F342895

General Info

Members Datasets Scaffolds Average Seq Length
230 166 460 205

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10018658|Ga0075368_100186583
Length 235
Sequence VLDARDPGDAIRDEAVVLTGINSQVRTMTHRLRVYSDYKSPYAYLAKDLTYELERQTGVTIEWLPYTLDIPAYLGSARVDGEGNVLEQSRNAHQWRRVKYSYMDCRREANLRGLTIRGPRKIFDSRLANIGLLYAQQRGVLRAYHDCVFERFWRRDLDIESVDALADVLAQAGTEAEGFVAFVQGEGGLRLDAVQREAEAAGVFGVPSYLFADGDLYWGREHLPRIRELLTAKSR

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
108 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
165 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
166 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.74
Nodule 0
Rhizoplane 5.22
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10018658 3300006042 Bacteria 2608
2 Ga0070658_10938295 3300005327 Bacteria 752
3 Ga0070683_100317175 3300005329 Bacteria 1483
4 Ga0068869_100296239 3300005334 Bacteria 1305
5 Ga0070680_100015297 3300005336 Bacteria 6012
6 Ga0070660_100350253 3300005339 Bacteria 1216
7 Ga0070689_100091567 3300005340 Bacteria 2397
8 Ga0070691_10001384 3300005341 Bacteria 10354
9 Ga0070691_10011910 3300005341 Bacteria 3981
10 Ga0070671_100071205 3300005355 Bacteria 2902
11 Ga0070674_100277109 3300005356 Bacteria 1328
12 Ga0070673_101025267 3300005364 Bacteria 769
13 Ga0070688_100158240 3300005365 Bacteria 1555
14 Ga0070659_100276407 3300005366 Bacteria 1396
15 Ga0070714_100038255 3300005435 Bacteria 4034
16 Ga0070700_100246999 3300005441 Bacteria 1278
17 Ga0070678_100007718 3300005456 Bacteria 6397
18 Ga0070681_10007181 3300005458 Bacteria 10853
19 Ga0070706_100150080 3300005467 Bacteria 2176
20 Ga0070679_100070058 3300005530 Bacteria 3498
21 Ga0070697_100137358 3300005536 Unclassified 2053
22 Ga0068853_101337109 3300005539 Bacteria 693
23 Ga0070672_100625704 3300005543 Bacteria 939
24 Ga0070695_100000663 3300005545 Bacteria 18363
25 Ga0070665_100019538 3300005548 Bacteria 6802
26 Ga0068855_100018664 3300005563 Bacteria 8341
27 Ga0068855_100887582 3300005563 Bacteria 943
28 Ga0070664_100082198 3300005564 Bacteria 2777
29 Ga0068857_100132775 3300005577 Bacteria 2246
30 Ga0068856_100012002 3300005614 Bacteria 8392
31 Ga0068856_100207278 3300005614 Bacteria 1975
32 Ga0068859_100482362 3300005617 Bacteria 1335
33 Ga0068861_100399410 3300005719 Bacteria 1219
34 Ga0068861_100765319 3300005719 Unclassified 903
35 Ga0068861_100842485 3300005719 Bacteria 864
36 Ga0068858_100336699 3300005842 Bacteria 1444
37 Ga0068862_100105249 3300005844 Bacteria 2473
38 Ga0081455_10000058 3300005937 Bacteria 119171
39 Ga0081455_10005226 3300005937 Bacteria 14278
40 Ga0081455_10013474 3300005937 Bacteria 8076
41 Ga0081540_1000040 3300005983 Bacteria 136968
42 Ga0081539_10105605 3300005985 Bacteria 1427
43 Ga0070717_10109760 3300006028 Bacteria 2352
44 Ga0075365_10083260 3300006038 Bacteria 2170
45 Ga0075363_100008483 3300006048 Bacteria 4788
46 Ga0075432_10035544 3300006058 Bacteria 1731
47 Ga0070715_10086760 3300006163 Bacteria 1432
48 Ga0070716_100147069 3300006173 Bacteria 1511
49 Ga0075362_10057852 3300006177 Bacteria 1748
50 Ga0075362_10336974 3300006177 Bacteria 753
51 Ga0075367_10004026 3300006178 Bacteria 7105
52 Ga0075367_10064737 3300006178 Bacteria 2187
53 Ga0075367_10150570 3300006178 Bacteria 1444
54 Ga0075367_10188799 3300006178 Bacteria 1286
55 Ga0075369_10064281 3300006186 Bacteria 1606
56 Ga0075369_10096578 3300006186 Bacteria 1323
57 Ga0075370_10396464 3300006353 Unclassified 828
58 Ga0075428_100156861 3300006844 Bacteria 2472
59 Ga0075428_100246617 3300006844 Bacteria 1925
60 Ga0075428_101181543 3300006844 Bacteria 807
61 Ga0075431_100379049 3300006847 Bacteria 1419
62 Ga0075433_10001198 3300006852 Bacteria 18880
63 Ga0075433_10252790 3300006852 Bacteria 1563
64 Ga0075433_10397747 3300006852 Bacteria 1215
65 Ga0075434_100031494 3300006871 Bacteria 5229
66 Ga0075429_100289283 3300006880 Bacteria 1435
67 Ga0097620_100482394 3300006931 Bacteria 1335
68 Ga0097620_101212931 3300006931 Bacteria 831
69 Ga0075435_100012256 3300007076 Bacteria 6343
70 Ga0105240_10137198 3300009093 Bacteria 2928
71 Ga0111539_10004293 3300009094 Bacteria 18644
72 Ga0111539_10023902 3300009094 Bacteria 7508
73 Ga0111539_10284131 3300009094 Bacteria 1926
74 Ga0105245_10174914 3300009098 Bacteria 2047
75 Ga0105245_11716740 3300009098 Bacteria 680
76 Ga0114129_10113280 3300009147 Bacteria 3740
77 Ga0114129_10538723 3300009147 Bacteria 1520
78 Ga0105241_10877892 3300009174 Bacteria 831
79 Ga0105242_10746053 3300009176 Bacteria 963
80 Ga0105237_10320513 3300009545 Bacteria 1553
81 Ga0105237_10898245 3300009545 Bacteria 893
82 Ga0105238_10100084 3300009551 Bacteria 2882
83 Ga0105238_10691695 3300009551 Bacteria 1031
84 Ga0105249_10667708 3300009553 Bacteria 1098
85 Ga0105239_10202201 3300010375 Bacteria 2226
86 Ga0157370_10027910 3300013104 Bacteria 5561
87 Ga0157370_10800291 3300013104 Bacteria 858
88 Ga0157369_10093901 3300013105 Bacteria 3202
89 Ga0157378_10559129 3300013297 Bacteria 1150
90 Ga0157378_10631663 3300013297 Bacteria 1085
91 Ga0163162_11255840 3300013306 Bacteria 841
92 Ga0157372_10094501 3300013307 Bacteria 3404
93 Ga0157375_10036391 3300013308 Bacteria 4709
94 Ga0182008_10337083 3300014497 Bacteria 797
95 Ga0157379_10448539 3300014968 Bacteria 1191
96 Ga0163161_10385330 3300017792 Bacteria 1121
97 Ga0213875_10000003 3300021388 Bacteria 719367
98 Ga0207426_1014080 3300025302 Bacteria 2942
99 Ga0207705_10028474 3300025909 Bacteria 3983
100 Ga0207684_10119674 3300025910 Bacteria 2257
101 Ga0207684_10151418 3300025910 Bacteria 1996
102 Ga0207707_10045348 3300025912 Bacteria 3831
103 Ga0207695_10042017 3300025913 Bacteria 4888
104 Ga0207695_10383018 3300025913 Bacteria 1292
105 Ga0207671_10235158 3300025914 Bacteria 1438
106 Ga0207671_10363401 3300025914 Bacteria 1149
107 Ga0207662_10209639 3300025918 Bacteria 1264
108 Ga0207657_10252666 3300025919 Bacteria 1405
109 Ga0207652_10063194 3300025921 Bacteria 3201
110 Ga0207652_10162089 3300025921 Bacteria 2005
111 Ga0207694_10244335 3300025924 Bacteria 1467
112 Ga0207659_10091495 3300025926 Bacteria 2272
113 Ga0207664_10286550 3300025929 Bacteria 1446
114 Ga0207664_10698383 3300025929 Bacteria 912
115 Ga0207670_10257793 3300025936 Unclassified 1350
116 Ga0207669_10222980 3300025937 Bacteria 1385
117 Ga0207665_10070473 3300025939 Bacteria 2385
118 Ga0207665_10095229 3300025939 Bacteria 2069
119 Ga0207691_10266999 3300025940 Bacteria 1474
120 Ga0207689_10258889 3300025942 Bacteria 1439
121 Ga0207661_10218210 3300025944 Bacteria 1684
122 Ga0207667_10009274 3300025949 Bacteria 11615
123 Ga0207667_10844628 3300025949 Bacteria 910
124 Ga0207639_11151606 3300026041 Bacteria 728
125 Ga0207641_10125332 3300026088 Bacteria 2299
126 Ga0207674_10093186 3300026116 Bacteria 3001
127 Ga0207683_10044255 3300026121 Bacteria 3892
128 Ga0207698_10006156 3300026142 Bacteria 7470
129 Ga0207428_10075567 3300027907 Bacteria 2640
130 Ga0207428_10191615 3300027907 Bacteria 1541
131 Ga0207428_10326849 3300027907 Bacteria 1132
132 Ga0268266_10016000 3300028379 Bacteria 6415
133 Ga0268266_10078192 3300028379 Bacteria 2878
134 Ga0268265_10123112 3300028380 Bacteria 2141
135 Ga0268264_10415272 3300028381 Bacteria 1296
136 Ga0265334_10038095 3300028573 Bacteria 1893
137 Ga0265340_10095783 3300031247 Bacteria 1383
138 Ga0307416_100576481 3300032002 Bacteria 1202
139 Ga0373929_0118358 3300035085 Bacteria 684
140 Ga0373936_0045122 3300035113 Bacteria 1775
141 Ga0373941_0004004 3300035115 Bacteria 3376
142 Ga0373942_0006826 3300035207 Bacteria 2637
143 Ga0373942_0035673 3300035207 Bacteria 1335
144 Ga0373961_0011248 3300035241 Bacteria 2218
145 Ga0373931_0000696 3300035691 Bacteria 13905
146 Ga0373935_0144387 3300035692 Bacteria 1610
147 Ga0373933_0213521 3300035724 Bacteria 1237
148 Ga0373947_0220816 3300035725 Bacteria 1246
149 Ga0373947_0353590 3300035725 Bacteria 986
150 Ga0373937_1091462 3300036401 Bacteria 747
151 Ga0373925_0229790 3300037068 Bacteria 1483
152 Ga0373925_0457689 3300037068 Bacteria 1045
153 Ga0395899_0012500 3300037312 Bacteria 6503
154 Ga0395899_0171288 3300037312 Bacteria 1529
155 Ga0395900_0041060 3300037418 Bacteria 4770
156 Ga0395900_0051731 3300037418 Bacteria 4230
157 Ga0395900_0057128 3300037418 Bacteria 4017
158 Ga0395898_0086617 3300037466 Bacteria 3018
159 Ga0395898_0251177 3300037466 Bacteria 1687
160 Ga0436364_0934425 3300037853 Bacteria 728
161 Ga0436364_1170796 3300037853 Bacteria 45618
162 Ga0395901_0043009 3300038443 Bacteria 4685
163 Ga0395901_0054737 3300038443 Bacteria 4147
164 Ga0395901_0106263 3300038443 Bacteria 2946
165 Ga0395901_0494698 3300038443 Bacteria 1246
166 Ga0436365_0873251 3300039437 Bacteria 1043
167 Ga0436365_1459979 3300039437 Bacteria 1473
168 Ga0436360_0399157 3300039438 Bacteria 1719
169 Ga0436360_0602615 3300039438 Bacteria 812
170 Ga0436360_0726981 3300039438 Bacteria 930
171 Ga0436363_0679222 3300039450 Bacteria 1720
172 Ga0439448_0007716 3300042005 Bacteria 3126
173 Ga0466963_0008304 3300044694 Bacteria 6218
174 Ga0466971_0201315 3300044719 Bacteria 940
175 Ga0466957_0157440 3300044842 Bacteria 1473
176 Ga0466967_0016337 3300045976 Bacteria 5850
177 Ga0495659_0056906 3300046664 Unclassified 1436
178 Ga0496101_0385738 3300048904 Bacteria 1102
179 Ga0496104_0010481 3300048907 Bacteria 8280
180 Ga0496105_0036019 3300048908 Bacteria 4075
181 Ga0496106_0199513 3300048909 Bacteria 1592
182 Ga0496108_0052273 3300048911 Bacteria 3423
183 Ga0496109_0080239 3300048912 Bacteria 3006
184 Ga0496109_0177288 3300048912 Bacteria 2001
185 Ga0496110_0061601 3300048913 Bacteria 3312
186 Ga0496111_0355246 3300048914 Bacteria 1085
187 Ga0496112_0083086 3300048915 Bacteria 3167
188 Ga0496112_0119061 3300048915 Bacteria 2611
189 Ga0496115_0087775 3300048918 Bacteria 2538
190 Ga0496126_0070009 3300048929 Bacteria 3127
191 Ga0501034_0005101 3300049571 Bacteria 14416
192 Ga0501034_0017558 3300049571 Bacteria 7338
193 Ga0501034_0055981 3300049571 Bacteria 3969
194 Ga0501034_0096416 3300049571 Bacteria 2954
195 Ga0501034_1098414 3300049571 Bacteria 676
196 Ga0501043_0167062 3300049579 Bacteria 1718
197 Ga0501067_0494988 3300049583 Unclassified 684
198 Ga0501068_0003290 3300049584 Bacteria 8659
199 Ga0501070_0198961 3300049586 Bacteria 1646
200 Ga0501070_0294365 3300049586 Bacteria 1323
201 Ga0501072_1084413 3300049588 Bacteria 623
202 Ga0501044_0159438 3300049823 Bacteria 2234
203 Ga0501044_0169292 3300049823 Bacteria 2157
204 Ga0501044_0342536 3300049823 Bacteria 1416
205 Ga0501044_0398515 3300049823 Bacteria 1289
206 nmdc:mga03n38_35126_c1 3300050490 Bacteria 2145
207 nmdc:mga00v17_463564_c1 3300050491 Bacteria 822
208 nmdc:mga0yw44_116483_c1 3300050492 Bacteria 1717
209 nmdc:mga06z11_3562_c1 3300050494 Bacteria 6029
210 nmdc:mga04h51_9562_c1 3300050495 Bacteria 2635
211 nmdc:mga05p37_50988_c1 3300050507 Bacteria 5089
212 nmdc:mga09592_123513_c1 3300050508 Bacteria 2225
213 nmdc:mga0qj67_120762_c1 3300050509 Bacteria 2120
214 nmdc:mga0qj67_65897_c1 3300050509 Bacteria 2884
215 nmdc:mga06r32_305076_c1 3300050510 Bacteria 1578
216 nmdc:mga06r32_37795_c1 3300050510 Bacteria 4568
217 nmdc:mga08y16_12025_c1 3300050511 Bacteria 9093
218 nmdc:mga08y16_238075_c1 3300050511 Bacteria 1882
219 nmdc:mga08y16_646071_c1 3300050511 Bacteria 1063
220 nmdc:mga0n895_184473_c1 3300050512 Bacteria 2118
221 nmdc:mga0a205_88447_c1 3300050515 Bacteria 2993
222 nmdc:mga0sz30_33155_c2 3300050516 Bacteria 894
223 nmdc:mga0sz30_59483_c1 3300050516 Bacteria 1630
224 Ga0500647_0022694 3300053091 Bacteria 2939
225 Ga0500651_0199882 3300053093 Bacteria 1180
226 Ga0500655_009658 3300053133 Bacteria 1741
227 Ga0500616_0006145 3300053153 Bacteria 7939
228 Ga0500620_108816 3300053155 Bacteria 970
229 Ga0500609_007849 3300053731 Bacteria 1440
230 Ga0500552_000222 3300053733 Bacteria 5145
231 Ga0075368_10018658
232 Ga0070658_10938295
233 Ga0070683_100317175
234 Ga0068869_100296239
235 Ga0070680_100015297
236 Ga0070660_100350253
237 Ga0070689_100091567
238 Ga0070691_10001384
239 Ga0070691_10011910
240 Ga0070671_100071205
241 Ga0070674_100277109
242 Ga0070673_101025267
243 Ga0070688_100158240
244 Ga0070659_100276407
245 Ga0070714_100038255
246 Ga0070700_100246999
247 Ga0070678_100007718
248 Ga0070681_10007181
249 Ga0070706_100150080
250 Ga0070679_100070058
251 Ga0070697_100137358
252 Ga0068853_101337109
253 Ga0070672_100625704
254 Ga0070695_100000663
255 Ga0070665_100019538
256 Ga0068855_100018664
257 Ga0068855_100887582
258 Ga0070664_100082198
259 Ga0068857_100132775
260 Ga0068856_100012002
261 Ga0068856_100207278
262 Ga0068859_100482362
263 Ga0068861_100399410
264 Ga0068861_100765319
265 Ga0068861_100842485
266 Ga0068858_100336699
267 Ga0068862_100105249
268 Ga0081455_10000058
269 Ga0081455_10005226
270 Ga0081455_10013474
271 Ga0081540_1000040
272 Ga0081539_10105605
273 Ga0070717_10109760
274 Ga0075365_10083260
275 Ga0075363_100008483
276 Ga0075432_10035544
277 Ga0070715_10086760
278 Ga0070716_100147069
279 Ga0075362_10057852
280 Ga0075362_10336974
281 Ga0075367_10004026
282 Ga0075367_10064737
283 Ga0075367_10150570
284 Ga0075367_10188799
285 Ga0075369_10064281
286 Ga0075369_10096578
287 Ga0075370_10396464
288 Ga0075428_100156861
289 Ga0075428_100246617
290 Ga0075428_101181543
291 Ga0075431_100379049
292 Ga0075433_10001198
293 Ga0075433_10252790
294 Ga0075433_10397747
295 Ga0075434_100031494
296 Ga0075429_100289283
297 Ga0097620_100482394
298 Ga0097620_101212931
299 Ga0075435_100012256
300 Ga0105240_10137198
301 Ga0111539_10004293
302 Ga0111539_10023902
303 Ga0111539_10284131
304 Ga0105245_10174914
305 Ga0105245_11716740
306 Ga0114129_10113280
307 Ga0114129_10538723
308 Ga0105241_10877892
309 Ga0105242_10746053
310 Ga0105237_10320513
311 Ga0105237_10898245
312 Ga0105238_10100084
313 Ga0105238_10691695
314 Ga0105249_10667708
315 Ga0105239_10202201
316 Ga0157370_10027910
317 Ga0157370_10800291
318 Ga0157369_10093901
319 Ga0157378_10559129
320 Ga0157378_10631663
321 Ga0163162_11255840
322 Ga0157372_10094501
323 Ga0157375_10036391
324 Ga0182008_10337083
325 Ga0157379_10448539
326 Ga0163161_10385330
327 Ga0213875_10000003
328 Ga0207426_1014080
329 Ga0207705_10028474
330 Ga0207684_10119674
331 Ga0207684_10151418
332 Ga0207707_10045348
333 Ga0207695_10042017
334 Ga0207695_10383018
335 Ga0207671_10235158
336 Ga0207671_10363401
337 Ga0207662_10209639
338 Ga0207657_10252666
339 Ga0207652_10063194
340 Ga0207652_10162089
341 Ga0207694_10244335
342 Ga0207659_10091495
343 Ga0207664_10286550
344 Ga0207664_10698383
345 Ga0207670_10257793
346 Ga0207669_10222980
347 Ga0207665_10070473
348 Ga0207665_10095229
349 Ga0207691_10266999
350 Ga0207689_10258889
351 Ga0207661_10218210
352 Ga0207667_10009274
353 Ga0207667_10844628
354 Ga0207639_11151606
355 Ga0207641_10125332
356 Ga0207674_10093186
357 Ga0207683_10044255
358 Ga0207698_10006156
359 Ga0207428_10075567
360 Ga0207428_10191615
361 Ga0207428_10326849
362 Ga0268266_10016000
363 Ga0268266_10078192
364 Ga0268265_10123112
365 Ga0268264_10415272
366 Ga0265334_10038095
367 Ga0265340_10095783
368 Ga0307416_100576481
369 Ga0373929_0118358
370 Ga0373936_0045122
371 Ga0373941_0004004
372 Ga0373942_0006826
373 Ga0373942_0035673
374 Ga0373961_0011248
375 Ga0373931_0000696
376 Ga0373935_0144387
377 Ga0373933_0213521
378 Ga0373947_0220816
379 Ga0373947_0353590
380 Ga0373937_1091462
381 Ga0373925_0229790
382 Ga0373925_0457689
383 Ga0395899_0012500
384 Ga0395899_0171288
385 Ga0395900_0041060
386 Ga0395900_0051731
387 Ga0395900_0057128
388 Ga0395898_0086617
389 Ga0395898_0251177
390 Ga0436364_0934425
391 Ga0436364_1170796
392 Ga0395901_0043009
393 Ga0395901_0054737
394 Ga0395901_0106263
395 Ga0395901_0494698
396 Ga0436365_0873251
397 Ga0436365_1459979
398 Ga0436360_0399157
399 Ga0436360_0602615
400 Ga0436360_0726981
401 Ga0436363_0679222
402 Ga0439448_0007716
403 Ga0466963_0008304
404 Ga0466971_0201315
405 Ga0466957_0157440
406 Ga0466967_0016337
407 Ga0495659_0056906
408 Ga0496101_0385738
409 Ga0496104_0010481
410 Ga0496105_0036019
411 Ga0496106_0199513
412 Ga0496108_0052273
413 Ga0496109_0080239
414 Ga0496109_0177288
415 Ga0496110_0061601
416 Ga0496111_0355246
417 Ga0496112_0083086
418 Ga0496112_0119061
419 Ga0496115_0087775
420 Ga0496126_0070009
421 Ga0501034_0005101
422 Ga0501034_0017558
423 Ga0501034_0055981
424 Ga0501034_0096416
425 Ga0501034_1098414
426 Ga0501043_0167062
427 Ga0501067_0494988
428 Ga0501068_0003290
429 Ga0501070_0198961
430 Ga0501070_0294365
431 Ga0501072_1084413
432 Ga0501044_0159438
433 Ga0501044_0169292
434 Ga0501044_0342536
435 Ga0501044_0398515
436 nmdc:mga03n38_35126_c1
437 nmdc:mga00v17_463564_c1
438 nmdc:mga0yw44_116483_c1
439 nmdc:mga06z11_3562_c1
440 nmdc:mga04h51_9562_c1
441 nmdc:mga05p37_50988_c1
442 nmdc:mga09592_123513_c1
443 nmdc:mga0qj67_120762_c1
444 nmdc:mga0qj67_65897_c1
445 nmdc:mga06r32_305076_c1
446 nmdc:mga06r32_37795_c1
447 nmdc:mga08y16_12025_c1
448 nmdc:mga08y16_238075_c1
449 nmdc:mga08y16_646071_c1
450 nmdc:mga0n895_184473_c1
451 nmdc:mga0a205_88447_c1
452 nmdc:mga0sz30_33155_c2
453 nmdc:mga0sz30_59483_c1
454 Ga0500647_0022694
455 Ga0500651_0199882
456 Ga0500655_009658
457 Ga0500616_0006145
458 Ga0500620_108816
459 Ga0500609_007849
460 Ga0500552_000222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

31

231

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cyy-assembly2.cif.gz_C structure of the c-terminal domains of dipz from mycobacterium tuberculosis 0.8811 2 39
2imd-assembly1.cif.gz_A structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) 0.8039 4 194
3rpn-assembly3.cif.gz_F crystal structure of human kappa class glutathione transferase in complex with s-hexylglutathione 0.8025 2 197
3fz5-assembly1.cif.gz_A crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.7965 3 195
3grx-assembly1.cif.gz_A nmr structure of escherichia coli glutaredoxin 3-glutathione mixed disulfide complex, 20 structures 0.7909 3 38
ID Description Score Start End Superfamily
af_Q18973_4_212_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.801 5 192 3.40.30.10
3rppC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7978 2 192 3.40.30.10
3grxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7909 3 38 3.40.30.10
5cp1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7906 2 194 3.40.30.10
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7874 4 194 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A259MTN3-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9913 2 199 GO:0016491
GO:0018845
AF-A0A521RK46-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9887 2 199 GO:0016491
AF-A0A537NA34-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9853 1 199 GO:0016491
GO:0018845
AF-A0A259MTN3-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9815 2 199 GO:0016491
GO:0018845
AF-A0A537NA34-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9804 1 199 GO:0016491
GO:0018845

Map