F342460

General Info

Members Datasets Scaffolds Average Seq Length
229 159 458 161

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0284322|Ga0501044_0284322_899_1471
Length 174
Sequence VTDGGGGDGAASDRAGAALVLGDVKEGHEVPALAYDVTATTVVLGALATRDWRPMHHDVDFAVNRNGTRDIFLNTPNQQAWLERFVTDWTGPLGRPGRLRFRMRDSVYPGETMTLTGTVAAAGTDATGCGWATVDVEVRSGRPARLCTTATMRVALPTTPGDNPWRRHDDRWAP

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
63 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
94 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
95 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
153 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
154 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
155 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
156 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 1.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.3
Nodule 0
Rhizoplane 4.37
Rhizosphere 84.72
Stem 0
Stem Tuber 0
Unclassified 10.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0284322 3300049823 Bacteria 1587
2 Ga0070687_100302152 3300005343 Bacteria 1016
3 Ga0070675_100319352 3300005354 Bacteria 1372
4 Ga0070671_100007862 3300005355 Bacteria 8526
5 Ga0070667_100491781 3300005367 Bacteria 1124
6 Ga0070667_101010166 3300005367 Bacteria 776
7 Ga0070703_10117225 3300005406 Bacteria 961
8 Ga0070708_100508334 3300005445 Bacteria 1137
9 Ga0070662_100126831 3300005457 Bacteria 1962
10 Ga0070681_11465809 3300005458 Bacteria 607
11 Ga0070706_100551939 3300005467 Bacteria 1072
12 Ga0068856_101311584 3300005614 Bacteria 739
13 Ga0068861_100599213 3300005719 Bacteria 1011
14 Ga0068851_10282225 3300005834 Bacteria 950
15 Ga0068858_100015601 3300005842 Bacteria 7146
16 Ga0068858_100190934 3300005842 Bacteria 1936
17 Ga0075365_10018271 3300006038 Bacteria 4309
18 Ga0075365_10081563 3300006038 Bacteria 2192
19 Ga0075365_10707115 3300006038 Bacteria 712
20 Ga0075365_11153678 3300006038 Bacteria 545
21 Ga0075363_100108428 3300006048 Bacteria 1542
22 Ga0075432_10436377 3300006058 Unclassified 572
23 Ga0075428_100110691 3300006844 Bacteria 2992
24 Ga0075430_100829619 3300006846 Unclassified 762
25 Ga0105240_10037004 3300009093 Bacteria 6273
26 Ga0105240_10765402 3300009093 Bacteria 1049
27 Ga0111539_10227387 3300009094 Bacteria 2173
28 Ga0111539_10713018 3300009094 Bacteria 1168
29 Ga0105245_10022708 3300009098 Bacteria 5506
30 Ga0105245_10370277 3300009098 Unclassified 1424
31 Ga0114129_10144354 3300009147 Bacteria 3261
32 Ga0114129_10178989 3300009147 Bacteria 2887
33 Ga0114129_10200533 3300009147 Bacteria 2703
34 Ga0105243_10310994 3300009148 Bacteria 1432
35 Ga0105243_10323267 3300009148 Bacteria 1407
36 Ga0105241_10049647 3300009174 Bacteria 3196
37 Ga0105249_10310176 3300009553 Bacteria 1586
38 Ga0105249_10752929 3300009553 Bacteria 1036
39 Ga0105239_11024741 3300010375 Bacteria 949
40 Ga0157378_10105772 3300013297 Unclassified 2574
41 Ga0163162_10286494 3300013306 Bacteria 1779
42 Ga0157372_11698668 3300013307 Bacteria 726
43 Ga0157375_11265589 3300013308 Bacteria 866
44 Ga0157380_11005167 3300014326 Bacteria 868
45 Ga0163161_10327999 3300017792 Bacteria 1212
46 Ga0206353_10409189 3300020082 Bacteria 723
47 Ga0213873_10018685 3300021358 Bacteria 1597
48 Ga0213876_10137537 3300021384 Bacteria 1299
49 Ga0213876_10307824 3300021384 Bacteria 842
50 Ga0224712_10006255 3300022467 Bacteria 3380
51 Ga0207656_10399464 3300025321 Bacteria 691
52 Ga0207680_10447621 3300025903 Bacteria 917
53 Ga0207647_10050293 3300025904 Bacteria 2581
54 Ga0207684_10573385 3300025910 Unclassified 965
55 Ga0207654_10013107 3300025911 Bacteria 4260
56 Ga0207695_10028265 3300025913 Bacteria 6224
57 Ga0207671_10001844 3300025914 Bacteria 23655
58 Ga0207662_10154803 3300025918 Bacteria 1460
59 Ga0207694_10013758 3300025924 Bacteria 6099
60 Ga0207650_10129395 3300025925 Unclassified 1974
61 Ga0207659_10327653 3300025926 Bacteria 1265
62 Ga0207687_10046772 3300025927 Bacteria 2997
63 Ga0207687_10205079 3300025927 Bacteria 1543
64 Ga0207644_10018608 3300025931 Bacteria 4702
65 Ga0207706_10077746 3300025933 Bacteria 2918
66 Ga0207709_10249979 3300025935 Bacteria 1294
67 Ga0207667_10301481 3300025949 Bacteria 1637
68 Ga0207640_10079083 3300025981 Bacteria 2240
69 Ga0207658_10945192 3300025986 Bacteria 786
70 Ga0207658_10972796 3300025986 Bacteria 774
71 Ga0207677_10111902 3300026023 Bacteria 2035
72 Ga0207708_10017885 3300026075 Bacteria 5335
73 Ga0207702_11349085 3300026078 Bacteria 707
74 Ga0207648_10496799 3300026089 Bacteria 1116
75 Ga0207674_10241288 3300026116 Bacteria 1754
76 Ga0207675_100599393 3300026118 Bacteria 1104
77 Ga0265326_10065273 3300028558 Unclassified 1029
78 Ga0265336_10117836 3300028666 Bacteria 791
79 Ga0265338_10015068 3300028800 Bacteria 8532
80 Ga0265760_10181313 3300031090 Bacteria 704
81 Ga0265320_10062529 3300031240 Bacteria 1773
82 Ga0265325_10402993 3300031241 Bacteria 599
83 Ga0265327_10000005 3300031251 Bacteria 790146
84 Ga0265327_10000252 3300031251 Bacteria 106339
85 Ga0265327_10078554 3300031251 Bacteria 1635
86 Ga0265327_10215674 3300031251 Unclassified 865
87 Ga0265316_10422189 3300031344 Bacteria 959
88 Ga0307408_100573380 3300031548 Bacteria 999
89 Ga0316575_10292859 3300031665 Bacteria 688
90 Ga0316576_10270733 3300031727 Bacteria 1273
91 Ga0316578_10394953 3300031728 Bacteria 820
92 Ga0307413_10040575 3300031824 Bacteria 2717
93 Ga0307413_10193586 3300031824 Bacteria 1462
94 Ga0307410_10006761 3300031852 Bacteria 6220
95 Ga0307410_10014598 3300031852 Bacteria 4628
96 Ga0307407_10035924 3300031903 Bacteria 2726
97 Ga0307412_11818141 3300031911 Bacteria 561
98 Ga0307409_100024906 3300031995 Bacteria 4185
99 Ga0307416_100154507 3300032002 Bacteria 2110
100 Ga0307416_100466087 3300032002 Bacteria 1320
101 Ga0307411_10011490 3300032005 Bacteria 4782
102 Ga0307411_10209030 3300032005 Bacteria 1505
103 Ga0307415_100705920 3300032126 Bacteria 911
104 Ga0373938_0089549 3300034957 Bacteria 760
105 Ga0316574_0332971 3300035398 Bacteria 962
106 Ga0373935_0168349 3300035692 Bacteria 1497
107 Ga0373927_0111990 3300035695 Bacteria 1779
108 Ga0373947_0186448 3300035725 Unclassified 1353
109 Ga0373947_0713441 3300035725 Bacteria 684
110 Ga0373937_0017556 3300036401 Bacteria 6378
111 Ga0373937_1094340 3300036401 Bacteria 746
112 Ga0316582_0368326 3300036647 Bacteria 989
113 Ga0373925_0231318 3300037068 Unclassified 1478
114 Ga0436365_0955215 3300039437 Bacteria 8449
115 Ga0436365_1109361 3300039437 Bacteria 897
116 Ga0436365_1403099 3300039437 Bacteria 2120
117 Ga0436365_1591998 3300039437 Bacteria 18516
118 Ga0436360_0255005 3300039438 Bacteria 668
119 Ga0436360_1203965 3300039438 Bacteria 1214
120 Ga0436362_0606329 3300039453 Bacteria 2275
121 Ga0436362_1169156 3300039453 Bacteria 8538
122 Ga0451793_1807245 3300041452 Bacteria 1425
123 Ga0450888_048939 3300042126 Bacteria 602
124 Ga0450905_020974 3300042142 Bacteria 964
125 Ga0466966_0661168 3300044684 Unclassified 629
126 Ga0466963_0036579 3300044694 Bacteria 3203
127 Ga0466958_0210622 3300045836 Bacteria 1238
128 Ga0466958_0606261 3300045836 Bacteria 712
129 Ga0466967_1288668 3300045976 Bacteria 728
130 Ga0495592_0049964 3300046454 Bacteria 3108
131 Ga0495651_0000176 3300046462 Bacteria 47308
132 Ga0495653_0199092 3300046463 Bacteria 1361
133 Ga0495582_0149258 3300046473 Bacteria 1327
134 Ga0495582_0265337 3300046473 Unclassified 985
135 Ga0495628_0034511 3300046516 Bacteria 4068
136 Ga0495628_0192332 3300046516 Bacteria 1540
137 Ga0495666_0312281 3300046526 Bacteria 710
138 Ga0495652_0006412 3300046529 Bacteria 10952
139 Ga0495652_0149609 3300046529 Bacteria 1826
140 Ga0495587_0103551 3300046536 Bacteria 1639
141 Ga0495645_0031090 3300046543 Bacteria 3888
142 Ga0495645_0331173 3300046543 Bacteria 986
143 Ga0495667_0120264 3300046559 Bacteria 1696
144 Ga0495667_0260102 3300046559 Bacteria 1104
145 Ga0495667_0614504 3300046559 Bacteria 677
146 Ga0495667_0804848 3300046559 Bacteria 579
147 Ga0495635_0756545 3300046663 Bacteria 628
148 Ga0495658_0386383 3300046683 Bacteria 892
149 Ga0495624_0238930 3300046690 Bacteria 1100
150 Ga0495600_0009119 3300046809 Bacteria 6118
151 Ga0495600_0398696 3300046809 Unclassified 856
152 Ga0495604_0052669 3300047317 Bacteria 3150
153 Ga0495672_0001624 3300047320 Bacteria 21893
154 Ga0495676_0260519 3300047321 Unclassified 1180
155 Ga0495675_0579410 3300047444 Bacteria 638
156 Ga0495614_0249248 3300048089 Bacteria 812
157 Ga0496102_0363290 3300048905 Bacteria 1363
158 Ga0496105_0073528 3300048908 Bacteria 2824
159 Ga0496106_0797958 3300048909 Unclassified 749
160 Ga0496107_0181338 3300048910 Unclassified 1564
161 Ga0496107_0620019 3300048910 Unclassified 799
162 Ga0496108_0225343 3300048911 Bacteria 1629
163 Ga0496109_0089882 3300048912 Bacteria 2840
164 Ga0496109_0111830 3300048912 Bacteria 2540
165 Ga0496114_0315957 3300048917 Bacteria 1380
166 Ga0501031_0390634 3300049568 Bacteria 900
167 Ga0501031_0938623 3300049568 Bacteria 553
168 Ga0501032_0018795 3300049569 Bacteria 4836
169 Ga0501032_0141621 3300049569 Bacteria 1583
170 Ga0501033_0021857 3300049570 Bacteria 4828
171 Ga0501034_0070032 3300049571 Bacteria 3519
172 Ga0501034_0105110 3300049571 Bacteria 2817
173 Ga0501034_0360034 3300049571 Bacteria 1382
174 Ga0501037_0022624 3300049573 Bacteria 4648
175 Ga0501038_0004412 3300049574 Bacteria 13089
176 Ga0501039_0348521 3300049575 Bacteria 1164
177 Ga0501043_0031493 3300049579 Bacteria 4169
178 Ga0501043_0792012 3300049579 Bacteria 686
179 Ga0501047_0304053 3300049581 Bacteria 1437
180 Ga0501067_0538939 3300049583 Bacteria 653
181 Ga0501069_0003177 3300049585 Bacteria 8418
182 Ga0501069_0316933 3300049585 Unclassified 916
183 Ga0501070_0003310 3300049586 Bacteria 13992
184 Ga0501070_0055567 3300049586 Bacteria 3281
185 Ga0501070_0426605 3300049586 Bacteria 1070
186 Ga0501070_0449800 3300049586 Bacteria 1039
187 Ga0501073_0049250 3300049589 Unclassified 2955
188 Ga0501073_0077556 3300049589 Bacteria 2312
189 Ga0501073_0316502 3300049589 Bacteria 1077
190 Ga0501074_0027027 3300049590 Bacteria 4158
191 Ga0501074_0115566 3300049590 Bacteria 1920
192 Ga0501074_0351946 3300049590 Bacteria 1045
193 Ga0501079_0006015 3300049741 Bacteria 9090
194 Ga0501079_0651941 3300049741 Bacteria 829
195 Ga0501080_0002211 3300049742 Bacteria 16902
196 Ga0501080_0017273 3300049742 Bacteria 6668
197 Ga0501080_0088976 3300049742 Bacteria 2868
198 Ga0501044_0151852 3300049823 Unclassified 2298
199 Ga0501044_0215158 3300049823 Bacteria 1874
200 Ga0501044_0923039 3300049823 Bacteria 747
201 nmdc:mga03n38_245450_c1 3300050490 Bacteria 944
202 nmdc:mga00v17_141501_c1 3300050491 Bacteria 1139
203 nmdc:mga00v17_446085_c1 3300050491 Bacteria 840
204 nmdc:mga0yw44_95533_c1 3300050492 Bacteria 1885
205 nmdc:mga06z11_175938_c1 3300050494 Bacteria 1231
206 nmdc:mga06z11_303023_c1 3300050494 Bacteria 950
207 nmdc:mga06z11_92766_c2 3300050494 Bacteria 692
208 nmdc:mga05p37_262486_c1 3300050507 Unclassified 2066
209 nmdc:mga0qj67_1026000_c1 3300050509 Unclassified 646
210 nmdc:mga0qj67_369025_c1 3300050509 Bacteria 1159
211 nmdc:mga0a205_428926_c1 3300050515 Bacteria 1183
212 Ga0495601_0023091 3300053077 Bacteria 3820
213 Ga0495601_0031239 3300053077 Bacteria 3310
214 Ga0495601_0216274 3300053077 Bacteria 1252
215 Ga0495601_0225935 3300053077 Bacteria 1223
216 Ga0495612_0040825 3300053078 Bacteria 1891
217 Ga0495612_0137484 3300053078 Bacteria 1058
218 Ga0495619_0150106 3300053085 Unclassified 1608
219 Ga0500646_0000516 3300053090 Bacteria 11330
220 Ga0500583_0250726 3300053092 Unclassified 874
221 Ga0500654_119635 3300053099 Bacteria 1042
222 Ga0500573_0054260 3300053140 Bacteria 2301
223 Ga0500588_0092430 3300053146 Unclassified 1030
224 Ga0500616_0001779 3300053153 Bacteria 19685
225 Ga0500616_0026211 3300053153 Bacteria 3228
226 Ga0501084_0000059 3300054114 Bacteria 86630
227 Ga0501084_1139006 3300054114 Bacteria 655
228 Ga0501082_0681419 3300060353 Bacteria 900
229 Ga0501082_1122830 3300060353 Bacteria 687
230 Ga0501044_0284322
231 Ga0070687_100302152
232 Ga0070675_100319352
233 Ga0070671_100007862
234 Ga0070667_100491781
235 Ga0070667_101010166
236 Ga0070703_10117225
237 Ga0070708_100508334
238 Ga0070662_100126831
239 Ga0070681_11465809
240 Ga0070706_100551939
241 Ga0068856_101311584
242 Ga0068861_100599213
243 Ga0068851_10282225
244 Ga0068858_100015601
245 Ga0068858_100190934
246 Ga0075365_10018271
247 Ga0075365_10081563
248 Ga0075365_10707115
249 Ga0075365_11153678
250 Ga0075363_100108428
251 Ga0075432_10436377
252 Ga0075428_100110691
253 Ga0075430_100829619
254 Ga0105240_10037004
255 Ga0105240_10765402
256 Ga0111539_10227387
257 Ga0111539_10713018
258 Ga0105245_10022708
259 Ga0105245_10370277
260 Ga0114129_10144354
261 Ga0114129_10178989
262 Ga0114129_10200533
263 Ga0105243_10310994
264 Ga0105243_10323267
265 Ga0105241_10049647
266 Ga0105249_10310176
267 Ga0105249_10752929
268 Ga0105239_11024741
269 Ga0157378_10105772
270 Ga0163162_10286494
271 Ga0157372_11698668
272 Ga0157375_11265589
273 Ga0157380_11005167
274 Ga0163161_10327999
275 Ga0206353_10409189
276 Ga0213873_10018685
277 Ga0213876_10137537
278 Ga0213876_10307824
279 Ga0224712_10006255
280 Ga0207656_10399464
281 Ga0207680_10447621
282 Ga0207647_10050293
283 Ga0207684_10573385
284 Ga0207654_10013107
285 Ga0207695_10028265
286 Ga0207671_10001844
287 Ga0207662_10154803
288 Ga0207694_10013758
289 Ga0207650_10129395
290 Ga0207659_10327653
291 Ga0207687_10046772
292 Ga0207687_10205079
293 Ga0207644_10018608
294 Ga0207706_10077746
295 Ga0207709_10249979
296 Ga0207667_10301481
297 Ga0207640_10079083
298 Ga0207658_10945192
299 Ga0207658_10972796
300 Ga0207677_10111902
301 Ga0207708_10017885
302 Ga0207702_11349085
303 Ga0207648_10496799
304 Ga0207674_10241288
305 Ga0207675_100599393
306 Ga0265326_10065273
307 Ga0265336_10117836
308 Ga0265338_10015068
309 Ga0265760_10181313
310 Ga0265320_10062529
311 Ga0265325_10402993
312 Ga0265327_10000005
313 Ga0265327_10000252
314 Ga0265327_10078554
315 Ga0265327_10215674
316 Ga0265316_10422189
317 Ga0307408_100573380
318 Ga0316575_10292859
319 Ga0316576_10270733
320 Ga0316578_10394953
321 Ga0307413_10040575
322 Ga0307413_10193586
323 Ga0307410_10006761
324 Ga0307410_10014598
325 Ga0307407_10035924
326 Ga0307412_11818141
327 Ga0307409_100024906
328 Ga0307416_100154507
329 Ga0307416_100466087
330 Ga0307411_10011490
331 Ga0307411_10209030
332 Ga0307415_100705920
333 Ga0373938_0089549
334 Ga0316574_0332971
335 Ga0373935_0168349
336 Ga0373927_0111990
337 Ga0373947_0186448
338 Ga0373947_0713441
339 Ga0373937_0017556
340 Ga0373937_1094340
341 Ga0316582_0368326
342 Ga0373925_0231318
343 Ga0436365_0955215
344 Ga0436365_1109361
345 Ga0436365_1403099
346 Ga0436365_1591998
347 Ga0436360_0255005
348 Ga0436360_1203965
349 Ga0436362_0606329
350 Ga0436362_1169156
351 Ga0451793_1807245
352 Ga0450888_048939
353 Ga0450905_020974
354 Ga0466966_0661168
355 Ga0466963_0036579
356 Ga0466958_0210622
357 Ga0466958_0606261
358 Ga0466967_1288668
359 Ga0495592_0049964
360 Ga0495651_0000176
361 Ga0495653_0199092
362 Ga0495582_0149258
363 Ga0495582_0265337
364 Ga0495628_0034511
365 Ga0495628_0192332
366 Ga0495666_0312281
367 Ga0495652_0006412
368 Ga0495652_0149609
369 Ga0495587_0103551
370 Ga0495645_0031090
371 Ga0495645_0331173
372 Ga0495667_0120264
373 Ga0495667_0260102
374 Ga0495667_0614504
375 Ga0495667_0804848
376 Ga0495635_0756545
377 Ga0495658_0386383
378 Ga0495624_0238930
379 Ga0495600_0009119
380 Ga0495600_0398696
381 Ga0495604_0052669
382 Ga0495672_0001624
383 Ga0495676_0260519
384 Ga0495675_0579410
385 Ga0495614_0249248
386 Ga0496102_0363290
387 Ga0496105_0073528
388 Ga0496106_0797958
389 Ga0496107_0181338
390 Ga0496107_0620019
391 Ga0496108_0225343
392 Ga0496109_0089882
393 Ga0496109_0111830
394 Ga0496114_0315957
395 Ga0501031_0390634
396 Ga0501031_0938623
397 Ga0501032_0018795
398 Ga0501032_0141621
399 Ga0501033_0021857
400 Ga0501034_0070032
401 Ga0501034_0105110
402 Ga0501034_0360034
403 Ga0501037_0022624
404 Ga0501038_0004412
405 Ga0501039_0348521
406 Ga0501043_0031493
407 Ga0501043_0792012
408 Ga0501047_0304053
409 Ga0501067_0538939
410 Ga0501069_0003177
411 Ga0501069_0316933
412 Ga0501070_0003310
413 Ga0501070_0055567
414 Ga0501070_0426605
415 Ga0501070_0449800
416 Ga0501073_0049250
417 Ga0501073_0077556
418 Ga0501073_0316502
419 Ga0501074_0027027
420 Ga0501074_0115566
421 Ga0501074_0351946
422 Ga0501079_0006015
423 Ga0501079_0651941
424 Ga0501080_0002211
425 Ga0501080_0017273
426 Ga0501080_0088976
427 Ga0501044_0151852
428 Ga0501044_0215158
429 Ga0501044_0923039
430 nmdc:mga03n38_245450_c1
431 nmdc:mga00v17_141501_c1
432 nmdc:mga00v17_446085_c1
433 nmdc:mga0yw44_95533_c1
434 nmdc:mga06z11_175938_c1
435 nmdc:mga06z11_303023_c1
436 nmdc:mga06z11_92766_c2
437 nmdc:mga05p37_262486_c1
438 nmdc:mga0qj67_1026000_c1
439 nmdc:mga0qj67_369025_c1
440 nmdc:mga0a205_428926_c1
441 Ga0495601_0023091
442 Ga0495601_0031239
443 Ga0495601_0216274
444 Ga0495601_0225935
445 Ga0495612_0040825
446 Ga0495612_0137484
447 Ga0495619_0150106
448 Ga0500646_0000516
449 Ga0500583_0250726
450 Ga0500654_119635
451 Ga0500573_0054260
452 Ga0500588_0092430
453 Ga0500616_0001779
454 Ga0500616_0026211
455 Ga0501084_0000059
456 Ga0501084_1139006
457 Ga0501082_0681419
458 Ga0501082_1122830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w78-assembly1.cif.gz_F crystal structure of the chsh1-chsh2 complex from mycobacterium tuberculosis 0.9537 11 140
4w78-assembly1.cif.gz_F crystal structure of the chsh1-chsh2 complex from mycobacterium tuberculosis 0.9248 11 140
3d6x-assembly1.cif.gz_F crystal structure of campylobacter jejuni fabz 0.9053 80 139
1tbu-assembly1.cif.gz_D crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.8899 63 140
3doz-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase (fabz) from helicobacter pylori in complex with compound 3k 0.886 80 139
ID Description Score Start End Superfamily
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9537 11 140 3.10.129.10
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9248 11 140 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8835 9 141 3.10.129.10
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8756 10 140 3.10.129.10
1tbuC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8711 63 140 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A538BDJ2-F1-model_v4 Uncharacterized protein 0.9831 3 143
AF-A0A2E4SU87-F1-model_v4 MaoC-like domain-containing protein 0.9823 5 134
AF-A0A351LZW9-F1-model_v4 Uncharacterized protein 0.9822 5 158
AF-A0A2E5NTP2-F1-model_v4 Uncharacterized protein 0.9788 5 158
AF-A0A538LWT1-F1-model_v4 Uncharacterized protein 0.9766 2 158

Map