F343051

General Info

Members Datasets Scaffolds Average Seq Length
230 107 460 83

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10121811|Ga0213875_101218113
Length 96
Sequence MCSGSVAGDRGDLVNEWEVAATVLGFALIPCVLVALLASPPHGLAALELASVLLTTILMLLAEGFHRQPFIDLAVVFAPLSLVGSLMFARLMERDL

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
70 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
71 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
72 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
73 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
74 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
104 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
105 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
106 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 1.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.17
Rhizosphere 77.39
Stem 0
Stem Tuber 0
Unclassified 21.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10121811 3300021388 Bacteria 1219
2 Ga0070683_100001318 3300005329 Bacteria 18882
3 Ga0070683_100024404 3300005329 Bacteria 5416
4 Ga0070680_100000377 3300005336 Bacteria 30109
5 Ga0070682_100359804 3300005337 Bacteria 1088
6 Ga0070660_100010370 3300005339 Bacteria 6585
7 Ga0070661_100021851 3300005344 Bacteria 4576
8 Ga0070659_100016577 3300005366 Bacteria 5532
9 Ga0070713_100487184 3300005436 Bacteria 1162
10 Ga0070681_10007641 3300005458 Bacteria 10573
11 Ga0070679_100001463 3300005530 Bacteria 20928
12 Ga0070684_100001164 3300005535 Bacteria 18882
13 Ga0070684_100006789 3300005535 Bacteria 8876
14 Ga0068853_100237966 3300005539 Bacteria 1668
15 Ga0068855_100143086 3300005563 Bacteria 2724
16 Ga0068855_100152824 3300005563 Bacteria 2624
17 Ga0068855_102120013 3300005563 Bacteria 566
18 Ga0070664_100128553 3300005564 Bacteria 2224
19 Ga0068857_100414959 3300005577 Bacteria 1254
20 Ga0068856_100005073 3300005614 Bacteria 13034
21 Ga0068856_100020228 3300005614 Bacteria 6464
22 Ga0068856_100055897 3300005614 Bacteria 3895
23 Ga0068856_101661085 3300005614 Bacteria 651
24 Ga0068852_100025467 3300005616 Bacteria 4794
25 Ga0068852_100156093 3300005616 Bacteria 2126
26 Ga0070717_10127457 3300006028 Bacteria 2186
27 Ga0070717_10624436 3300006028 Bacteria 978
28 Ga0075434_100048058 3300006871 Bacteria 4234
29 Ga0075436_100149585 3300006914 Bacteria 1643
30 Ga0075435_100300572 3300007076 Bacteria 1373
31 Ga0075435_101940725 3300007076 Bacteria 517
32 Ga0105240_10054485 3300009093 Bacteria 5012
33 Ga0114129_10521219 3300009147 Bacteria 1549
34 Ga0105241_10888556 3300009174 Bacteria 827
35 Ga0105237_10085960 3300009545 Bacteria 3135
36 Ga0105238_10243228 3300009551 Bacteria 1777
37 Ga0105239_13491957 3300010375 Unclassified 511
38 Ga0157373_10446368 3300013100 Bacteria 930
39 Ga0157370_10007489 3300013104 Bacteria 11858
40 Ga0157370_10148271 3300013104 Bacteria 2184
41 Ga0157370_11295904 3300013104 Bacteria 656
42 Ga0157369_10184269 3300013105 Bacteria 2196
43 Ga0157369_10528161 3300013105 Unclassified 1220
44 Ga0157369_10776257 3300013105 Unclassified 985
45 Ga0157372_10390417 3300013307 Bacteria 1622
46 Ga0157372_10901466 3300013307 Bacteria 1026
47 Ga0206353_10369643 3300020082 Bacteria 1098
48 Ga0154015_1350184 3300020610 Bacteria 857
49 Ga0213874_10012114 3300021377 Bacteria 2204
50 Ga0213874_10168481 3300021377 Bacteria 773
51 Ga0213874_10415920 3300021377 Bacteria 525
52 Ga0213876_10037753 3300021384 Unclassified 2548
53 Ga0213876_10088771 3300021384 Bacteria 1637
54 Ga0213876_10116909 3300021384 Bacteria 1415
55 Ga0213876_10182721 3300021384 Unclassified 1115
56 Ga0213875_10007903 3300021388 Bacteria 5467
57 Ga0213875_10075021 3300021388 Bacteria 1578
58 Ga0213875_10560126 3300021388 Unclassified 551
59 Ga0224712_10007891 3300022467 Bacteria 3121
60 Ga0207707_10024986 3300025912 Bacteria 5227
61 Ga0207695_10077200 3300025913 Bacteria 3384
62 Ga0207671_10787248 3300025914 Bacteria 754
63 Ga0207660_10022124 3300025917 Bacteria 4282
64 Ga0207657_10041936 3300025919 Bacteria 4042
65 Ga0207649_10013307 3300025920 Bacteria 4590
66 Ga0207652_10024941 3300025921 Bacteria 4965
67 Ga0207694_10098186 3300025924 Bacteria 2318
68 Ga0207700_10427912 3300025928 Bacteria 1164
69 Ga0207664_10209459 3300025929 Bacteria 1686
70 Ga0207664_10807790 3300025929 Bacteria 843
71 Ga0207644_10195729 3300025931 Bacteria 1592
72 Ga0207690_10028749 3300025932 Bacteria 3526
73 Ga0207661_10016335 3300025944 Bacteria 5475
74 Ga0207679_10297083 3300025945 Bacteria 1391
75 Ga0207667_10149953 3300025949 Bacteria 2400
76 Ga0207667_10779414 3300025949 Unclassified 954
77 Ga0207667_11850162 3300025949 Bacteria 567
78 Ga0207639_10081914 3300026041 Bacteria 2557
79 Ga0207702_10037107 3300026078 Bacteria 4078
80 Ga0207702_10069970 3300026078 Bacteria 3017
81 Ga0207702_10075856 3300026078 Bacteria 2905
82 Ga0207674_10134939 3300026116 Bacteria 2430
83 Ga0207698_10244328 3300026142 Bacteria 1638
84 Ga0207698_10317028 3300026142 Bacteria 1458
85 Ga0373935_0612444 3300035692 Bacteria 797
86 Ga0373933_1026659 3300035724 Bacteria 543
87 Ga0373937_0131069 3300036401 Bacteria 2342
88 Ga0395899_0390361 3300037312 Unclassified 923
89 Ga0395899_0756895 3300037312 Bacteria 604
90 Ga0395900_0018019 3300037418 Bacteria 7210
91 Ga0395900_1325453 3300037418 Unclassified 633
92 Ga0395898_0084243 3300037466 Bacteria 3064
93 Ga0395898_0197831 3300037466 Bacteria 1920
94 Ga0395905_0083890 3300037471 Bacteria 2985
95 Ga0395905_0184463 3300037471 Bacteria 1959
96 Ga0395905_0872819 3300037471 Bacteria 803
97 Ga0395905_0976003 3300037471 Unclassified 750
98 Ga0436364_0111667 3300037853 Bacteria 1808
99 Ga0436364_0207633 3300037853 Bacteria 3002
100 Ga0436364_0242553 3300037853 Unclassified 2068
101 Ga0436364_0354286 3300037853 Bacteria 2422
102 Ga0436364_0758998 3300037853 Bacteria 29208
103 Ga0436364_0853893 3300037853 Bacteria 1470
104 Ga0436364_0859095 3300037853 Unclassified 1762
105 Ga0436364_0934308 3300037853 Bacteria 3977
106 Ga0436364_0934832 3300037853 Bacteria 2948
107 Ga0436364_0990911 3300037853 Bacteria 708
108 Ga0436364_1019243 3300037853 Bacteria 1855
109 Ga0395901_0000956 3300038443 Bacteria 31448
110 Ga0395901_0083545 3300038443 Bacteria 3338
111 Ga0395901_0187738 3300038443 Bacteria 2168
112 Ga0395901_0469709 3300038443 Bacteria 1284
113 Ga0395901_0678912 3300038443 Unclassified 1030
114 Ga0436365_0074905 3300039437 Bacteria 1898
115 Ga0436365_0097479 3300039437 Bacteria 2121
116 Ga0436365_0136387 3300039437 Bacteria 5285
117 Ga0436365_0363744 3300039437 Unclassified 845
118 Ga0436365_0435734 3300039437 Bacteria 2035
119 Ga0436365_0543216 3300039437 Unclassified 856
120 Ga0436365_0786421 3300039437 Unclassified 1271
121 Ga0436365_1085223 3300039437 Bacteria 3240
122 Ga0436365_1174137 3300039437 Unclassified 1224
123 Ga0436365_1429493 3300039437 Bacteria 6046
124 Ga0436365_1455286 3300039437 Bacteria 3420
125 Ga0436360_1285891 3300039438 Bacteria 2476
126 Ga0436363_0349849 3300039450 Bacteria 8979
127 Ga0436363_0788846 3300039450 Bacteria 731
128 Ga0436363_0875630 3300039450 Bacteria 1000
129 Ga0436363_1013078 3300039450 Bacteria 901
130 Ga0436363_1244415 3300039450 Bacteria 1616
131 Ga0436363_1444466 3300039450 Bacteria 1548
132 Ga0436363_1455014 3300039450 Bacteria 719
133 Ga0436363_1501493 3300039450 Bacteria 597
134 Ga0436362_0129652 3300039453 Bacteria 955
135 Ga0436362_0701385 3300039453 Bacteria 5698
136 Ga0451793_1552643 3300041452 Unclassified 1279
137 Ga0451802_1240834 3300041460 Unclassified 1001
138 Ga0451835_0332783 3300041492 Bacteria 1097
139 Ga0451841_0014152 3300041498 Unclassified 863
140 Ga0451849_0638308 3300041505 Unclassified 875
141 Ga0451851_1044443 3300041507 Bacteria 939
142 Ga0451853_0851126 3300041512 Bacteria 2065
143 Ga0451853_1907954 3300041512 Bacteria 577
144 Ga0466972_0510215 3300044658 Bacteria 566
145 Ga0453683_0000350 3300044673 Bacteria 55884
146 Ga0466965_0166564 3300044683 Bacteria 1157
147 Ga0466965_0263623 3300044683 Unclassified 927
148 Ga0466965_0506556 3300044683 Bacteria 677
149 Ga0466966_0033547 3300044684 Bacteria 3324
150 Ga0466966_0063023 3300044684 Unclassified 2337
151 Ga0466966_0070430 3300044684 Unclassified 2193
152 Ga0466966_0180714 3300044684 Bacteria 1280
153 Ga0466966_0403855 3300044684 Unclassified 821
154 Ga0466961_0005025 3300044693 Bacteria 8317
155 Ga0466961_0096437 3300044693 Unclassified 1865
156 Ga0466961_0322925 3300044693 Bacteria 941
157 Ga0466961_0456419 3300044693 Unclassified 773
158 Ga0466961_0527630 3300044693 Bacteria 712
159 Ga0466963_0002944 3300044694 Bacteria 9623
160 Ga0466963_0033823 3300044694 Bacteria 3322
161 Ga0466963_0062239 3300044694 Bacteria 2496
162 Ga0466963_0185494 3300044694 Bacteria 1453
163 Ga0466963_0383870 3300044694 Bacteria 990
164 Ga0466963_1238585 3300044694 Bacteria 524
165 Ga0466964_0414244 3300044706 Unclassified 707
166 Ga0466964_0448097 3300044706 Bacteria 684
167 Ga0466964_0920716 3300044706 Bacteria 501
168 Ga0466971_0013411 3300044719 Bacteria 3600
169 Ga0466971_0520202 3300044719 Unclassified 588
170 Ga0466971_0634070 3300044719 Unclassified 534
171 Ga0466968_0095119 3300044735 Bacteria 1325
172 Ga0466968_0146622 3300044735 Bacteria 1082
173 Ga0466968_0295298 3300044735 Bacteria 778
174 Ga0466968_0316254 3300044735 Bacteria 753
175 Ga0466968_0340286 3300044735 Bacteria 727
176 Ga0466968_0723681 3300044735 Unclassified 509
177 Ga0466968_0730340 3300044735 Unclassified 507
178 Ga0466970_0028144 3300044765 Bacteria 2952
179 Ga0466970_0062652 3300044765 Bacteria 1994
180 Ga0466970_0904010 3300044765 Bacteria 519
181 Ga0466957_0167242 3300044842 Bacteria 1431
182 Ga0466957_0232479 3300044842 Unclassified 1221
183 Ga0466957_0343457 3300044842 Unclassified 1011
184 Ga0466957_0467602 3300044842 Unclassified 871
185 Ga0466957_0758491 3300044842 Bacteria 687
186 Ga0466960_0266370 3300044901 Bacteria 956
187 Ga0466960_0425276 3300044901 Unclassified 768
188 Ga0466959_0012804 3300045049 Bacteria 6068
189 Ga0466959_0057263 3300045049 Bacteria 2842
190 Ga0466959_0197141 3300045049 Bacteria 1403
191 Ga0466959_0320298 3300045049 Bacteria 1060
192 Ga0466959_0429528 3300045049 Bacteria 896
193 Ga0466959_0437546 3300045049 Unclassified 887
194 Ga0451576_1687038 3300045051 Unclassified 656
195 Ga0466958_0000658 3300045836 Bacteria 14922
196 Ga0466958_0010697 3300045836 Bacteria 5146
197 Ga0466958_0062715 3300045836 Unclassified 2266
198 Ga0466958_0137112 3300045836 Unclassified 1539
199 Ga0466958_0154425 3300045836 Bacteria 1448
200 Ga0466958_0171049 3300045836 Bacteria 1376
201 Ga0466958_0253352 3300045836 Bacteria 1126
202 Ga0466958_1136411 3300045836 Unclassified 510
203 Ga0466967_0025085 3300045976 Bacteria 4911
204 Ga0466967_0217604 3300045976 Bacteria 1814
205 Ga0466967_0256100 3300045976 Unclassified 1673
206 Ga0466967_0258959 3300045976 Bacteria 1664
207 Ga0466967_0285373 3300045976 Unclassified 1585
208 Ga0466967_1373755 3300045976 Bacteria 703
209 Ga0466967_1941714 3300045976 Unclassified 585
210 Ga0466967_2046721 3300045976 Bacteria 569
211 Ga0466967_2249405 3300045976 Unclassified 541
212 Ga0495664_0848169 3300046477 Bacteria 536
213 Ga0495618_0614415 3300046514 Bacteria 646
214 Ga0495652_0508035 3300046529 Unclassified 835
215 Ga0495640_0390749 3300046533 Unclassified 855
216 Ga0495676_0832355 3300047321 Unclassified 593
217 Ga0495680_0138572 3300047322 Bacteria 1782
218 Ga0495684_0873523 3300047471 Unclassified 581
219 Ga0496110_0911321 3300048913 Bacteria 785
220 Ga0496113_0276718 3300048916 Bacteria 1342
221 Ga0496113_0336330 3300048916 Bacteria 1211
222 nmdc:mga05p37_379004_c1 3300050507 Bacteria 1658
223 nmdc:mga0n895_63902_c1 3300050512 Bacteria 3640
224 nmdc:mga0rr50_43112_c1 3300050513 Bacteria 3299
225 nmdc:mga08x19_68115_c1 3300050514 Bacteria 2316
226 nmdc:mga0a205_70867_c1 3300050515 Bacteria 3366
227 Ga0495601_0102789 3300053077 Bacteria 1847
228 Ga0495601_0390485 3300053077 Bacteria 903
229 Ga0466962_0003722 3300061719 Bacteria 7277
230 Ga0466962_0149659 3300061719 Bacteria 1132
231 Ga0213875_10121811
232 Ga0070683_100001318
233 Ga0070683_100024404
234 Ga0070680_100000377
235 Ga0070682_100359804
236 Ga0070660_100010370
237 Ga0070661_100021851
238 Ga0070659_100016577
239 Ga0070713_100487184
240 Ga0070681_10007641
241 Ga0070679_100001463
242 Ga0070684_100001164
243 Ga0070684_100006789
244 Ga0068853_100237966
245 Ga0068855_100143086
246 Ga0068855_100152824
247 Ga0068855_102120013
248 Ga0070664_100128553
249 Ga0068857_100414959
250 Ga0068856_100005073
251 Ga0068856_100020228
252 Ga0068856_100055897
253 Ga0068856_101661085
254 Ga0068852_100025467
255 Ga0068852_100156093
256 Ga0070717_10127457
257 Ga0070717_10624436
258 Ga0075434_100048058
259 Ga0075436_100149585
260 Ga0075435_100300572
261 Ga0075435_101940725
262 Ga0105240_10054485
263 Ga0114129_10521219
264 Ga0105241_10888556
265 Ga0105237_10085960
266 Ga0105238_10243228
267 Ga0105239_13491957
268 Ga0157373_10446368
269 Ga0157370_10007489
270 Ga0157370_10148271
271 Ga0157370_11295904
272 Ga0157369_10184269
273 Ga0157369_10528161
274 Ga0157369_10776257
275 Ga0157372_10390417
276 Ga0157372_10901466
277 Ga0206353_10369643
278 Ga0154015_1350184
279 Ga0213874_10012114
280 Ga0213874_10168481
281 Ga0213874_10415920
282 Ga0213876_10037753
283 Ga0213876_10088771
284 Ga0213876_10116909
285 Ga0213876_10182721
286 Ga0213875_10007903
287 Ga0213875_10075021
288 Ga0213875_10560126
289 Ga0224712_10007891
290 Ga0207707_10024986
291 Ga0207695_10077200
292 Ga0207671_10787248
293 Ga0207660_10022124
294 Ga0207657_10041936
295 Ga0207649_10013307
296 Ga0207652_10024941
297 Ga0207694_10098186
298 Ga0207700_10427912
299 Ga0207664_10209459
300 Ga0207664_10807790
301 Ga0207644_10195729
302 Ga0207690_10028749
303 Ga0207661_10016335
304 Ga0207679_10297083
305 Ga0207667_10149953
306 Ga0207667_10779414
307 Ga0207667_11850162
308 Ga0207639_10081914
309 Ga0207702_10037107
310 Ga0207702_10069970
311 Ga0207702_10075856
312 Ga0207674_10134939
313 Ga0207698_10244328
314 Ga0207698_10317028
315 Ga0373935_0612444
316 Ga0373933_1026659
317 Ga0373937_0131069
318 Ga0395899_0390361
319 Ga0395899_0756895
320 Ga0395900_0018019
321 Ga0395900_1325453
322 Ga0395898_0084243
323 Ga0395898_0197831
324 Ga0395905_0083890
325 Ga0395905_0184463
326 Ga0395905_0872819
327 Ga0395905_0976003
328 Ga0436364_0111667
329 Ga0436364_0207633
330 Ga0436364_0242553
331 Ga0436364_0354286
332 Ga0436364_0758998
333 Ga0436364_0853893
334 Ga0436364_0859095
335 Ga0436364_0934308
336 Ga0436364_0934832
337 Ga0436364_0990911
338 Ga0436364_1019243
339 Ga0395901_0000956
340 Ga0395901_0083545
341 Ga0395901_0187738
342 Ga0395901_0469709
343 Ga0395901_0678912
344 Ga0436365_0074905
345 Ga0436365_0097479
346 Ga0436365_0136387
347 Ga0436365_0363744
348 Ga0436365_0435734
349 Ga0436365_0543216
350 Ga0436365_0786421
351 Ga0436365_1085223
352 Ga0436365_1174137
353 Ga0436365_1429493
354 Ga0436365_1455286
355 Ga0436360_1285891
356 Ga0436363_0349849
357 Ga0436363_0788846
358 Ga0436363_0875630
359 Ga0436363_1013078
360 Ga0436363_1244415
361 Ga0436363_1444466
362 Ga0436363_1455014
363 Ga0436363_1501493
364 Ga0436362_0129652
365 Ga0436362_0701385
366 Ga0451793_1552643
367 Ga0451802_1240834
368 Ga0451835_0332783
369 Ga0451841_0014152
370 Ga0451849_0638308
371 Ga0451851_1044443
372 Ga0451853_0851126
373 Ga0451853_1907954
374 Ga0466972_0510215
375 Ga0453683_0000350
376 Ga0466965_0166564
377 Ga0466965_0263623
378 Ga0466965_0506556
379 Ga0466966_0033547
380 Ga0466966_0063023
381 Ga0466966_0070430
382 Ga0466966_0180714
383 Ga0466966_0403855
384 Ga0466961_0005025
385 Ga0466961_0096437
386 Ga0466961_0322925
387 Ga0466961_0456419
388 Ga0466961_0527630
389 Ga0466963_0002944
390 Ga0466963_0033823
391 Ga0466963_0062239
392 Ga0466963_0185494
393 Ga0466963_0383870
394 Ga0466963_1238585
395 Ga0466964_0414244
396 Ga0466964_0448097
397 Ga0466964_0920716
398 Ga0466971_0013411
399 Ga0466971_0520202
400 Ga0466971_0634070
401 Ga0466968_0095119
402 Ga0466968_0146622
403 Ga0466968_0295298
404 Ga0466968_0316254
405 Ga0466968_0340286
406 Ga0466968_0723681
407 Ga0466968_0730340
408 Ga0466970_0028144
409 Ga0466970_0062652
410 Ga0466970_0904010
411 Ga0466957_0167242
412 Ga0466957_0232479
413 Ga0466957_0343457
414 Ga0466957_0467602
415 Ga0466957_0758491
416 Ga0466960_0266370
417 Ga0466960_0425276
418 Ga0466959_0012804
419 Ga0466959_0057263
420 Ga0466959_0197141
421 Ga0466959_0320298
422 Ga0466959_0429528
423 Ga0466959_0437546
424 Ga0451576_1687038
425 Ga0466958_0000658
426 Ga0466958_0010697
427 Ga0466958_0062715
428 Ga0466958_0137112
429 Ga0466958_0154425
430 Ga0466958_0171049
431 Ga0466958_0253352
432 Ga0466958_1136411
433 Ga0466967_0025085
434 Ga0466967_0217604
435 Ga0466967_0256100
436 Ga0466967_0258959
437 Ga0466967_0285373
438 Ga0466967_1373755
439 Ga0466967_1941714
440 Ga0466967_2046721
441 Ga0466967_2249405
442 Ga0495664_0848169
443 Ga0495618_0614415
444 Ga0495652_0508035
445 Ga0495640_0390749
446 Ga0495676_0832355
447 Ga0495680_0138572
448 Ga0495684_0873523
449 Ga0496110_0911321
450 Ga0496113_0276718
451 Ga0496113_0336330
452 nmdc:mga05p37_379004_c1
453 nmdc:mga0n895_63902_c1
454 nmdc:mga0rr50_43112_c1
455 nmdc:mga08x19_68115_c1
456 nmdc:mga0a205_70867_c1
457 Ga0495601_0102789
458 Ga0495601_0390485
459 Ga0466962_0003722
460 Ga0466962_0149659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04066

MrpF_PhaF

Multiple resistance and pH regulation protein F (MrpF / PhaF)

43

93

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gpn-assembly1.cif.gz_i architecture of mammalian respirasome 0.8558 8 83
7zd6-assembly1.cif.gz_K complex i from ovis aries, at ph7.4, open state 0.8524 9 83
5lc5-assembly1.cif.gz_K structure of mammalian respiratory complex i, class2 0.8523 10 83
5xtd-assembly1.cif.gz_k cryo-em structure of human respiratory complex i 0.8396 8 83
7ak5-assembly1.cif.gz_K cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a 0.8383 9 83
ID Description Score Start End Superfamily
5xtdk00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8396 8 83 1.10.287.3510
6g72K00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8235 9 83 1.10.287.3510
af_P03926_3_170_1.20.120.1200 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ 0.7542 6 84 1.20.120.1200
5xtdk00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7531 8 83 1.10.287.3510
af_Q91X86_50_207_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.738 1 85 1.20.1410.10
ID Description Score Start End GO Terms
AF-A0A0G2AMX8-F1-model_v4 Uncharacterized protein 0.9125 29 83 GO:0016020
AF-A0A7K4CEU2-F1-model_v4 Cation:proton antiporter 0.9101 2 83 GO:0016020
AF-A0A538BK59-F1-model_v4 Uncharacterized protein 0.8949 4 85 GO:0005886
GO:0015075
AF-A0A516Q285-F1-model_v4 Multisubunit sodium/proton antiporter, MrpF subunit 0.8941 5 81 GO:0005886
GO:0015075
AF-A0A6B1DNR4-F1-model_v4 Cation:proton antiporter 0.893 8 85 GO:0005886
GO:0015385

Map