F342947

General Info

Members Datasets Scaffolds Average Seq Length
230 125 218 277

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10000139|Ga0099794_1000013912
Length 307
Sequence VIAPGTAPPGTAYQEIRLERVETGARKRPRFELRQPAGQLAFDATGVVVAAVMLFPIYWMVATAFKPGRDILSLTPKWFPDPFTVQNFQDAIARPYFLEDVRNSLIVVAAMLAISLAVAFLAAVGVARFGFKGRTAFLIMIIGVQLVPLNSLIIPLYLMLDGVGQTDALPGVIAIYLAVVLPFMVWTLRGFVANIPVELEEAAMIDGCTRVGAFFRITFPLVGPGLVATAVFGFIQAWNEYIIAYVLLSSPGNQTLTVWLASFTTNHGPEWGPLMAAATLTGLPVVAFFLIVQRYLAGGLTAGAVKG

Samples

Sample ID Description Type Environment
1 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
2 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
3 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
4 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
5 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
6 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
7 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
8 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
79 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
93 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
94 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
115 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
116 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
119 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
122 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
123 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
124 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
125 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.78
Metatranscriptomes 0
Isolates 5.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 0
Rhizosphere 94.35
Stem 0
Stem Tuber 0
Unclassified 3.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10009795 3300003203 Bacteria 4279
2 rootH2_10039287 3300003320 Bacteria 7675
3 Ga0070680_100303802 3300005336 Bacteria 1353
4 Ga0070667_100076080 3300005367 Bacteria 2866
5 Ga0070714_100005209 3300005435 Bacteria 9896
6 Ga0070714_100402165 3300005435 Bacteria 1294
7 Ga0070701_10176640 3300005438 Bacteria 1247
8 Ga0070705_100055767 3300005440 Bacteria 2324
9 Ga0070708_100000014 3300005445 Bacteria 130264
10 Ga0070708_100005499 3300005445 Bacteria 10046
11 Ga0070708_100009268 3300005445 Bacteria 7933
12 Ga0070708_100024333 3300005445 Bacteria 5165
13 Ga0070708_100056487 3300005445 Bacteria 3492
14 Ga0070708_100069287 3300005445 Bacteria 3172
15 Ga0070708_100126421 3300005445 Bacteria 2363
16 Ga0070708_100192756 3300005445 Bacteria 1906
17 Ga0070708_100222191 3300005445 Bacteria 1771
18 Ga0070708_100289270 3300005445 Bacteria 1543
19 Ga0070708_100436344 3300005445 Bacteria 1235
20 Ga0070678_100011739 3300005456 Bacteria 5417
21 Ga0068867_100365564 3300005459 Bacteria 1208
22 Ga0070706_100000036 3300005467 Bacteria 151766
23 Ga0070706_100000096 3300005467 Bacteria 106439
24 Ga0070706_100000148 3300005467 Bacteria 89214
25 Ga0070706_100000231 3300005467 Bacteria 68414
26 Ga0070706_100001022 3300005467 Bacteria 30362
27 Ga0070706_100042558 3300005467 Bacteria 4197
28 Ga0070706_100044834 3300005467 Bacteria 4085
29 Ga0070706_100138679 3300005467 Bacteria 2270
30 Ga0070706_100170933 3300005467 Bacteria 2029
31 Ga0070706_100217203 3300005467 Bacteria 1785
32 Ga0070707_100000195 3300005468 Bacteria 60549
33 Ga0070707_100000961 3300005468 Bacteria 28611
34 Ga0070707_100007680 3300005468 Bacteria 10014
35 Ga0070707_100009503 3300005468 Bacteria 9035
36 Ga0070707_100009604 3300005468 Bacteria 8987
37 Ga0070707_100010630 3300005468 Bacteria 8574
38 Ga0070707_100097740 3300005468 Bacteria 2844
39 Ga0070707_100128168 3300005468 Bacteria 2466
40 Ga0070707_100172713 3300005468 Bacteria 2106
41 Ga0070707_100217330 3300005468 Bacteria 1862
42 Ga0070707_100539541 3300005468 Bacteria 1128
43 Ga0070707_100630295 3300005468 Unclassified 1035
44 Ga0070698_100003604 3300005471 Bacteria 17018
45 Ga0070698_100020222 3300005471 Bacteria 6979
46 Ga0070698_100035990 3300005471 Bacteria 5117
47 Ga0070698_100042587 3300005471 Bacteria 4657
48 Ga0070698_100052726 3300005471 Bacteria 4136
49 Ga0070698_100078375 3300005471 Bacteria 3302
50 Ga0070698_100140365 3300005471 Bacteria 2368
51 Ga0070698_100182526 3300005471 Bacteria 2036
52 Ga0070699_100000134 3300005518 Bacteria 68781
53 Ga0070699_100000387 3300005518 Bacteria 42737
54 Ga0070699_100000395 3300005518 Bacteria 42275
55 Ga0070699_100000715 3300005518 Bacteria 30819
56 Ga0070699_100001052 3300005518 Bacteria 25646
57 Ga0070699_100021265 3300005518 Bacteria 5595
58 Ga0070699_100025018 3300005518 Bacteria 5147
59 Ga0070699_100036919 3300005518 Bacteria 4227
60 Ga0070699_100497963 3300005518 Bacteria 1107
61 Ga0070697_100000004 3300005536 Bacteria 284078
62 Ga0070697_100000840 3300005536 Bacteria 23074
63 Ga0070697_100006820 3300005536 Bacteria 8862
64 Ga0070697_100017390 3300005536 Bacteria 5657
65 Ga0070697_100020775 3300005536 Bacteria 5199
66 Ga0070697_100026948 3300005536 Bacteria 4596
67 Ga0070697_100130287 3300005536 Bacteria 2109
68 Ga0070686_100262285 3300005544 Bacteria 1267
69 Ga0070695_100001150 3300005545 Bacteria 14516
70 Ga0070696_100066021 3300005546 Bacteria 2537
71 Ga0068855_100246782 3300005563 Bacteria 1993
72 Ga0081455_10019807 3300005937 Bacteria 6354
73 Ga0081539_10000288 3300005985 Bacteria 113905
74 Ga0070717_10000105 3300006028 Bacteria 66343
75 Ga0070717_10000942 3300006028 Bacteria 19379
76 Ga0070717_10003630 3300006028 Bacteria 11067
77 Ga0070717_10004920 3300006028 Bacteria 9718
78 Ga0070717_10503410 3300006028 Bacteria 1095
79 Ga0070717_10744900 3300006028 Bacteria 891
80 Ga0075364_10143870 3300006051 Bacteria 1605
81 Ga0070715_10007970 3300006163 Bacteria 3671
82 Ga0070712_100418714 3300006175 Bacteria 1110
83 Ga0075433_10072577 3300006852 Bacteria 3027
84 Ga0075433_10186471 3300006852 Bacteria 1846
85 Ga0068865_100127790 3300006881 Bacteria 1900
86 Ga0075436_100008595 3300006914 Bacteria 6979
87 Ga0075436_100019774 3300006914 Bacteria 4618
88 Ga0075436_100081230 3300006914 Bacteria 2247
89 Ga0075436_100089476 3300006914 Bacteria 2139
90 Ga0075436_100132572 3300006914 Bacteria 1748
91 Ga0075435_100014298 3300007076 Bacteria 5927
92 Ga0075435_100018630 3300007076 Bacteria 5287
93 Ga0099794_10000139 3300007265 Bacteria 26801
94 Ga0099794_10003791 3300007265 Bacteria 5834
95 Ga0099794_10122145 3300007265 Bacteria 1311
96 Ga0111539_10079025 3300009094 Bacteria 3869
97 Ga0111539_10806621 3300009094 Bacteria 1092
98 Ga0105243_10136691 3300009148 Bacteria 2086
99 Ga0105237_10318992 3300009545 Bacteria 1557
100 Ga0105249_10009439 3300009553 Bacteria 8541
101 Ga0157369_10010860 3300013105 Bacteria 10373
102 Ga0157375_10458560 3300013308 Bacteria 1440
103 Ga0213872_10004550 3300021361 Bacteria 7332
104 Ga0213874_10072587 3300021377 Bacteria 1101
105 Ga0207684_10000002 3300025910 Bacteria 1042751
106 Ga0207684_10000010 3300025910 Bacteria 552805
107 Ga0207684_10000020 3300025910 Bacteria 342787
108 Ga0207684_10000054 3300025910 Bacteria 220915
109 Ga0207684_10000084 3300025910 Bacteria 176027
110 Ga0207684_10000640 3300025910 Bacteria 41431
111 Ga0207684_10004920 3300025910 Bacteria 12462
112 Ga0207684_10085742 3300025910 Bacteria 2682
113 Ga0207684_10106590 3300025910 Bacteria 2397
114 Ga0207684_10154814 3300025910 Bacteria 1973
115 Ga0207646_10000021 3300025922 Bacteria 272003
116 Ga0207646_10000031 3300025922 Bacteria 219144
117 Ga0207646_10000196 3300025922 Bacteria 81941
118 Ga0207646_10000385 3300025922 Bacteria 59352
119 Ga0207646_10001140 3300025922 Bacteria 33868
120 Ga0207646_10005676 3300025922 Bacteria 13087
121 Ga0207646_10007146 3300025922 Bacteria 11416
122 Ga0207646_10007329 3300025922 Bacteria 11237
123 Ga0207646_10007576 3300025922 Bacteria 11002
124 Ga0207646_10010769 3300025922 Bacteria 8898
125 Ga0207646_10020477 3300025922 Bacteria 6128
126 Ga0207646_10062730 3300025922 Bacteria 3318
127 Ga0207700_10051035 3300025928 Bacteria 3085
128 Ga0207700_10171934 3300025928 Bacteria 1808
129 Ga0207664_10140862 3300025929 Bacteria 2040
130 Ga0207664_10152166 3300025929 Bacteria 1966
131 Ga0207706_10249690 3300025933 Bacteria 1550
132 Ga0207709_10058836 3300025935 Bacteria 2390
133 Ga0207665_10006710 3300025939 Bacteria 7633
134 Ga0207691_10189775 3300025940 Bacteria 1792
135 Ga0207712_10047313 3300025961 Bacteria 2986
136 Ga0207668_10078447 3300025972 Bacteria 2385
137 Ga0207658_10177650 3300025986 Bacteria 1759
138 Ga0207677_10219241 3300026023 Bacteria 1525
139 Ga0207708_10058771 3300026075 Bacteria 2934
140 Ga0207675_100000692 3300026118 Bacteria 33306
141 Ga0207683_10033890 3300026121 Bacteria 4437
142 Ga0209588_1000137 3300027671 Bacteria 21215
143 Ga0209588_1002097 3300027671 Bacteria 5383
144 Ga0265319_1073749 3300028563 Bacteria 1091
145 Ga0307405_10012914 3300031731 Bacteria 4440
146 Ga0307405_10116561 3300031731 Bacteria 1819
147 Ga0307413_10336501 3300031824 Bacteria 1159
148 Ga0307410_10007479 3300031852 Bacteria 5982
149 Ga0307410_10176115 3300031852 Bacteria 1616
150 Ga0307406_10017725 3300031901 Bacteria 4150
151 Ga0307412_10141791 3300031911 Bacteria 1761
152 Ga0307416_100003243 3300032002 Bacteria 9532
153 Ga0307416_100075664 3300032002 Bacteria 2818
154 Ga0307411_10219539 3300032005 Bacteria 1474
155 Ga0307411_10306276 3300032005 Bacteria 1276
156 Ga0373945_0145190 3300035116 Bacteria 959
157 Ga0373947_0577064 3300035725 Unclassified 766
158 Ga0373925_0074940 3300037068 Bacteria 2564
159 Ga0395898_0128774 3300037466 Bacteria 2425
160 Ga0395901_0083754 3300038443 Bacteria 3334
161 Ga0436360_1338869 3300039438 Unclassified 1309
162 Ga0436361_0286503 3300039447 Bacteria 9972
163 Ga0436363_1343257 3300039450 Bacteria 1481
164 Ga0450893_0017554 3300042532 Bacteria 1216
165 Ga0466957_0467465 3300044842 Bacteria 871
166 Ga0451576_0549179 3300045051 Bacteria 1214
167 Ga0495592_0255567 3300046454 Bacteria 1156
168 Ga0495591_029925 3300046458 Bacteria 1649
169 Ga0495629_0011823 3300046459 Bacteria 6333
170 Ga0495605_0088174 3300046474 Bacteria 1442
171 Ga0495596_0058907 3300046500 Bacteria 1497
172 Ga0495618_0067923 3300046514 Unclassified 2267
173 Ga0495652_0032210 3300046529 Bacteria 4586
174 Ga0495635_0059193 3300046663 Bacteria 2634
175 Ga0495646_0191931 3300046680 Bacteria 1116
176 Ga0495658_0225542 3300046683 Bacteria 1174
177 Ga0495624_0091564 3300046690 Unclassified 1876
178 Ga0495671_0080826 3300046692 Bacteria 1593
179 Ga0495604_0154919 3300047317 Unclassified 1624
180 Ga0495674_0008392 3300047319 Bacteria 9846
181 Ga0495684_0060407 3300047471 Unclassified 2886
182 Ga0495602_0050796 3300048088 Unclassified 3702
183 Ga0501032_0104427 3300049569 Bacteria 1877
184 Ga0501034_0028046 3300049571 Bacteria 5726
185 Ga0501034_0084152 3300049571 Bacteria 3183
186 Ga0501036_0001032 3300049572 Bacteria 21031
187 Ga0501036_0041628 3300049572 Bacteria 3886
188 Ga0501037_0107680 3300049573 Bacteria 2008
189 Ga0501038_0027101 3300049574 Bacteria 5100
190 Ga0501038_0123126 3300049574 Bacteria 2136
191 Ga0501043_0025684 3300049579 Bacteria 4622
192 Ga0501043_0034115 3300049579 Bacteria 4003
193 Ga0501047_0004363 3300049581 Bacteria 13310
194 Ga0501048_0010755 3300049582 Bacteria 6824
195 Ga0501073_0060781 3300049589 Bacteria 2637
196 Ga0501074_0000518 3300049590 Bacteria 23708
197 Ga0501076_0446195 3300049592 Bacteria 1065
198 Ga0501080_0100514 3300049742 Bacteria 2683
199 Ga0501083_0066284 3300049744 Bacteria 2404
200 nmdc:mga00v17_207483_c1 3300050491 Bacteria 1267
201 nmdc:mga0yw44_6214_c1 3300050492 Bacteria 5746
202 nmdc:mga0n895_490366_c1 3300050512 Bacteria 1239
203 nmdc:mga0rr50_305879_c1 3300050513 Bacteria 1331
204 nmdc:mga0rr50_340916_c1 3300050513 Bacteria 1259
205 nmdc:mga08x19_165048_c1 3300050514 Bacteria 1506
206 nmdc:mga08x19_17008_c1 3300050514 Bacteria 4445
207 nmdc:mga08x19_17462_c1 3300050514 Bacteria 4390
208 nmdc:mga08x19_42815_c1 3300050514 Bacteria 2888
209 nmdc:mga08x19_9349_c1 3300050514 Bacteria 5866
210 nmdc:mga0a205_100731_c1 3300050515 Bacteria 2788
211 nmdc:mga0a205_188408_c1 3300050515 Bacteria 1955
212 nmdc:mga0a205_255001_c1 3300050515 Bacteria 1633
213 nmdc:mga0a205_26996_c1 3300050515 Bacteria 5482
214 Ga0495601_0001637 3300053077 Bacteria 12352
215 Ga0495612_0063215 3300053078 Unclassified 1535
216 Ga0495595_0069431 3300053084 Unclassified 1663
217 Ga0495619_0000503 3300053085 Bacteria 26179
218 Ga0500641_0001058 3300053096 Bacteria 9822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0145190 Ga0373945_0145190_217_942 202
2 3300035725 Ga0373947_0577064 Ga0373947_0577064_22_747 202
3 3300005467 Ga0070706_100217203 Ga0070706_1002172032 230
4 3300005468 Ga0070707_100000195 Ga0070707_10000019517 230
5 3300025910 Ga0207684_10106590 Ga0207684_101065903 230
6 3300025922 Ga0207646_10007146 Ga0207646_100071464 230
7 3300028563 Ga0265319_1073749 Ga0265319_10737492 233
8 3300013308 Ga0157375_10458560 Ga0157375_104585602 236
9 3300026121 Ga0207683_10033890 Ga0207683_100338902 236
10 3300005536 Ga0070697_100130287 Ga0070697_1001302871 237
11 3300032005 Ga0307411_10219539 Ga0307411_102195392 237
12 3300005445 Ga0070708_100024333 Ga0070708_1000243334 239
13 3300005445 Ga0070708_100289270 Ga0070708_1002892702 239
14 3300005467 Ga0070706_100000036 Ga0070706_10000003623 239
15 3300005467 Ga0070706_100000096 Ga0070706_10000009619 239
16 3300005468 Ga0070707_100010630 Ga0070707_1000106306 239
17 3300005536 Ga0070697_100026948 Ga0070697_1000269482 239
18 3300006028 Ga0070717_10004920 Ga0070717_100049209 239
19 3300025910 Ga0207684_10000054 Ga0207684_1000005419 239
20 3300031824 Ga0307413_10336501 Ga0307413_103365012 239
21 3300044842 Ga0466957_0467465 Ga0466957_0467465_11_853 239
22 3300050515 nmdc:mga0a205_255001_c1 nmdc:mga0a205_255001_c1_458_1291 239
23 3300049571 Ga0501034_0028046 Ga0501034_0028046_1904_2746 240
24 3300049572 Ga0501036_0001032 Ga0501036_0001032_15384_16226 240
25 3300049573 Ga0501037_0107680 Ga0501037_0107680_520_1362 240
26 3300049574 Ga0501038_0027101 Ga0501038_0027101_404_1246 240
27 3300049579 Ga0501043_0034115 Ga0501043_0034115_265_1107 240
28 3300049581 Ga0501047_0004363 Ga0501047_0004363_1638_2480 240
29 3300049582 Ga0501048_0010755 Ga0501048_0010755_2327_3169 240
30 3300049590 Ga0501074_0000518 Ga0501074_0000518_11833_12675 240
31 3300049592 Ga0501076_0446195 Ga0501076_0446195_56_898 240
32 3300005563 Ga0068855_100246782 Ga0068855_1002467822 242
33 3300005367 Ga0070667_100076080 Ga0070667_1000760803 244
34 3300025929 Ga0207664_10140862 Ga0207664_101408622 244
35 3300025986 Ga0207658_10177650 Ga0207658_101776502 244
36 3300050514 nmdc:mga08x19_165048_c1 nmdc:mga08x19_165048_c1_135_1040 245
37 3300005468 Ga0070707_100217330 Ga0070707_1002173302 246
38 3300025922 Ga0207646_10005676 Ga0207646_100056766 246
39 3300005456 Ga0070678_100011739 Ga0070678_1000117392 248
40 3300006163 Ga0070715_10007970 Ga0070715_100079702 248
41 3300013105 Ga0157369_10010860 Ga0157369_100108602 248
42 3300050515 nmdc:mga0a205_26996_c1 nmdc:mga0a205_26996_c1_30_917 248
43 3300005518 Ga0070699_100000715 Ga0070699_10000071511 250
44 3300031731 Ga0307405_10116561 Ga0307405_101165611 250
45 3300031852 Ga0307410_10176115 Ga0307410_101761152 250
46 3300032002 Ga0307416_100075664 Ga0307416_1000756642 250
47 3300037466 Ga0395898_0128774 Ga0395898_0128774_849_1763 250
48 3300038443 Ga0395901_0083754 Ga0395901_0083754_1917_2831 250
49 iso_pu_bacteria 2795385472 2795794429 250
50 3300005438 Ga0070701_10176640 Ga0070701_101766402 251
51 3300005544 Ga0070686_100262285 Ga0070686_1002622851 251
52 3300006051 Ga0075364_10143870 Ga0075364_101438702 251
53 3300009094 Ga0111539_10079025 Ga0111539_100790253 251
54 3300050491 nmdc:mga00v17_207483_c1 nmdc:mga00v17_207483_c1_220_1134 251
55 3300050492 nmdc:mga0yw44_6214_c1 nmdc:mga0yw44_6214_c1_1647_2561 251
56 3300031731 Ga0307405_10012914 Ga0307405_100129144 252
57 3300031852 Ga0307410_10007479 Ga0307410_100074795 252
58 3300031901 Ga0307406_10017725 Ga0307406_100177253 252
59 3300031911 Ga0307412_10141791 Ga0307412_101417912 252
60 3300032002 Ga0307416_100003243 Ga0307416_1000032438 252
61 3300032005 Ga0307411_10306276 Ga0307411_103062762 252
62 3300046474 Ga0495605_0088174 Ga0495605_0088174_59_880 252
63 3300046500 Ga0495596_0058907 Ga0495596_0058907_318_1139 252
64 3300046692 Ga0495671_0080826 Ga0495671_0080826_280_1110 252
65 iso_pu_bacteria 2795385470 2795781671 252
66 iso_pu_bacteria 8053945823 8053946918 252
67 3300021377 Ga0213874_10072587 Ga0213874_100725872 253
68 3300039450 Ga0436363_1343257 Ga0436363_1343257_248_1069 253
69 3300053096 Ga0500641_0001058 Ga0500641_0001058_7322_8203 254
70 3300005435 Ga0070714_100402165 Ga0070714_1004021652 255
71 3300005445 Ga0070708_100126421 Ga0070708_1001264212 255
72 3300005445 Ga0070708_100222191 Ga0070708_1002221912 255
73 3300005467 Ga0070706_100042558 Ga0070706_1000425583 255
74 3300005468 Ga0070707_100128168 Ga0070707_1001281682 255
75 3300005468 Ga0070707_100172713 Ga0070707_1001727133 255
76 3300005471 Ga0070698_100035990 Ga0070698_1000359902 255
77 3300005471 Ga0070698_100052726 Ga0070698_1000527263 255
78 3300005518 Ga0070699_100000134 Ga0070699_10000013446 255
79 3300005518 Ga0070699_100025018 Ga0070699_1000250186 255
80 3300005536 Ga0070697_100020775 Ga0070697_1000207753 255
81 3300006028 Ga0070717_10003630 Ga0070717_100036308 255
82 3300006028 Ga0070717_10744900 Ga0070717_107449001 255
83 3300006175 Ga0070712_100418714 Ga0070712_1004187142 255
84 3300006914 Ga0075436_100008595 Ga0075436_1000085953 255
85 3300006914 Ga0075436_100019774 Ga0075436_1000197742 255
86 3300006914 Ga0075436_100132572 Ga0075436_1001325722 255
87 3300009553 Ga0105249_10009439 Ga0105249_100094394 255
88 3300025910 Ga0207684_10085742 Ga0207684_100857423 255
89 3300025922 Ga0207646_10000385 Ga0207646_1000038517 255
90 3300025922 Ga0207646_10007329 Ga0207646_100073293 255
91 3300025928 Ga0207700_10171934 Ga0207700_101719342 255
92 3300025961 Ga0207712_10047313 Ga0207712_100473133 255
93 3300025972 Ga0207668_10078447 Ga0207668_100784472 255
94 3300026118 Ga0207675_100000692 Ga0207675_10000069221 255
95 3300050514 nmdc:mga08x19_17008_c1 nmdc:mga08x19_17008_c1_687_1514 255
96 3300050514 nmdc:mga08x19_17462_c1 nmdc:mga08x19_17462_c1_1618_2445 255
97 iso_pu_bacteria 2856741275 2856746343 255
98 iso_pu_bacteria 2873314349 2873321389 255
99 iso_pu_bacteria 2895442618 2895449413 255
100 iso_pu_bacteria 8055066027 8055073049 255
101 iso_pu_bacteria 8055172936 8055173402 255
102 3300005336 Ga0070680_100303802 Ga0070680_1003038022 256
103 3300005445 Ga0070708_100009268 Ga0070708_1000092688 256
104 3300005445 Ga0070708_100436344 Ga0070708_1004363442 256
105 3300005467 Ga0070706_100000148 Ga0070706_10000014873 256
106 3300005467 Ga0070706_100044834 Ga0070706_1000448342 256
107 3300005467 Ga0070706_100170933 Ga0070706_1001709332 256
108 3300005468 Ga0070707_100539541 Ga0070707_1005395411 256
109 3300005468 Ga0070707_100630295 Ga0070707_1006302952 256
110 3300005471 Ga0070698_100003604 Ga0070698_1000036049 256
111 3300005471 Ga0070698_100042587 Ga0070698_1000425873 256
112 3300005471 Ga0070698_100078375 Ga0070698_1000783752 256
113 3300005471 Ga0070698_100140365 Ga0070698_1001403652 256
114 3300005471 Ga0070698_100182526 Ga0070698_1001825262 256
115 3300005518 Ga0070699_100000395 Ga0070699_10000039544 256
116 3300005518 Ga0070699_100497963 Ga0070699_1004979632 256
117 3300005536 Ga0070697_100000004 Ga0070697_100000004221 256
118 3300005536 Ga0070697_100006820 Ga0070697_1000068204 256
119 3300005937 Ga0081455_10019807 Ga0081455_100198074 256
120 3300006028 Ga0070717_10503410 Ga0070717_105034102 256
121 3300007265 Ga0099794_10003791 Ga0099794_100037912 256
122 3300007265 Ga0099794_10122145 Ga0099794_101221452 256
123 3300009094 Ga0111539_10806621 Ga0111539_108066211 256
124 3300025910 Ga0207684_10000002 Ga0207684_10000002703 256
125 3300025910 Ga0207684_10000640 Ga0207684_1000064035 256
126 3300025910 Ga0207684_10004920 Ga0207684_100049204 256
127 3300025922 Ga0207646_10000196 Ga0207646_100001968 256
128 3300025922 Ga0207646_10062730 Ga0207646_100627302 256
129 3300027671 Ga0209588_1002097 Ga0209588_10020974 256
130 3300042532 Ga0450893_0017554 Ga0450893_0017554_94_924 256
131 3300050513 nmdc:mga0rr50_340916_c1 nmdc:mga0rr50_340916_c1_216_1046 256
132 iso_pu_bacteria 3002998708 3003003099 256
133 3300005546 Ga0070696_100066021 Ga0070696_1000660213 257
134 3300037068 Ga0373925_0074940 Ga0373925_0074940_1521_2411 257
135 3300046454 Ga0495592_0255567 Ga0495592_0255567_171_1061 257
136 3300046459 Ga0495629_0011823 Ga0495629_0011823_480_1370 257
137 3300046514 Ga0495618_0067923 Ga0495618_0067923_115_1005 257
138 3300046529 Ga0495652_0032210 Ga0495652_0032210_2332_3222 257
139 3300046663 Ga0495635_0059193 Ga0495635_0059193_699_1589 257
140 3300046680 Ga0495646_0191931 Ga0495646_0191931_121_1011 257
141 3300046683 Ga0495658_0225542 Ga0495658_0225542_201_1091 257
142 3300046690 Ga0495624_0091564 Ga0495624_0091564_852_1742 257
143 3300047317 Ga0495604_0154919 Ga0495604_0154919_484_1374 257
144 3300047319 Ga0495674_0008392 Ga0495674_0008392_3290_4180 257
145 3300047471 Ga0495684_0060407 Ga0495684_0060407_1894_2784 257
146 3300048088 Ga0495602_0050796 Ga0495602_0050796_2762_3652 257
147 3300049589 Ga0501073_0060781 Ga0501073_0060781_362_1252 257
148 3300049742 Ga0501080_0100514 Ga0501080_0100514_949_1839 257
149 3300049744 Ga0501083_0066284 Ga0501083_0066284_1011_1901 257
150 3300053077 Ga0495601_0001637 Ga0495601_0001637_6300_7190 257
151 3300053078 Ga0495612_0063215 Ga0495612_0063215_223_1113 257
152 3300053084 Ga0495595_0069431 Ga0495595_0069431_447_1337 257
153 3300053085 Ga0495619_0000503 Ga0495619_0000503_11379_12269 257
154 3300021361 Ga0213872_10004550 Ga0213872_100045505 258
155 3300039447 Ga0436361_0286503 Ga0436361_0286503_5052_5945 258
156 iso_pu_bacteria 2883291878 2883296308 258
157 iso_pu_bacteria 2883354860 2883359029 258
158 3300006028 Ga0070717_10000942 Ga0070717_100009428 259
159 3300009545 Ga0105237_10318992 Ga0105237_103189922 259
160 3300039438 Ga0436360_1338869 Ga0436360_1338869_323_1225 259
161 3300050514 nmdc:mga08x19_42815_c1 nmdc:mga08x19_42815_c1_15_854 259
162 3300003320 rootH2_10039287 rootH2_100392873 260
163 3300005459 Ga0068867_100365564 Ga0068867_1003655642 260
164 3300006881 Ga0068865_100127790 Ga0068865_1001277902 260
165 3300009148 Ga0105243_10136691 Ga0105243_101366912 260
166 3300025933 Ga0207706_10249690 Ga0207706_102496902 260
167 3300025935 Ga0207709_10058836 Ga0207709_100588362 260
168 3300025940 Ga0207691_10189775 Ga0207691_101897752 260
169 3300026023 Ga0207677_10219241 Ga0207677_102192412 260
170 3300026075 Ga0207708_10058771 Ga0207708_100587712 260
171 3300045051 Ga0451576_0549179 Ga0451576_0549179_142_1020 260
172 3300046458 Ga0495591_029925 Ga0495591_029925_51_932 260
173 3300049569 Ga0501032_0104427 Ga0501032_0104427_984_1826 260
174 3300049571 Ga0501034_0084152 Ga0501034_0084152_1580_2422 260
175 3300049572 Ga0501036_0041628 Ga0501036_0041628_68_910 260
176 3300049574 Ga0501038_0123126 Ga0501038_0123126_64_906 260
177 3300049579 Ga0501043_0025684 Ga0501043_0025684_2921_3763 260
178 iso_pu_bacteria 8025530807 8025531872 260
179 3300005468 Ga0070707_100009604 Ga0070707_1000096048 265
180 3300005471 Ga0070698_100020222 Ga0070698_1000202224 265
181 3300025922 Ga0207646_10000021 Ga0207646_10000021161 265
182 3300005435 Ga0070714_100005209 Ga0070714_1000052094 266
183 3300005440 Ga0070705_100055767 Ga0070705_1000557671 266
184 3300005445 Ga0070708_100000014 Ga0070708_100000014116 266
185 3300005445 Ga0070708_100005499 Ga0070708_1000054998 266
186 3300005445 Ga0070708_100056487 Ga0070708_1000564873 266
187 3300005445 Ga0070708_100069287 Ga0070708_1000692872 266
188 3300005445 Ga0070708_100192756 Ga0070708_1001927562 266
189 3300005467 Ga0070706_100000231 Ga0070706_10000023146 266
190 3300005467 Ga0070706_100001022 Ga0070706_10000102216 266
191 3300005467 Ga0070706_100138679 Ga0070706_1001386792 266
192 3300005468 Ga0070707_100000961 Ga0070707_10000096115 266
193 3300005468 Ga0070707_100007680 Ga0070707_10000768010 266
194 3300005468 Ga0070707_100009503 Ga0070707_1000095033 266
195 3300005468 Ga0070707_100097740 Ga0070707_1000977403 266
196 3300005518 Ga0070699_100000387 Ga0070699_10000038720 266
197 3300005518 Ga0070699_100001052 Ga0070699_10000105212 266
198 3300005518 Ga0070699_100021265 Ga0070699_1000212654 266
199 3300005518 Ga0070699_100036919 Ga0070699_1000369192 266
200 3300005536 Ga0070697_100000840 Ga0070697_10000084010 266
201 3300005536 Ga0070697_100017390 Ga0070697_1000173905 266
202 3300005545 Ga0070695_100001150 Ga0070695_1000011502 266
203 3300006028 Ga0070717_10000105 Ga0070717_1000010540 266
204 3300006852 Ga0075433_10072577 Ga0075433_100725772 266
205 3300006852 Ga0075433_10186471 Ga0075433_101864712 266
206 3300006914 Ga0075436_100081230 Ga0075436_1000812302 266
207 3300006914 Ga0075436_100089476 Ga0075436_1000894762 266
208 3300007076 Ga0075435_100014298 Ga0075435_1000142982 266
209 3300007076 Ga0075435_100018630 Ga0075435_1000186304 266
210 3300007265 Ga0099794_10000139 Ga0099794_1000013912 266
211 3300025910 Ga0207684_10000010 Ga0207684_10000010271 266
212 3300025910 Ga0207684_10000020 Ga0207684_1000002023 266
213 3300025910 Ga0207684_10000084 Ga0207684_10000084149 266
214 3300025910 Ga0207684_10154814 Ga0207684_101548142 266
215 3300025922 Ga0207646_10000031 Ga0207646_10000031149 266
216 3300025922 Ga0207646_10001140 Ga0207646_1000114034 266
217 3300025922 Ga0207646_10007576 Ga0207646_100075765 266
218 3300025922 Ga0207646_10010769 Ga0207646_1001076910 266
219 3300025922 Ga0207646_10020477 Ga0207646_100204772 266
220 3300025928 Ga0207700_10051035 Ga0207700_100510352 266
221 3300025929 Ga0207664_10152166 Ga0207664_101521662 266
222 3300025939 Ga0207665_10006710 Ga0207665_100067103 266
223 3300027671 Ga0209588_1000137 Ga0209588_10001372 266
224 3300050512 nmdc:mga0n895_490366_c1 nmdc:mga0n895_490366_c1_322_1227 266
225 3300050513 nmdc:mga0rr50_305879_c1 nmdc:mga0rr50_305879_c1_123_1028 266
226 3300050514 nmdc:mga08x19_9349_c1 nmdc:mga08x19_9349_c1_448_1353 266
227 3300050515 nmdc:mga0a205_100731_c1 nmdc:mga0a205_100731_c1_14_919 266
228 3300050515 nmdc:mga0a205_188408_c1 nmdc:mga0a205_188408_c1_426_1331 266
229 3300003203 JGI25406J46586_10009795 JGI25406J46586_100097952 268
230 3300005985 Ga0081539_10000288 Ga0081539_10000288109 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

115

301

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.3719 16 268
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.3664 18 268
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.3661 18 252
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.3634 16 268
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.3561 18 266
ID Description Score Start End Superfamily
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4076 131 258 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4055 68 252 1.10.3720.10
af_P0AER3_18_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4004 148 257 1.10.3720.10
af_P76224_283_502_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.397 19 255 1.10.3720.10
af_P76224_283_502_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3926 19 255 1.10.3720.10
ID Description Score Start End GO Terms
AF-X1MS11-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.6507 107 268 GO:0005886
GO:0055085
AF-A0A2N7SAH3-F1-model_v4 deleted 0.6427 108 268
AF-A0A2N7SAH3-F1-model_v4 deleted 0.639 108 268
AF-A0A1V0PWP0-F1-model_v4 Inner membrane ABC transporter permease protein YcjP 0.6387 108 268 GO:0005886
GO:0055085
AF-A0A354ZF98-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.6327 106 267 GO:0005886
GO:0015423
GO:0042956

Feature Viewer

pLDDT pTM Quality
63.57 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map