410 Ga0265760_10001998
411 Ga0265760_10002469
412 Ga0265760_10011672
413 Ga0265760_10022224
414 Ga0265328_10092006
415 Ga0265325_10012074
416 Ga0265339_10082103
417 Ga0265339_10169401
418 Ga0265316_10027510
419 Ga0265316_10028576
420 Ga0265314_10037832
421 Ga0307412_10089199
422 Ga0307409_100079343
423 Ga0373935_0478542
424 Ga0373933_0091975
425 Ga0373937_0032001
426 Ga0373937_0181415
427 Ga0436363_0380184
428 Ga0436362_0758452
429 Ga0466968_0091323
430 Ga0466957_0307784
431 Ga0451576_0794225
432 Ga0495590_0027536
433 Ga0495580_0002901
434 Ga0495580_0003297
435 Ga0495580_0004476
436 Ga0495580_0021223
437 Ga0495580_0023514
438 Ga0495580_0057747
439 Ga0495659_0027422
440 Ga0495659_0063025
441 Ga0495657_0248282
442 Ga0495669_0003332
443 Ga0495670_0237407
444 Ga0496101_0045797
445 Ga0496104_0170941
446 Ga0496106_0315753
447 Ga0496108_0000957
448 Ga0496109_0000164
449 Ga0496110_0017520
450 Ga0496111_0413436
451 Ga0496112_0000078
452 Ga0496113_0005389
453 Ga0501298_054327
454 nmdc:mga08y16_511824_c1
455 nmdc:mga0n895_1237_c1
456 nmdc:mga0n895_1909_c1
457 nmdc:mga0rr50_800_c1
458 nmdc:mga08x19_50243_c1
459 nmdc:mga0a205_3232_c1
460 nmdc:mga0a205_36950_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02308

MgtC

MgtC family

59

183

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wo1-assembly1.cif.gz_B hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit 0.8699 153 229
6vz8-assembly1.cif.gz_S arabidopsis thaliana acetohydroxyacid synthase complex with valine bound 0.8575 155 229
2f1f-assembly1.cif.gz_A crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli 0.8488 156 228
3k5p-assembly1.cif.gz_A crystal structure of amino acid-binding act: d-isomer specific 2-hydroxyacid dehydrogenase catalytic domain from brucella melitensis 0.8388 157 228
2pc6-assembly2.cif.gz_D crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea 0.8365 155 228
ID Description Score Start End Superfamily
af_B6TXK4_310_390_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8693 153 228 3.30.70.260
af_Q9FFF4_74_151_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8523 156 228 3.30.70.260
af_Q57901_1_89_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8458 154 230 3.30.70.60
3k5pA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8388 157 228 3.30.70.260
af_P18459_145_576_1.10.800.10 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.8368 153 229 1.10.800.10
ID Description Score Start End GO Terms
AF-A0A2K1Q1C1-F1-model_v4 V4R domain 0.8978 155 227
AF-A0A259K7Q0-F1-model_v4 Uncharacterized protein 0.875 154 233
AF-A0A139DSS6-F1-model_v4 deleted 0.8746 153 228
AF-A0A0C9MNV4-F1-model_v4 lanosterol synthase (EC 5.4.99.7) 0.8743 153 227 GO:0000250
GO:0005737
GO:0005811
GO:0006696
GO:0009097
GO:0009099
GO:0016104
GO:1990610
AF-A0A074LMX9-F1-model_v4 ACT domain-containing protein 0.8742 155 229

Map