F342896

General Info

Members Datasets Scaffolds Average Seq Length
230 180 460 174

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10036208|Ga0075368_100362083
Length 184
Sequence VSRGNNYNGRVSLTFTLDPAVTPDLRDGLLDLWTDVSNAGGSVGFVPPVTREVVRPELVKHMVGMAEGRTRLLVGYDQDGRVAATAFLAFNTHRLMTHWLWLYTVMVHPRHQGKGYGRDLLAAAEEAARSLDGIEAIRLTCRGGNGLERFYGSCGYKEVGRVPDAIRVAPGDDRDDIFMLLPLT

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
18 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
19 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
25 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
26 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
27 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
28 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
29 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
30 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
35 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
38 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
41 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
42 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
43 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
44 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
45 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
46 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
47 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
48 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
49 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
50 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
51 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
52 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
53 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
61 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
65 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
74 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
79 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
80 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
93 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
126 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
127 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
128 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
130 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
131 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
132 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
133 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
134 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
135 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
136 2643221578 Streptomyces sp. Root63 Isolate Unclassified
137 2643221670 Streptomyces sp. Root431 Isolate Unclassified
138 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
139 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
140 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
141 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
142 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
143 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
144 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
145 2808606448 Streptomyces sp. 193411 Isolate Unclassified
146 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
147 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
148 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
149 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
150 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
151 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
152 2867428634 Streptomyces sp. RP5T Isolate Unclassified
153 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
154 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
155 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
156 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
157 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
158 2891562705 Microbispora tritici MT50 Isolate Unclassified
159 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
160 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
161 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
162 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
163 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
164 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
165 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
166 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
167 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
168 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
169 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
170 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
171 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
172 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
173 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
174 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
175 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
176 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
177 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
178 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
179 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
180 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.96
Metatranscriptomes 1.74
Isolates 21.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0
Rhizoplane 0.43
Rhizosphere 67.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10036208 3300006042 Bacteria 1928
2 rootH1_10064457 3300003316 Bacteria 2273
3 rootH2_10094149 3300003320 Bacteria 2203
4 rootL2_10048061 3300003322 Bacteria 11893
5 rootL2_10120525 3300003322 Bacteria 2907
6 rootH1_10020463 3300003323 Bacteria 4989
7 rootH1_10042030 3300003323 Bacteria 2643
8 rootH1_10060687 3300003323 Bacteria 6144
9 Ga0006562J51391_1068470 3300003578 Bacteria 1400
10 Ga0006562J51391_1068471 3300003578 Bacteria 1188
11 Ga0006562J51391_1078455 3300003578 Bacteria 11995
12 Ga0006562J51391_1078456 3300003578 Bacteria 8680
13 Ga0070707_100640300 3300005468 Bacteria 1026
14 Ga0070672_100178283 3300005543 Bacteria 1770
15 Ga0070665_100462620 3300005548 Bacteria 1279
16 Ga0081455_10033863 3300005937 Bacteria 4584
17 Ga0075367_10002092 3300006178 Bacteria 8950
18 Ga0105238_10822462 3300009551 Bacteria 945
19 Ga0105246_10014755 3300011119 Bacteria 4920
20 Ga0157369_10352031 3300013105 Bacteria 1530
21 Ga0157372_10073697 3300013307 Bacteria 3849
22 Ga0182008_10002322 3300014497 Bacteria 11986
23 Ga0182007_10001433 3300015262 Bacteria 12787
24 Ga0209758_1006175 3300025297 Bacteria 8769
25 Ga0207647_10022633 3300025904 Bacteria 4171
26 Ga0207691_10128692 3300025940 Bacteria 2238
27 Ga0207667_10891360 3300025949 Bacteria 882
28 Ga0209371_1022116 3300027312 Bacteria 1526
29 Ga0209371_1054290 3300027312 Bacteria 757
30 Ga0268266_10519801 3300028379 Bacteria 1138
31 Ga0307517_10002570 3300028786 Bacteria 28904
32 Ga0307515_10000258 3300028794 Bacteria 131660
33 Ga0268256_1016559 3300030500 Bacteria 2109
34 Ga0268256_1024257 3300030500 Bacteria 1559
35 Ga0307511_10005077 3300030521 Bacteria 13424
36 Ga0307511_10038530 3300030521 Bacteria 4101
37 Ga0307512_10004738 3300030522 Bacteria 14684
38 Ga0307512_10006571 3300030522 Bacteria 11749
39 Ga0307513_10387841 3300031456 Bacteria 1134
40 Ga0307509_10063720 3300031507 Bacteria 3880
41 Ga0307509_10075002 3300031507 Bacteria 3514
42 Ga0307509_10427093 3300031507 Bacteria 1024
43 Ga0307508_10065249 3300031616 Bacteria 3208
44 Ga0307508_10166141 3300031616 Bacteria 1810
45 Ga0307514_10025416 3300031649 Bacteria 4790
46 Ga0307514_10031576 3300031649 Bacteria 4247
47 Ga0307514_10086179 3300031649 Bacteria 2305
48 Ga0307514_10129067 3300031649 Bacteria 1744
49 Ga0307514_10200294 3300031649 Bacteria 1256
50 Ga0307516_10039408 3300031730 Bacteria 4710
51 Ga0307516_10215095 3300031730 Bacteria 1634
52 Ga0307518_10015625 3300031838 Bacteria 5438
53 Ga0307518_10026179 3300031838 Bacteria 4210
54 Ga0307518_10193025 3300031838 Bacteria 1362
55 Ga0307410_10475736 3300031852 Bacteria 1024
56 Ga0307416_101218000 3300032002 Bacteria 858
57 Ga0307507_10031244 3300033179 Bacteria 5594
58 Ga0307507_10070746 3300033179 Bacteria 3161
59 Ga0307510_10003725 3300033180 Bacteria 17820
60 Ga0307510_10016240 3300033180 Bacteria 8791
61 Ga0307510_10024112 3300033180 Bacteria 7035
62 Ga0307510_10249136 3300033180 Bacteria 1265
63 Ga0395898_0131696 3300037466 Bacteria 2395
64 Ga0439436_0016271 3300041404 Bacteria 2232
65 Ga0439436_0021474 3300041404 Bacteria 1918
66 Ga0439439_0006785 3300041406 Bacteria 2656
67 Ga0439439_0096249 3300041406 Bacteria 812
68 Ga0451800_1681228 3300041459 Bacteria 1015
69 Ga0451853_1442377 3300041512 Bacteria 551
70 Ga0439433_0002520 3300041999 Bacteria 3889
71 Ga0439448_0015936 3300042005 Bacteria 2282
72 Ga0439449_0000759 3300042007 Bacteria 12397
73 Ga0439449_0038036 3300042007 Bacteria 1790
74 Ga0439449_0043674 3300042007 Bacteria 1663
75 Ga0439455_0000327 3300042012 Bacteria 6046
76 Ga0439457_001023 3300042014 Bacteria 8437
77 Ga0439457_004574 3300042014 Bacteria 3586
78 Ga0439462_0002313 3300042015 Bacteria 4413
79 Ga0450897_014525 3300042128 Bacteria 796
80 Ga0450902_017503 3300042137 Bacteria 1172
81 Ga0450903_001208 3300042138 Bacteria 4851
82 Ga0439458_0000008 3300042157 Bacteria 29768
83 Ga0466969_0029771 3300044656 Bacteria 2786
84 Ga0466972_0018563 3300044658 Bacteria 3479
85 Ga0466965_0000250 3300044683 Bacteria 17340
86 Ga0466965_0090002 3300044683 Bacteria 1560
87 Ga0466965_0296169 3300044683 Bacteria 877
88 Ga0466966_0001751 3300044684 Bacteria 14056
89 Ga0466966_0053810 3300044684 Bacteria 2553
90 Ga0466961_0000557 3300044693 Bacteria 23793
91 Ga0466963_0000145 3300044694 Bacteria 27958
92 Ga0466964_0005568 3300044706 Bacteria 4678
93 Ga0466971_0000187 3300044719 Bacteria 23602
94 Ga0466971_0157462 3300044719 Bacteria 1062
95 Ga0466970_0001548 3300044765 Bacteria 11072
96 Ga0466970_0024502 3300044765 Bacteria 3155
97 Ga0466957_0000840 3300044842 Bacteria 15708
98 Ga0466960_0123201 3300044901 Bacteria 1360
99 Ga0466960_0824142 3300044901 Bacteria 563
100 Ga0466959_0000277 3300045049 Bacteria 31271
101 Ga0466958_0000201 3300045836 Bacteria 22048
102 Ga0466958_0206082 3300045836 Bacteria 1252
103 Ga0466967_0028397 3300045976 Bacteria 4670
104 Ga0466967_0450968 3300045976 Bacteria 1257
105 Ga0495592_0004877 3300046454 Bacteria 9873
106 Ga0495629_0063076 3300046459 Bacteria 2587
107 Ga0495651_0004772 3300046462 Bacteria 10376
108 Ga0495582_0143794 3300046473 Bacteria 1352
109 Ga0495662_0001764 3300046476 Bacteria 10818
110 Ga0495662_0313044 3300046476 Bacteria 772
111 Ga0495664_0000650 3300046477 Bacteria 17686
112 Ga0495594_0019302 3300046499 Bacteria 3621
113 Ga0495608_0204199 3300046511 Bacteria 1244
114 Ga0495620_0306969 3300046515 Bacteria 603
115 Ga0495628_0028833 3300046516 Bacteria 4508
116 Ga0495666_0025028 3300046526 Bacteria 2949
117 Ga0495652_0015197 3300046529 Bacteria 6892
118 Ga0495652_0020053 3300046529 Bacteria 5947
119 Ga0495640_0034361 3300046533 Bacteria 3597
120 Ga0495586_0102058 3300046535 Bacteria 1592
121 Ga0495587_0002356 3300046536 Bacteria 12624
122 Ga0495645_0134331 3300046543 Bacteria 1731
123 Ga0495622_0092466 3300046557 Bacteria 1389
124 Ga0495667_0160264 3300046559 Bacteria 1447
125 Ga0495634_0003920 3300046642 Bacteria 11813
126 Ga0495625_0012229 3300046660 Bacteria 6962
127 Ga0495635_0015604 3300046663 Bacteria 5308
128 Ga0495588_0003274 3300046674 Bacteria 7033
129 Ga0495657_0023308 3300046675 Bacteria 4424
130 Ga0495599_0069351 3300046678 Bacteria 2200
131 Ga0495646_0000394 3300046680 Bacteria 22936
132 Ga0495658_0124208 3300046683 Bacteria 1564
133 Ga0495613_0000548 3300046689 Bacteria 31085
134 Ga0495613_0011869 3300046689 Bacteria 6474
135 Ga0495613_0149053 3300046689 Bacteria 1669
136 Ga0495671_0040800 3300046692 Bacteria 2339
137 Ga0495600_0092937 3300046809 Bacteria 1967
138 Ga0495581_0033652 3300047315 Bacteria 2966
139 Ga0495604_0006696 3300047317 Bacteria 9134
140 Ga0495636_0110143 3300047318 Bacteria 1211
141 Ga0495674_0179070 3300047319 Bacteria 1766
142 Ga0495676_0004467 3300047321 Bacteria 12783
143 Ga0495676_0034810 3300047321 Bacteria 4221
144 Ga0495687_002285 3300047443 Bacteria 15671
145 Ga0495675_0461586 3300047444 Bacteria 733
146 Ga0495681_0002152 3300047470 Bacteria 14284
147 Ga0495684_0052265 3300047471 Bacteria 3118
148 Ga0495593_0002812 3300047673 Bacteria 10484
149 Ga0495602_0028655 3300048088 Bacteria 5324
150 Ga0495614_0005564 3300048089 Bacteria 5680
151 Ga0495614_0006646 3300048089 Bacteria 5179
152 Ga0495614_0014649 3300048089 Bacteria 3428
153 Ga0501031_0042568 3300049568 Bacteria 2964
154 Ga0501033_0013456 3300049570 Bacteria 6229
155 Ga0501036_0202098 3300049572 Bacteria 1671
156 Ga0501036_1070289 3300049572 Bacteria 659
157 Ga0501038_0006300 3300049574 Bacteria 10971
158 Ga0501043_0215144 3300049579 Bacteria 1488
159 Ga0501048_0607074 3300049582 Bacteria 785
160 Ga0501067_0449575 3300049583 Bacteria 720
161 Ga0501068_0867715 3300049584 Bacteria 593
162 Ga0501070_0245024 3300049586 Bacteria 1467
163 Ga0501070_0493600 3300049586 Bacteria 984
164 Ga0501080_0211699 3300049742 Bacteria 1776
165 Ga0501035_0207663 3300049822 Bacteria 1677
166 Ga0501035_0273058 3300049822 Bacteria 1430
167 Ga0501044_0003360 3300049823 Bacteria 18042
168 Ga0501044_1043848 3300049823 Bacteria 688
169 nmdc:mga03n38_33887_c1 3300050490 Bacteria 2176
170 nmdc:mga06z11_9520_c1 3300050494 Bacteria 4098
171 Ga0495612_0135290 3300053078 Bacteria 1067
172 Ga0495619_0041531 3300053085 Bacteria 3009
173 Ga0500640_004541 3300053095 Bacteria 5057
174 Ga0500553_097794 3300053101 Bacteria 1272
175 Ga0500560_000486 3300053107 Bacteria 5531
176 Ga0500572_003303 3300053111 Bacteria 3713
177 Ga0500614_007257 3300053123 Bacteria 2336
178 Ga0500600_0070638 3300053149 Bacteria 1916
179 Ga0500600_0164863 3300053149 Bacteria 1085
180 Ga0466962_0000305 3300061719 Bacteria 21073
181 Ga0466962_0241137 3300061719 Bacteria 887
182 2547410137 2547132111 Bacteria 8013147
183 2585308241 2582581313 Bacteria 10042643
184 2585319133 2582581314 Bacteria 11452267
185 2616904777 2616644941 Bacteria 8510691
186 2643898402 2643221578 Bacteria 9213798
187 2644388630 2643221670 Bacteria 6497041
188 2644403727 2643221673 Bacteria 9196637
189 2644439177 2643221678 Bacteria 9540101
190 2784589555 2784132148 Bacteria 8627943
191 2785342018 2784746763 Bacteria 9783172
192 2786671806 2786546132 Bacteria 10419719
193 2808843180 2808606359 Bacteria 9866990
194 2808921542 2808606375 Bacteria 9466072
195 2809233227 2808606448 Bacteria 8656184
196 2812356910 2811994879 Bacteria 9313447
197 2812479596 2811994917 Bacteria 7761064
198 2819698025 2818991463 Bacteria 7948711
199 2852640510 2852635781 Bacteria 8251373
200 2856742984 2856741275 Bacteria 8096094
201 2862514457 2862507626 Bacteria 9425308
202 2867435725 2867428634 Bacteria 9590268
203 2873154847 2873151551 Bacteria 8625867
204 2875394556 2875391855 Bacteria 7600475
205 2877679957 2877676314 Bacteria 9512378
206 2891401184 2891395885 Bacteria 9251614
207 2891560118 2891554331 Bacteria 8812224
208 2891563550 2891562705 Bacteria 8039471
209 2912718590 2912715099 Bacteria 9460473
210 2912730914 2912723979 Bacteria 8557534
211 2912762015 2912757875 Bacteria 7940295
212 2919475838 2919468124 Bacteria 9133025
213 2946050083 2946045630 Bacteria 8527308
214 2946068955 2946064051 Bacteria 8957905
215 2946076966 2946072368 Bacteria 8999607
216 2947227969 2947224130 Bacteria 9938529
217 2954678082 2954673503 Bacteria 9685905
218 2954686076 2954682443 Bacteria 9862841
219 2954715143 2954711539 Bacteria 10867210
220 2954725085 2954721474 Bacteria 10456478
221 2954736733 2954731030 Bacteria 10243860
222 2954744017 2954740390 Bacteria 10229294
223 2954755580 2954749733 Bacteria 10366972
224 2954762959 2954759201 Bacteria 9358192
225 2966602618 2966598605 Bacteria 7676064
226 3006428908 3006425503 Bacteria 6491253
227 3006499714 3006493962 Bacteria 8825450
228 8008577928 8008574985 Bacteria 7815457
229 8025534877 8025530807 Bacteria 8495698
230 8048410702 8048406513 Bacteria 8936924
231 Ga0075368_10036208
232 rootH1_10064457
233 rootH2_10094149
234 rootL2_10048061
235 rootL2_10120525
236 rootH1_10020463
237 rootH1_10042030
238 rootH1_10060687
239 Ga0006562J51391_1068470
240 Ga0006562J51391_1068471
241 Ga0006562J51391_1078455
242 Ga0006562J51391_1078456
243 Ga0070707_100640300
244 Ga0070672_100178283
245 Ga0070665_100462620
246 Ga0081455_10033863
247 Ga0075367_10002092
248 Ga0105238_10822462
249 Ga0105246_10014755
250 Ga0157369_10352031
251 Ga0157372_10073697
252 Ga0182008_10002322
253 Ga0182007_10001433
254 Ga0209758_1006175
255 Ga0207647_10022633
256 Ga0207691_10128692
257 Ga0207667_10891360
258 Ga0209371_1022116
259 Ga0209371_1054290
260 Ga0268266_10519801
261 Ga0307517_10002570
262 Ga0307515_10000258
263 Ga0268256_1016559
264 Ga0268256_1024257
265 Ga0307511_10005077
266 Ga0307511_10038530
267 Ga0307512_10004738
268 Ga0307512_10006571
269 Ga0307513_10387841
270 Ga0307509_10063720
271 Ga0307509_10075002
272 Ga0307509_10427093
273 Ga0307508_10065249
274 Ga0307508_10166141
275 Ga0307514_10025416
276 Ga0307514_10031576
277 Ga0307514_10086179
278 Ga0307514_10129067
279 Ga0307514_10200294
280 Ga0307516_10039408
281 Ga0307516_10215095
282 Ga0307518_10015625
283 Ga0307518_10026179
284 Ga0307518_10193025
285 Ga0307410_10475736
286 Ga0307416_101218000
287 Ga0307507_10031244
288 Ga0307507_10070746
289 Ga0307510_10003725
290 Ga0307510_10016240
291 Ga0307510_10024112
292 Ga0307510_10249136
293 Ga0395898_0131696
294 Ga0439436_0016271
295 Ga0439436_0021474
296 Ga0439439_0006785
297 Ga0439439_0096249
298 Ga0451800_1681228
299 Ga0451853_1442377
300 Ga0439433_0002520
301 Ga0439448_0015936
302 Ga0439449_0000759
303 Ga0439449_0038036
304 Ga0439449_0043674
305 Ga0439455_0000327
306 Ga0439457_001023
307 Ga0439457_004574
308 Ga0439462_0002313
309 Ga0450897_014525
310 Ga0450902_017503
311 Ga0450903_001208
312 Ga0439458_0000008
313 Ga0466969_0029771
314 Ga0466972_0018563
315 Ga0466965_0000250
316 Ga0466965_0090002
317 Ga0466965_0296169
318 Ga0466966_0001751
319 Ga0466966_0053810
320 Ga0466961_0000557
321 Ga0466963_0000145
322 Ga0466964_0005568
323 Ga0466971_0000187
324 Ga0466971_0157462
325 Ga0466970_0001548
326 Ga0466970_0024502
327 Ga0466957_0000840
328 Ga0466960_0123201
329 Ga0466960_0824142
330 Ga0466959_0000277
331 Ga0466958_0000201
332 Ga0466958_0206082
333 Ga0466967_0028397
334 Ga0466967_0450968
335 Ga0495592_0004877
336 Ga0495629_0063076
337 Ga0495651_0004772
338 Ga0495582_0143794
339 Ga0495662_0001764
340 Ga0495662_0313044
341 Ga0495664_0000650
342 Ga0495594_0019302
343 Ga0495608_0204199
344 Ga0495620_0306969
345 Ga0495628_0028833
346 Ga0495666_0025028
347 Ga0495652_0015197
348 Ga0495652_0020053
349 Ga0495640_0034361
350 Ga0495586_0102058
351 Ga0495587_0002356
352 Ga0495645_0134331
353 Ga0495622_0092466
354 Ga0495667_0160264
355 Ga0495634_0003920
356 Ga0495625_0012229
357 Ga0495635_0015604
358 Ga0495588_0003274
359 Ga0495657_0023308
360 Ga0495599_0069351
361 Ga0495646_0000394
362 Ga0495658_0124208
363 Ga0495613_0000548
364 Ga0495613_0011869
365 Ga0495613_0149053
366 Ga0495671_0040800
367 Ga0495600_0092937
368 Ga0495581_0033652
369 Ga0495604_0006696
370 Ga0495636_0110143
371 Ga0495674_0179070
372 Ga0495676_0004467
373 Ga0495676_0034810
374 Ga0495687_002285
375 Ga0495675_0461586
376 Ga0495681_0002152
377 Ga0495684_0052265
378 Ga0495593_0002812
379 Ga0495602_0028655
380 Ga0495614_0005564
381 Ga0495614_0006646
382 Ga0495614_0014649
383 Ga0501031_0042568
384 Ga0501033_0013456
385 Ga0501036_0202098
386 Ga0501036_1070289
387 Ga0501038_0006300
388 Ga0501043_0215144
389 Ga0501048_0607074
390 Ga0501067_0449575
391 Ga0501068_0867715
392 Ga0501070_0245024
393 Ga0501070_0493600
394 Ga0501080_0211699
395 Ga0501035_0207663
396 Ga0501035_0273058
397 Ga0501044_0003360
398 Ga0501044_1043848
399 nmdc:mga03n38_33887_c1
400 nmdc:mga06z11_9520_c1
401 Ga0495612_0135290
402 Ga0495619_0041531
403 Ga0500640_004541
404 Ga0500553_097794
405 Ga0500560_000486
406 Ga0500572_003303
407 Ga0500614_007257
408 Ga0500600_0070638
409 Ga0500600_0164863
410 Ga0466962_0000305
411 Ga0466962_0241137
412 2547410137
413 2585308241
414 2585319133
415 2616904777
416 2643898402
417 2644388630
418 2644403727
419 2644439177
420 2784589555
421 2785342018
422 2786671806
423 2808843180
424 2808921542
425 2809233227
426 2812356910
427 2812479596
428 2819698025
429 2852640510
430 2856742984
431 2862514457
432 2867435725
433 2873154847
434 2875394556
435 2877679957
436 2891401184
437 2891560118
438 2891563550
439 2912718590
440 2912730914
441 2912762015
442 2919475838
443 2946050083
444 2946068955
445 2946076966
446 2947227969
447 2954678082
448 2954686076
449 2954715143
450 2954725085
451 2954736733
452 2954744017
453 2954755580
454 2954762959
455 2966602618
456 3006428908
457 3006499714
458 8008577928
459 8025534877
460 8048410702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

46

156

0.88

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

48

165

0.75

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

68

158

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8677 60 172
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.8638 58 172
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8614 57 172
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.8608 4 174
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8591 59 172
ID Description Score Start End Superfamily
af_Q54KJ9_7_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9016 9 172 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8792 60 172 3.40.630.30
af_Q54KJ9_7_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8765 9 172 3.40.630.30
af_Q09518_10_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8669 62 150 3.40.630.30
af_Q54KJ7_19_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8642 10 174 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A5R9FIL1-F1-model_v4 GNAT family N-acetyltransferase 0.9901 1 174 GO:0016747
AF-A0A4R7IJA3-F1-model_v4 deleted 0.9897 3 174
AF-A0A100Y241-F1-model_v4 Acetyltransferase 0.9889 1 174 GO:0016747
AF-A0A433DUV7-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9888 2 172 GO:0016747
AF-B5GWC9-F1-model_v4 Putative acetyltransferase 0.9868 1 174 GO:0016747

Map