F342976

General Info

Members Datasets Scaffolds Average Seq Length
230 176 460 120

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10719513|Ga0114129_107195133
Length 128
Sequence VQPVEKERQMAGVESRNFDSPDETRTPDKTRIELVGLGGGQIGRYTFQPGWRWSECIKPVVKTDSCQVEHVGYVVSGGLHVEHEDGSTGDVTAGDVYRIAPGHDAWVVGDQPAIFVEFQGATHYAEAK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
66 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
103 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
104 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
105 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
106 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
115 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
169 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
170 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
171 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
172 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
173 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
174 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
175 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
176 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.26
Metatranscriptomes 7.83
Isolates 3.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.83
Nodule 3.91
Rhizoplane 3.04
Rhizosphere 84.35
Stem 0
Stem Tuber 0
Unclassified 11.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10719513 3300009147 Unclassified 1281
2 Ga0058863_11869730 3300004799 Bacteria 693
3 Ga0058861_11866400 3300004800 Unclassified 790
4 Ga0058861_11932761 3300004800 Bacteria 599
5 Ga0058862_12322412 3300004803 Unclassified 590
6 Ga0058862_12712356 3300004803 Bacteria 716
7 Ga0058862_12879574 3300004803 Bacteria 638
8 Ga0070658_11613188 3300005327 Bacteria 562
9 Ga0070670_100241966 3300005331 Bacteria 1571
10 Ga0070670_100354482 3300005331 Bacteria 1289
11 Ga0070680_100342227 3300005336 Bacteria 1271
12 Ga0070680_101458384 3300005336 Bacteria 593
13 Ga0070660_100955406 3300005339 Bacteria 723
14 Ga0070692_10696548 3300005345 Bacteria 683
15 Ga0070671_100005469 3300005355 Bacteria 10138
16 Ga0070674_101748236 3300005356 Bacteria 563
17 Ga0070673_102240412 3300005364 Bacteria 519
18 Ga0070673_102339675 3300005364 Bacteria 508
19 Ga0070667_100821933 3300005367 Bacteria 863
20 Ga0070714_102432813 3300005435 Bacteria 509
21 Ga0070678_101040385 3300005456 Bacteria 754
22 Ga0070662_100911975 3300005457 Bacteria 750
23 Ga0070681_10181600 3300005458 Bacteria 2025
24 Ga0070681_10575425 3300005458 Bacteria 1040
25 Ga0070706_100054531 3300005467 Bacteria 3689
26 Ga0070699_100495622 3300005518 Bacteria 1109
27 Ga0070699_100837734 3300005518 Unclassified 842
28 Ga0070679_100205754 3300005530 Bacteria 1933
29 Ga0070679_100337311 3300005530 Bacteria 1456
30 Ga0070684_100010909 3300005535 Bacteria 7220
31 Ga0070684_100077885 3300005535 Bacteria 2929
32 Ga0068855_100244268 3300005563 Bacteria 2005
33 Ga0068855_101310494 3300005563 Bacteria 749
34 Ga0068854_100989060 3300005578 Bacteria 744
35 Ga0068856_100689146 3300005614 Bacteria 1042
36 Ga0068852_100840716 3300005616 Bacteria 933
37 Ga0068864_100133225 3300005618 Bacteria 2235
38 Ga0068861_100706354 3300005719 Bacteria 937
39 Ga0068861_101395105 3300005719 Bacteria 684
40 Ga0068863_100088186 3300005841 Bacteria 2940
41 Ga0068863_100091238 3300005841 Bacteria 2889
42 Ga0068858_100019719 3300005842 Bacteria 6305
43 Ga0068860_100061243 3300005843 Bacteria 3576
44 Ga0068860_100093939 3300005843 Bacteria 2859
45 Ga0081539_10024594 3300005985 Bacteria 3902
46 Ga0075365_10116922 3300006038 Bacteria 1836
47 Ga0075368_10002751 3300006042 Bacteria 5806
48 Ga0075363_100023570 3300006048 Bacteria 3121
49 Ga0075364_10002264 3300006051 Bacteria 10798
50 Ga0075364_10038507 3300006051 Bacteria 3097
51 Ga0075364_10082349 3300006051 Bacteria 2129
52 Ga0075432_10579317 3300006058 Bacteria 511
53 Ga0070716_100615389 3300006173 Bacteria 819
54 Ga0075362_10147570 3300006177 Bacteria 1127
55 Ga0075362_10586107 3300006177 Unclassified 575
56 Ga0075367_10020512 3300006178 Bacteria 3682
57 Ga0075370_10016812 3300006353 Bacteria 3942
58 Ga0075431_100046549 3300006847 Bacteria 4473
59 Ga0075433_10139013 3300006852 Bacteria 2159
60 Ga0075434_100098971 3300006871 Bacteria 2921
61 Ga0097620_103104791 3300006931 Unclassified 506
62 Ga0075435_100013914 3300007076 Bacteria 6001
63 Ga0105240_10005068 3300009093 Bacteria 19747
64 Ga0105240_10068937 3300009093 Bacteria 4380
65 Ga0111539_10607213 3300009094 Bacteria 1274
66 Ga0114129_10135233 3300009147 Bacteria 3383
67 Ga0105243_10898707 3300009148 Bacteria 881
68 Ga0105242_10224577 3300009176 Bacteria 1680
69 Ga0105237_10886975 3300009545 Bacteria 899
70 Ga0105238_10501517 3300009551 Bacteria 1215
71 Ga0105249_10684097 3300009553 Bacteria 1085
72 Ga0105249_11885003 3300009553 Bacteria 670
73 Ga0105239_10111593 3300010375 Bacteria 3031
74 Ga0105246_10859715 3300011119 Unclassified 810
75 Ga0157373_10445899 3300013100 Bacteria 931
76 Ga0157371_10404617 3300013102 Bacteria 999
77 Ga0157370_10032747 3300013104 Bacteria 5074
78 Ga0157369_10131659 3300013105 Unclassified 2650
79 Ga0157369_10337272 3300013105 Bacteria 1566
80 Ga0157369_12227455 3300013105 Bacteria 556
81 Ga0157374_10816709 3300013296 Bacteria 949
82 Ga0157374_11109257 3300013296 Unclassified 812
83 Ga0157378_10539023 3300013297 Unclassified 1171
84 Ga0157372_10534420 3300013307 Bacteria 1367
85 Ga0157372_12506100 3300013307 Unclassified 592
86 Ga0157375_11244224 3300013308 Bacteria 874
87 Ga0157379_10117814 3300014968 Bacteria 2389
88 Ga0206356_10060217 3300020070 Bacteria 601
89 Ga0206355_1507008 3300020076 Bacteria 688
90 Ga0206351_10673652 3300020077 Bacteria 1073
91 Ga0206354_11342298 3300020081 Bacteria 688
92 Ga0206353_10475305 3300020082 Bacteria 709
93 Ga0154015_1043319 3300020610 Bacteria 1394
94 Ga0213874_10322237 3300021377 Bacteria 586
95 Ga0224712_10062124 3300022467 Bacteria 1491
96 Ga0224712_10122377 3300022467 Bacteria 1128
97 Ga0207705_10487269 3300025909 Bacteria 957
98 Ga0207684_10391030 3300025910 Bacteria 1196
99 Ga0207707_10406095 3300025912 Unclassified 1169
100 Ga0207707_11146984 3300025912 Bacteria 631
101 Ga0207695_10734223 3300025913 Bacteria 868
102 Ga0207652_10125184 3300025921 Bacteria 2289
103 Ga0207652_10229545 3300025921 Bacteria 1673
104 Ga0207652_11037610 3300025921 Bacteria 719
105 Ga0207650_10184802 3300025925 Bacteria 1663
106 Ga0207650_10324308 3300025925 Bacteria 1262
107 Ga0207664_10351064 3300025929 Bacteria 1305
108 Ga0207664_10766630 3300025929 Bacteria 868
109 Ga0207644_10012774 3300025931 Bacteria 5583
110 Ga0207665_10381861 3300025939 Bacteria 1069
111 Ga0207667_11320186 3300025949 Bacteria 697
112 Ga0207667_11856071 3300025949 Unclassified 566
113 Ga0207640_10299923 3300025981 Bacteria 1271
114 Ga0207658_10915450 3300025986 Bacteria 799
115 Ga0207703_10065090 3300026035 Bacteria 2995
116 Ga0207702_11509896 3300026078 Bacteria 665
117 Ga0207641_10072150 3300026088 Bacteria 2973
118 Ga0207641_10220000 3300026088 Bacteria 1760
119 Ga0207676_10515834 3300026095 Bacteria 1137
120 Ga0207674_10103803 3300026116 Bacteria 2821
121 Ga0209983_1145797 3300027665 Bacteria 542
122 Ga0209813_10166606 3300027866 Bacteria 798
123 Ga0209974_10085711 3300027876 Bacteria 1088
124 Ga0207428_10158214 3300027907 Bacteria 1721
125 Ga0268264_10016444 3300028381 Bacteria 6057
126 Ga0268264_10041549 3300028381 Bacteria 3804
127 Ga0265338_10456973 3300028800 Unclassified 903
128 Ga0265338_10586279 3300028800 Bacteria 778
129 Ga0265320_10083918 3300031240 Bacteria 1484
130 Ga0307408_101274664 3300031548 Unclassified 688
131 Ga0307405_11767567 3300031731 Unclassified 549
132 Ga0307406_11132105 3300031901 Bacteria 677
133 Ga0307409_100218541 3300031995 Unclassified 1719
134 Ga0307409_100609391 3300031995 Bacteria 1080
135 Ga0307416_100028288 3300032002 Bacteria 4166
136 Ga0307416_101194571 3300032002 Bacteria 866
137 Ga0307416_101615978 3300032002 Unclassified 753
138 Ga0307415_100089171 3300032126 Bacteria 2227
139 Ga0373930_0000221 3300034816 Bacteria 7114
140 Ga0373928_0000537 3300035084 Bacteria 7374
141 Ga0373929_0021415 3300035085 Bacteria 1311
142 Ga0373949_0042086 3300035090 Bacteria 1126
143 Ga0373932_0000131 3300035112 Bacteria 21211
144 Ga0373931_0000006 3300035691 Bacteria 437006
145 Ga0373933_0371285 3300035724 Unclassified 931
146 Ga0373937_0016700 3300036401 Bacteria 6523
147 Ga0395898_0008302 3300037466 Bacteria 10978
148 Ga0395898_0399705 3300037466 Unclassified 1310
149 Ga0395905_0000828 3300037471 Bacteria 40415
150 Ga0395905_0001306 3300037471 Bacteria 30598
151 Ga0395905_0001930 3300037471 Bacteria 23804
152 Ga0395905_0178962 3300037471 Bacteria 1991
153 Ga0395901_0133605 3300038443 Bacteria 2608
154 Ga0395901_0311586 3300038443 Bacteria 1630
155 Ga0395901_0441483 3300038443 Unclassified 1332
156 Ga0395901_0941826 3300038443 Bacteria 843
157 Ga0436363_0283593 3300039450 Bacteria 579
158 Ga0439433_0035024 3300041999 Bacteria 1157
159 Ga0450923_121607 3300042125 Unclassified 616
160 Ga0439446_0059752 3300042156 Bacteria 1151
161 Ga0439434_0012366 3300042435 Bacteria 2526
162 Ga0439464_0004365 3300042439 Bacteria 3615
163 Ga0451577_0302369 3300042876 Bacteria 1450
164 Ga0453683_0079741 3300044673 Bacteria 2050
165 Ga0466961_0184556 3300044693 Bacteria 1294
166 Ga0466961_0907044 3300044693 Bacteria 525
167 Ga0466957_0166088 3300044842 Bacteria 1436
168 Ga0466957_0448700 3300044842 Bacteria 889
169 Ga0466959_0202287 3300045049 Bacteria 1382
170 Ga0451576_0850909 3300045051 Bacteria 957
171 Ga0466967_0486071 3300045976 Bacteria 1210
172 Ga0466967_0490355 3300045976 Bacteria 1205
173 Ga0466967_1013200 3300045976 Bacteria 827
174 Ga0495603_0096199 3300046455 Bacteria 1730
175 Ga0495653_0243251 3300046463 Bacteria 1198
176 Ga0495663_0240442 3300046525 Bacteria 640
177 Ga0495642_0118677 3300046528 Bacteria 1134
178 Ga0495586_0286026 3300046535 Bacteria 944
179 Ga0495633_0467471 3300046558 Bacteria 569
180 Ga0495656_0151487 3300046615 Bacteria 1120
181 Ga0495634_0056075 3300046642 Bacteria 2634
182 Ga0495661_0588579 3300046665 Bacteria 524
183 Ga0495588_0422303 3300046674 Bacteria 700
184 Ga0495600_0115860 3300046809 Unclassified 1744
185 Ga0495604_0201341 3300047317 Bacteria 1381
186 Ga0495676_0114693 3300047321 Bacteria 1971
187 Ga0496102_0210590 3300048905 Bacteria 1833
188 Ga0496104_0630344 3300048907 Bacteria 981
189 Ga0496105_0200053 3300048908 Bacteria 1631
190 Ga0496109_1013433 3300048912 Bacteria 768
191 Ga0496109_1176801 3300048912 Bacteria 703
192 Ga0496112_1680702 3300048915 Bacteria 547
193 Ga0496113_0936726 3300048916 Bacteria 684
194 Ga0501034_0000566 3300049571 Bacteria 58602
195 Ga0501034_0001863 3300049571 Bacteria 26757
196 Ga0501076_0783369 3300049592 Bacteria 787
197 Ga0501199_065662 3300049650 Unclassified 513
198 Ga0501079_1619927 3300049741 Bacteria 509
199 Ga0501083_0861024 3300049744 Bacteria 590
200 nmdc:mga03683_1720_c1 3300050489 Bacteria 6597
201 nmdc:mga00v17_515018_c1 3300050491 Bacteria 775
202 nmdc:mga00v17_6290_c1 3300050491 Bacteria 6296
203 nmdc:mga0yw44_153599_c1 3300050492 Bacteria 1503
204 nmdc:mga06z11_209758_c1 3300050494 Bacteria 1135
205 nmdc:mga04h51_68398_c1 3300050495 Bacteria 1234
206 nmdc:mga07m45_62191_c1 3300050496 Bacteria 2115
207 nmdc:mga05p37_281562_c1 3300050507 Bacteria 1983
208 nmdc:mga05p37_385633_c1 3300050507 Bacteria 1640
209 nmdc:mga05p37_727779_c1 3300050507 Bacteria 1098
210 nmdc:mga06r32_1166537_c1 3300050510 Unclassified 717
211 nmdc:mga06r32_58549_c1 3300050510 Bacteria 3703
212 nmdc:mga08y16_108215_c1 3300050511 Bacteria 2894
213 nmdc:mga0rr50_1347647_c1 3300050513 Bacteria 605
214 nmdc:mga08x19_61777_c1 3300050514 Bacteria 2428
215 nmdc:mga0a205_73193_c1 3300050515 Bacteria 3311
216 Ga0495619_0004417 3300053085 Bacteria 8972
217 Ga0587070_162291 3300059491 Bacteria 569
218 Ga0587077_125750 3300059493 Unclassified 645
219 Ga0587085_057858 3300059506 Bacteria 725
220 Ga0587111_0090434 3300060346 Unclassified 747
221 Ga0530510_0681455 3300061734 Bacteria 783
222 2871444820 2871444079 Bacteria 6423508
223 2937995916 2937994558 Bacteria 7036190
224 2958166388 2958165035 Bacteria 6906348
225 2961164850 2961163497 Bacteria 6901077
226 2965019676 2965018300 Bacteria 6883036
227 2968173252 2968171901 Bacteria 6894245
228 2970556342 2970554993 Bacteria 6814252
229 2987660859 2987659509 Bacteria 6966464
230 3004189907 3004188549 Bacteria 6952365
231 Ga0114129_10719513
232 Ga0058863_11869730
233 Ga0058861_11866400
234 Ga0058861_11932761
235 Ga0058862_12322412
236 Ga0058862_12712356
237 Ga0058862_12879574
238 Ga0070658_11613188
239 Ga0070670_100241966
240 Ga0070670_100354482
241 Ga0070680_100342227
242 Ga0070680_101458384
243 Ga0070660_100955406
244 Ga0070692_10696548
245 Ga0070671_100005469
246 Ga0070674_101748236
247 Ga0070673_102240412
248 Ga0070673_102339675
249 Ga0070667_100821933
250 Ga0070714_102432813
251 Ga0070678_101040385
252 Ga0070662_100911975
253 Ga0070681_10181600
254 Ga0070681_10575425
255 Ga0070706_100054531
256 Ga0070699_100495622
257 Ga0070699_100837734
258 Ga0070679_100205754
259 Ga0070679_100337311
260 Ga0070684_100010909
261 Ga0070684_100077885
262 Ga0068855_100244268
263 Ga0068855_101310494
264 Ga0068854_100989060
265 Ga0068856_100689146
266 Ga0068852_100840716
267 Ga0068864_100133225
268 Ga0068861_100706354
269 Ga0068861_101395105
270 Ga0068863_100088186
271 Ga0068863_100091238
272 Ga0068858_100019719
273 Ga0068860_100061243
274 Ga0068860_100093939
275 Ga0081539_10024594
276 Ga0075365_10116922
277 Ga0075368_10002751
278 Ga0075363_100023570
279 Ga0075364_10002264
280 Ga0075364_10038507
281 Ga0075364_10082349
282 Ga0075432_10579317
283 Ga0070716_100615389
284 Ga0075362_10147570
285 Ga0075362_10586107
286 Ga0075367_10020512
287 Ga0075370_10016812
288 Ga0075431_100046549
289 Ga0075433_10139013
290 Ga0075434_100098971
291 Ga0097620_103104791
292 Ga0075435_100013914
293 Ga0105240_10005068
294 Ga0105240_10068937
295 Ga0111539_10607213
296 Ga0114129_10135233
297 Ga0105243_10898707
298 Ga0105242_10224577
299 Ga0105237_10886975
300 Ga0105238_10501517
301 Ga0105249_10684097
302 Ga0105249_11885003
303 Ga0105239_10111593
304 Ga0105246_10859715
305 Ga0157373_10445899
306 Ga0157371_10404617
307 Ga0157370_10032747
308 Ga0157369_10131659
309 Ga0157369_10337272
310 Ga0157369_12227455
311 Ga0157374_10816709
312 Ga0157374_11109257
313 Ga0157378_10539023
314 Ga0157372_10534420
315 Ga0157372_12506100
316 Ga0157375_11244224
317 Ga0157379_10117814
318 Ga0206356_10060217
319 Ga0206355_1507008
320 Ga0206351_10673652
321 Ga0206354_11342298
322 Ga0206353_10475305
323 Ga0154015_1043319
324 Ga0213874_10322237
325 Ga0224712_10062124
326 Ga0224712_10122377
327 Ga0207705_10487269
328 Ga0207684_10391030
329 Ga0207707_10406095
330 Ga0207707_11146984
331 Ga0207695_10734223
332 Ga0207652_10125184
333 Ga0207652_10229545
334 Ga0207652_11037610
335 Ga0207650_10184802
336 Ga0207650_10324308
337 Ga0207664_10351064
338 Ga0207664_10766630
339 Ga0207644_10012774
340 Ga0207665_10381861
341 Ga0207667_11320186
342 Ga0207667_11856071
343 Ga0207640_10299923
344 Ga0207658_10915450
345 Ga0207703_10065090
346 Ga0207702_11509896
347 Ga0207641_10072150
348 Ga0207641_10220000
349 Ga0207676_10515834
350 Ga0207674_10103803
351 Ga0209983_1145797
352 Ga0209813_10166606
353 Ga0209974_10085711
354 Ga0207428_10158214
355 Ga0268264_10016444
356 Ga0268264_10041549
357 Ga0265338_10456973
358 Ga0265338_10586279
359 Ga0265320_10083918
360 Ga0307408_101274664
361 Ga0307405_11767567
362 Ga0307406_11132105
363 Ga0307409_100218541
364 Ga0307409_100609391
365 Ga0307416_100028288
366 Ga0307416_101194571
367 Ga0307416_101615978
368 Ga0307415_100089171
369 Ga0373930_0000221
370 Ga0373928_0000537
371 Ga0373929_0021415
372 Ga0373949_0042086
373 Ga0373932_0000131
374 Ga0373931_0000006
375 Ga0373933_0371285
376 Ga0373937_0016700
377 Ga0395898_0008302
378 Ga0395898_0399705
379 Ga0395905_0000828
380 Ga0395905_0001306
381 Ga0395905_0001930
382 Ga0395905_0178962
383 Ga0395901_0133605
384 Ga0395901_0311586
385 Ga0395901_0441483
386 Ga0395901_0941826
387 Ga0436363_0283593
388 Ga0439433_0035024
389 Ga0450923_121607
390 Ga0439446_0059752
391 Ga0439434_0012366
392 Ga0439464_0004365
393 Ga0451577_0302369
394 Ga0453683_0079741
395 Ga0466961_0184556
396 Ga0466961_0907044
397 Ga0466957_0166088
398 Ga0466957_0448700
399 Ga0466959_0202287
400 Ga0451576_0850909
401 Ga0466967_0486071
402 Ga0466967_0490355
403 Ga0466967_1013200
404 Ga0495603_0096199
405 Ga0495653_0243251
406 Ga0495663_0240442
407 Ga0495642_0118677
408 Ga0495586_0286026
409 Ga0495633_0467471
410 Ga0495656_0151487
411 Ga0495634_0056075
412 Ga0495661_0588579
413 Ga0495588_0422303
414 Ga0495600_0115860
415 Ga0495604_0201341
416 Ga0495676_0114693
417 Ga0496102_0210590
418 Ga0496104_0630344
419 Ga0496105_0200053
420 Ga0496109_1013433
421 Ga0496109_1176801
422 Ga0496112_1680702
423 Ga0496113_0936726
424 Ga0501034_0000566
425 Ga0501034_0001863
426 Ga0501076_0783369
427 Ga0501199_065662
428 Ga0501079_1619927
429 Ga0501083_0861024
430 nmdc:mga03683_1720_c1
431 nmdc:mga00v17_515018_c1
432 nmdc:mga00v17_6290_c1
433 nmdc:mga0yw44_153599_c1
434 nmdc:mga06z11_209758_c1
435 nmdc:mga04h51_68398_c1
436 nmdc:mga07m45_62191_c1
437 nmdc:mga05p37_281562_c1
438 nmdc:mga05p37_385633_c1
439 nmdc:mga05p37_727779_c1
440 nmdc:mga06r32_1166537_c1
441 nmdc:mga06r32_58549_c1
442 nmdc:mga08y16_108215_c1
443 nmdc:mga0rr50_1347647_c1
444 nmdc:mga08x19_61777_c1
445 nmdc:mga0a205_73193_c1
446 Ga0495619_0004417
447 Ga0587070_162291
448 Ga0587077_125750
449 Ga0587085_057858
450 Ga0587111_0090434
451 Ga0530510_0681455
452 2871444820
453 2937995916
454 2958166388
455 2961164850
456 2965019676
457 2968173252
458 2970556342
459 2987660859
460 3004189907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xcv-assembly1.cif.gz_A crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7874 39 116
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.7867 37 116
6m9s-assembly2.cif.gz_D crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7862 39 116
2q1z-assembly2.cif.gz_D crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.7712 20 116
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.7575 9 115
ID Description Score Start End Superfamily
3lwcA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.766 24 115 2.60.120.10
af_Q55GT9_408_527_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.765 19 44 3.10.110.10
af_P77626_84_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7526 37 115 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7517 27 115 2.60.120.10
af_P0A9U6_79_184_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7397 17 115 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538EBJ9-F1-model_v4 Cupin domain-containing protein 0.9989 44 114
AF-A0A0K2R360-F1-model_v4 deleted 0.9974 5 123
AF-A0A3A0F6X0-F1-model_v4 Guanylate cyclase domain-containing protein 0.9969 9 123 GO:0004016
GO:0009190
GO:0035556
AF-D0J0C6-F1-model_v4 deleted 0.9948 30 124
AF-A0A1F3X417-F1-model_v4 Cupin 0.9933 16 124

Map