F342405

General Info

Members Datasets Scaffolds Average Seq Length
229 157 458 192

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0032872|Ga0501031_0032872_1460_2092
Length 210
Sequence MDRQQSTIAIRDCPGQRPYADCVTTTLRRQLVSAAVDLTLAHGWSQVTMSRLAAEVGVSRQTVYNEIGTKSALAEAMILSELERFLAVVTEAFDHQPDDLVAAIEEATRGVLELAQGNDLLKAVVSATHGADTELLPLLTTHSESLLAVAKEVVAERVSAYPVPLDPDRLDAAIDVVVRVVLSHVMQPSASPAETAAALAWICSRVLREP

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
92 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
93 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
94 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
95 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
143 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
144 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
145 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
146 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
147 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
151 2643221561 Nocardioides sp. Root151 Isolate Unclassified
152 2643221615 Nocardioides sp. Root224 Isolate Unclassified
153 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
154 2643221696 Nocardioides sp. Root140 Isolate Unclassified
155 2739367898 Nocardioides sp. CF479 Isolate Unclassified
156 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
157 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 0
Isolates 3.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.65
Nodule 0
Rhizoplane 4.37
Rhizosphere 72.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0032872 3300049568 Bacteria 3382
2 Ga0070683_100004428 3300005329 Bacteria 11579
3 Ga0070683_100221007 3300005329 Bacteria 1800
4 Ga0068869_101005261 3300005334 Bacteria 726
5 Ga0070682_100056817 3300005337 Bacteria 2463
6 Ga0070682_100367363 3300005337 Bacteria 1078
7 Ga0070660_100006504 3300005339 Bacteria 8106
8 Ga0070661_100175926 3300005344 Bacteria 1627
9 Ga0070675_100469699 3300005354 Bacteria 1130
10 Ga0070671_100411754 3300005355 Bacteria 1157
11 Ga0070659_100047145 3300005366 Bacteria 3379
12 Ga0070667_100112651 3300005367 Bacteria 2360
13 Ga0070694_100444734 3300005444 Bacteria 1022
14 Ga0068867_100431008 3300005459 Bacteria 1119
15 Ga0070685_10119577 3300005466 Bacteria 1634
16 Ga0070685_10214868 3300005466 Bacteria 1257
17 Ga0070698_100001488 3300005471 Bacteria 26030
18 Ga0070684_100007235 3300005535 Bacteria 8625
19 Ga0068853_100280132 3300005539 Bacteria 1537
20 Ga0070686_100168522 3300005544 Bacteria 1547
21 Ga0068855_100052370 3300005563 Bacteria 4806
22 Ga0070664_101040898 3300005564 Bacteria 770
23 Ga0068857_100066476 3300005577 Bacteria 3208
24 Ga0068857_100230480 3300005577 Bacteria 1694
25 Ga0068854_100530682 3300005578 Bacteria 995
26 Ga0068852_100502077 3300005616 Bacteria 1208
27 Ga0068864_100078966 3300005618 Bacteria 2881
28 Ga0068861_100634948 3300005719 Bacteria 985
29 Ga0068870_10494773 3300005840 Bacteria 814
30 Ga0068863_100395520 3300005841 Bacteria 1351
31 Ga0068860_100000504 3300005843 Bacteria 48482
32 Ga0068860_100058111 3300005843 Bacteria 3677
33 Ga0081539_10017323 3300005985 Bacteria 5066
34 Ga0075365_10013039 3300006038 Bacteria 4958
35 Ga0075365_10056267 3300006038 Bacteria 2614
36 Ga0075365_10065680 3300006038 Bacteria 2432
37 Ga0075365_10106213 3300006038 Bacteria 1926
38 Ga0075365_10115947 3300006038 Bacteria 1844
39 Ga0075365_10164902 3300006038 Bacteria 1545
40 Ga0075365_10242712 3300006038 Bacteria 1265
41 Ga0075365_10292271 3300006038 Bacteria 1146
42 Ga0075365_10725667 3300006038 Bacteria 702
43 Ga0075363_100014681 3300006048 Bacteria 3835
44 Ga0075364_10030413 3300006051 Bacteria 3465
45 Ga0075364_10054574 3300006051 Bacteria 2613
46 Ga0075364_10076782 3300006051 Bacteria 2204
47 Ga0075364_10234862 3300006051 Bacteria 1245
48 Ga0075364_10493807 3300006051 Bacteria 837
49 Ga0075364_10686516 3300006051 Bacteria 699
50 Ga0075367_10002397 3300006178 Bacteria 8551
51 Ga0075367_10007389 3300006178 Bacteria 5622
52 Ga0075367_10113887 3300006178 Bacteria 1662
53 Ga0075369_10135202 3300006186 Bacteria 1122
54 Ga0075370_10008963 3300006353 Bacteria 5173
55 Ga0068871_100178221 3300006358 Bacteria 1825
56 Ga0068865_100120768 3300006881 Bacteria 1948
57 Ga0105245_10003886 3300009098 Bacteria 13287
58 Ga0105243_10083113 3300009148 Bacteria 2619
59 Ga0105243_11233030 3300009148 Bacteria 762
60 Ga0105243_11331709 3300009148 Bacteria 736
61 Ga0105237_10110808 3300009545 Bacteria 2736
62 Ga0105238_10143826 3300009551 Bacteria 2361
63 Ga0105249_10080065 3300009553 Bacteria 3034
64 Ga0105239_10007524 3300010375 Bacteria 12489
65 Ga0105246_10002197 3300011119 Bacteria 11771
66 Ga0105246_10345523 3300011119 Bacteria 1217
67 Ga0157371_10076351 3300013102 Bacteria 2372
68 Ga0157369_10068490 3300013105 Bacteria 3813
69 Ga0163162_10024383 3300013306 Bacteria 5970
70 Ga0157372_10101550 3300013307 Bacteria 3284
71 Ga0157372_11339732 3300013307 Bacteria 826
72 Ga0157375_10016461 3300013308 Bacteria 6645
73 Ga0157375_10217613 3300013308 Bacteria 2068
74 Ga0163163_10063923 3300014325 Bacteria 3651
75 Ga0163163_10084752 3300014325 Bacteria 3176
76 Ga0163163_11431785 3300014325 Bacteria 753
77 Ga0157380_10073352 3300014326 Bacteria 2774
78 Ga0157380_10516508 3300014326 Bacteria 1164
79 Ga0157376_10226318 3300014969 Bacteria 1735
80 Ga0163161_10044877 3300017792 Bacteria 3185
81 Ga0207642_10479507 3300025899 Bacteria 758
82 Ga0207688_10037717 3300025901 Bacteria 2681
83 Ga0207688_10298986 3300025901 Bacteria 984
84 Ga0207643_10203437 3300025908 Bacteria 1206
85 Ga0207705_10030564 3300025909 Bacteria 3843
86 Ga0207662_10305980 3300025918 Bacteria 1058
87 Ga0207657_10011855 3300025919 Bacteria 8629
88 Ga0207649_10136916 3300025920 Bacteria 1671
89 Ga0207687_10028592 3300025927 Bacteria 3745
90 Ga0207644_10317135 3300025931 Bacteria 1260
91 Ga0207690_10113503 3300025932 Bacteria 1955
92 Ga0207704_10261149 3300025938 Bacteria 1306
93 Ga0207691_10650005 3300025940 Bacteria 891
94 Ga0207711_10381159 3300025941 Bacteria 1308
95 Ga0207661_10055082 3300025944 Bacteria 3188
96 Ga0207661_10268681 3300025944 Bacteria 1521
97 Ga0207712_10120085 3300025961 Bacteria 1987
98 Ga0207668_10450782 3300025972 Bacteria 1098
99 Ga0207658_10060922 3300025986 Bacteria 2818
100 Ga0207658_10087593 3300025986 Bacteria 2405
101 Ga0207658_10484318 3300025986 Bacteria 1100
102 Ga0207703_10076587 3300026035 Bacteria 2775
103 Ga0207639_10688175 3300026041 Bacteria 948
104 Ga0207678_10149577 3300026067 Bacteria 1993
105 Ga0207702_10201819 3300026078 Bacteria 1844
106 Ga0207641_10449639 3300026088 Bacteria 1245
107 Ga0207676_10379531 3300026095 Bacteria 1315
108 Ga0207674_10007052 3300026116 Bacteria 13137
109 Ga0207674_10331903 3300026116 Bacteria 1470
110 Ga0207675_100016130 3300026118 Bacteria 6978
111 Ga0207698_10437938 3300026142 Bacteria 1259
112 Ga0268266_10058226 3300028379 Bacteria 3326
113 Ga0268264_10000547 3300028381 Bacteria 47223
114 Ga0316181_1274753 3300030744 Bacteria 1102
115 Ga0307405_10319947 3300031731 Bacteria 1185
116 Ga0307413_10809993 3300031824 Bacteria 788
117 Ga0307410_10513875 3300031852 Bacteria 987
118 Ga0307407_10105637 3300031903 Bacteria 1757
119 Ga0307407_10219531 3300031903 Bacteria 1285
120 Ga0307407_10439932 3300031903 Bacteria 944
121 Ga0307412_10200462 3300031911 Bacteria 1515
122 Ga0307409_100671352 3300031995 Bacteria 1032
123 Ga0307409_100866401 3300031995 Bacteria 915
124 Ga0307409_101159477 3300031995 Bacteria 795
125 Ga0307416_100171181 3300032002 Bacteria 2022
126 Ga0307415_100115423 3300032126 Bacteria 2001
127 Ga0307415_100150328 3300032126 Bacteria 1791
128 Ga0395901_0131596 3300038443 Bacteria 2629
129 Ga0439438_008155 3300041405 Bacteria 3504
130 Ga0439447_032557 3300041407 Bacteria 1303
131 Ga0439431_0027562 3300041997 Bacteria 1396
132 Ga0439457_045362 3300042014 Bacteria 982
133 Ga0450907_015818 3300042146 Bacteria 1258
134 Ga0450907_022386 3300042146 Bacteria 1065
135 Ga0439434_0046803 3300042435 Bacteria 1335
136 Ga0466965_0068418 3300044683 Bacteria 1783
137 Ga0466966_0067942 3300044684 Bacteria 2238
138 Ga0466963_0198954 3300044694 Bacteria 1401
139 Ga0466964_0057356 3300044706 Bacteria 1612
140 Ga0466964_0089618 3300044706 Bacteria 1336
141 Ga0466970_0012507 3300044765 Bacteria 4342
142 Ga0466960_0002867 3300044901 Bacteria 6538
143 Ga0466960_0235126 3300044901 Bacteria 1013
144 Ga0496100_0538658 3300048903 Bacteria 902
145 Ga0496101_0075339 3300048904 Bacteria 2484
146 Ga0496102_0020509 3300048905 Bacteria 5840
147 Ga0496103_0555575 3300048906 Bacteria 733
148 Ga0496107_0032659 3300048910 Bacteria 3720
149 Ga0496107_0405181 3300048910 Bacteria 1014
150 Ga0496108_0142995 3300048911 Bacteria 2061
151 Ga0496110_0045933 3300048913 Bacteria 3819
152 Ga0496111_0002615 3300048914 Bacteria 10911
153 Ga0496111_0283204 3300048914 Bacteria 1229
154 Ga0496124_0305314 3300048927 Bacteria 1147
155 Ga0501032_0120995 3300049569 Bacteria 1730
156 Ga0501033_0027872 3300049570 Bacteria 4245
157 Ga0501033_0170381 3300049570 Bacteria 1564
158 Ga0501036_0035313 3300049572 Bacteria 4230
159 Ga0501036_0247012 3300049572 Bacteria 1496
160 Ga0501037_0114897 3300049573 Bacteria 1938
161 Ga0501037_0147099 3300049573 Bacteria 1685
162 Ga0501038_0006244 3300049574 Bacteria 11014
163 Ga0501039_0009167 3300049575 Bacteria 7540
164 Ga0501040_0003815 3300049576 Bacteria 9776
165 Ga0501041_0010550 3300049577 Bacteria 5447
166 Ga0501041_0438359 3300049577 Bacteria 829
167 Ga0501042_0005624 3300049578 Bacteria 8084
168 Ga0501048_0002929 3300049582 Bacteria 13044
169 Ga0501067_0327225 3300049583 Bacteria 853
170 Ga0501068_0510506 3300049584 Bacteria 780
171 Ga0501069_0417052 3300049585 Bacteria 796
172 Ga0501070_0054185 3300049586 Bacteria 3326
173 Ga0501070_0209699 3300049586 Bacteria 1599
174 Ga0501070_0212386 3300049586 Bacteria 1588
175 Ga0501070_0299733 3300049586 Bacteria 1309
176 Ga0501071_0042656 3300049587 Bacteria 3251
177 Ga0501071_0124306 3300049587 Bacteria 1914
178 Ga0501072_0007312 3300049588 Bacteria 8375
179 Ga0501072_0089421 3300049588 Bacteria 2444
180 Ga0501074_0008801 3300049590 Bacteria 7317
181 Ga0501075_0097940 3300049591 Bacteria 2226
182 Ga0501075_0622165 3300049591 Bacteria 823
183 Ga0501076_0002751 3300049592 Bacteria 12178
184 Ga0501076_0073146 3300049592 Bacteria 2744
185 Ga0501077_0027453 3300049593 Bacteria 3615
186 Ga0501077_0261004 3300049593 Bacteria 1102
187 Ga0501079_0024836 3300049741 Bacteria 4597
188 Ga0501080_0037028 3300049742 Bacteria 4555
189 Ga0501081_0005529 3300049743 Bacteria 8156
190 Ga0501081_0175916 3300049743 Bacteria 1547
191 Ga0501035_0027042 3300049822 Bacteria 5246
192 Ga0501035_0138871 3300049822 Bacteria 2114
193 Ga0501045_0108833 3300049824 Bacteria 2054
194 nmdc:mga03n38_95442_c1 3300050490 Bacteria 1068
195 nmdc:mga00v17_147630_c1 3300050491 Bacteria 1510
196 nmdc:mga00v17_237053_c1 3300050491 Bacteria 1182
197 nmdc:mga00v17_250401_c1 3300050491 Bacteria 1148
198 nmdc:mga00v17_332241_c1 3300050491 Bacteria 988
199 nmdc:mga00v17_46842_c1 3300050491 Bacteria 2617
200 nmdc:mga00v17_514624_c1 3300050491 Bacteria 775
201 nmdc:mga00v17_79709_c1 3300050491 Bacteria 2042
202 nmdc:mga0yw44_102259_c1 3300050492 Bacteria 1827
203 nmdc:mga0yw44_127340_c1 3300050492 Bacteria 1646
204 nmdc:mga0yw44_155974_c1 3300050492 Bacteria 1492
205 nmdc:mga0yw44_16319_c1 3300050492 Bacteria 4008
206 nmdc:mga0yw44_201002_c1 3300050492 Bacteria 1316
207 nmdc:mga0yw44_259978_c1 3300050492 Bacteria 1157
208 nmdc:mga0yw44_405302_c1 3300050492 Bacteria 922
209 nmdc:mga0yw44_63073_c1 3300050492 Bacteria 2278
210 nmdc:mga0yw44_74350_c1 3300050492 Bacteria 2117
211 nmdc:mga06z11_19965_c1 3300050494 Bacteria 3090
212 nmdc:mga07m45_13839_c1 3300050496 Bacteria 4287
213 nmdc:mga0sz30_127160_c1 3300050516 Bacteria 1122
214 Ga0495655_0030163 3300053083 Bacteria 1310
215 Ga0500641_0017648 3300053096 Bacteria 2673
216 Ga0500556_0000444 3300053104 Bacteria 29431
217 Ga0500593_000216 3300053117 Bacteria 23737
218 Ga0500573_0029384 3300053140 Bacteria 3168
219 Ga0501084_0010064 3300054114 Bacteria 7813
220 Ga0501084_0772106 3300054114 Bacteria 810
221 Ga0501082_0221196 3300060353 Bacteria 1647
222 Ga0530510_0082395 3300061734 Bacteria 2343
223 2643825155 2643221561 Bacteria 4984412
224 2644092212 2643221615 Bacteria 5487866
225 2644322015 2643221657 Bacteria 5490246
226 2644534541 2643221696 Bacteria 5431823
227 2740168807 2739367898 Bacteria 4367674
228 2855390362 2855386786 Bacteria 4752232
229 2857483397 2857481737 Bacteria 4761446
230 Ga0501031_0032872
231 Ga0070683_100004428
232 Ga0070683_100221007
233 Ga0068869_101005261
234 Ga0070682_100056817
235 Ga0070682_100367363
236 Ga0070660_100006504
237 Ga0070661_100175926
238 Ga0070675_100469699
239 Ga0070671_100411754
240 Ga0070659_100047145
241 Ga0070667_100112651
242 Ga0070694_100444734
243 Ga0068867_100431008
244 Ga0070685_10119577
245 Ga0070685_10214868
246 Ga0070698_100001488
247 Ga0070684_100007235
248 Ga0068853_100280132
249 Ga0070686_100168522
250 Ga0068855_100052370
251 Ga0070664_101040898
252 Ga0068857_100066476
253 Ga0068857_100230480
254 Ga0068854_100530682
255 Ga0068852_100502077
256 Ga0068864_100078966
257 Ga0068861_100634948
258 Ga0068870_10494773
259 Ga0068863_100395520
260 Ga0068860_100000504
261 Ga0068860_100058111
262 Ga0081539_10017323
263 Ga0075365_10013039
264 Ga0075365_10056267
265 Ga0075365_10065680
266 Ga0075365_10106213
267 Ga0075365_10115947
268 Ga0075365_10164902
269 Ga0075365_10242712
270 Ga0075365_10292271
271 Ga0075365_10725667
272 Ga0075363_100014681
273 Ga0075364_10030413
274 Ga0075364_10054574
275 Ga0075364_10076782
276 Ga0075364_10234862
277 Ga0075364_10493807
278 Ga0075364_10686516
279 Ga0075367_10002397
280 Ga0075367_10007389
281 Ga0075367_10113887
282 Ga0075369_10135202
283 Ga0075370_10008963
284 Ga0068871_100178221
285 Ga0068865_100120768
286 Ga0105245_10003886
287 Ga0105243_10083113
288 Ga0105243_11233030
289 Ga0105243_11331709
290 Ga0105237_10110808
291 Ga0105238_10143826
292 Ga0105249_10080065
293 Ga0105239_10007524
294 Ga0105246_10002197
295 Ga0105246_10345523
296 Ga0157371_10076351
297 Ga0157369_10068490
298 Ga0163162_10024383
299 Ga0157372_10101550
300 Ga0157372_11339732
301 Ga0157375_10016461
302 Ga0157375_10217613
303 Ga0163163_10063923
304 Ga0163163_10084752
305 Ga0163163_11431785
306 Ga0157380_10073352
307 Ga0157380_10516508
308 Ga0157376_10226318
309 Ga0163161_10044877
310 Ga0207642_10479507
311 Ga0207688_10037717
312 Ga0207688_10298986
313 Ga0207643_10203437
314 Ga0207705_10030564
315 Ga0207662_10305980
316 Ga0207657_10011855
317 Ga0207649_10136916
318 Ga0207687_10028592
319 Ga0207644_10317135
320 Ga0207690_10113503
321 Ga0207704_10261149
322 Ga0207691_10650005
323 Ga0207711_10381159
324 Ga0207661_10055082
325 Ga0207661_10268681
326 Ga0207712_10120085
327 Ga0207668_10450782
328 Ga0207658_10060922
329 Ga0207658_10087593
330 Ga0207658_10484318
331 Ga0207703_10076587
332 Ga0207639_10688175
333 Ga0207678_10149577
334 Ga0207702_10201819
335 Ga0207641_10449639
336 Ga0207676_10379531
337 Ga0207674_10007052
338 Ga0207674_10331903
339 Ga0207675_100016130
340 Ga0207698_10437938
341 Ga0268266_10058226
342 Ga0268264_10000547
343 Ga0316181_1274753
344 Ga0307405_10319947
345 Ga0307413_10809993
346 Ga0307410_10513875
347 Ga0307407_10105637
348 Ga0307407_10219531
349 Ga0307407_10439932
350 Ga0307412_10200462
351 Ga0307409_100671352
352 Ga0307409_100866401
353 Ga0307409_101159477
354 Ga0307416_100171181
355 Ga0307415_100115423
356 Ga0307415_100150328
357 Ga0395901_0131596
358 Ga0439438_008155
359 Ga0439447_032557
360 Ga0439431_0027562
361 Ga0439457_045362
362 Ga0450907_015818
363 Ga0450907_022386
364 Ga0439434_0046803
365 Ga0466965_0068418
366 Ga0466966_0067942
367 Ga0466963_0198954
368 Ga0466964_0057356
369 Ga0466964_0089618
370 Ga0466970_0012507
371 Ga0466960_0002867
372 Ga0466960_0235126
373 Ga0496100_0538658
374 Ga0496101_0075339
375 Ga0496102_0020509
376 Ga0496103_0555575
377 Ga0496107_0032659
378 Ga0496107_0405181
379 Ga0496108_0142995
380 Ga0496110_0045933
381 Ga0496111_0002615
382 Ga0496111_0283204
383 Ga0496124_0305314
384 Ga0501032_0120995
385 Ga0501033_0027872
386 Ga0501033_0170381
387 Ga0501036_0035313
388 Ga0501036_0247012
389 Ga0501037_0114897
390 Ga0501037_0147099
391 Ga0501038_0006244
392 Ga0501039_0009167
393 Ga0501040_0003815
394 Ga0501041_0010550
395 Ga0501041_0438359
396 Ga0501042_0005624
397 Ga0501048_0002929
398 Ga0501067_0327225
399 Ga0501068_0510506
400 Ga0501069_0417052
401 Ga0501070_0054185
402 Ga0501070_0209699
403 Ga0501070_0212386
404 Ga0501070_0299733
405 Ga0501071_0042656
406 Ga0501071_0124306
407 Ga0501072_0007312
408 Ga0501072_0089421
409 Ga0501074_0008801
410 Ga0501075_0097940
411 Ga0501075_0622165
412 Ga0501076_0002751
413 Ga0501076_0073146
414 Ga0501077_0027453
415 Ga0501077_0261004
416 Ga0501079_0024836
417 Ga0501080_0037028
418 Ga0501081_0005529
419 Ga0501081_0175916
420 Ga0501035_0027042
421 Ga0501035_0138871
422 Ga0501045_0108833
423 nmdc:mga03n38_95442_c1
424 nmdc:mga00v17_147630_c1
425 nmdc:mga00v17_237053_c1
426 nmdc:mga00v17_250401_c1
427 nmdc:mga00v17_332241_c1
428 nmdc:mga00v17_46842_c1
429 nmdc:mga00v17_514624_c1
430 nmdc:mga00v17_79709_c1
431 nmdc:mga0yw44_102259_c1
432 nmdc:mga0yw44_127340_c1
433 nmdc:mga0yw44_155974_c1
434 nmdc:mga0yw44_16319_c1
435 nmdc:mga0yw44_201002_c1
436 nmdc:mga0yw44_259978_c1
437 nmdc:mga0yw44_405302_c1
438 nmdc:mga0yw44_63073_c1
439 nmdc:mga0yw44_74350_c1
440 nmdc:mga06z11_19965_c1
441 nmdc:mga07m45_13839_c1
442 nmdc:mga0sz30_127160_c1
443 Ga0495655_0030163
444 Ga0500641_0017648
445 Ga0500556_0000444
446 Ga0500593_000216
447 Ga0500573_0029384
448 Ga0501084_0010064
449 Ga0501084_0772106
450 Ga0501082_0221196
451 Ga0530510_0082395
452 2643825155
453 2644092212
454 2644322015
455 2644534541
456 2740168807
457 2855390362
458 2857483397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18556

TetR_C_35

Bacterial Tetracyclin repressor, C-terminal domain

99

205

0.99

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

31

77

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gfk-assembly1.cif.gz_A structures of no factors 0.7784 2 182
6o6n-assembly1.cif.gz_A structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa 0.7756 2 177
4gfk-assembly1.cif.gz_A structures of no factors 0.7674 2 182
6o6o-assembly1.cif.gz_B structure of the regulator fasr from mycobacterium tuberculosis 0.7495 1 181
3nxc-assembly1.cif.gz_A-2 molecular mechanism by which the escherichia coli nucleoid occlusion factor, slma, keeps cytokinesis in check 0.7486 2 177
ID Description Score Start End Superfamily
5ojxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.968 1 54 1.10.10.60
2y30B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9675 2 52 1.10.10.60
2y31A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9568 1 52 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9518 1 52 1.10.10.60
2ns8A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9477 4 57 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A4Y9NIS4-F1-model_v4 deleted 0.9258 2 182
AF-A0A7K3G373-F1-model_v4 TetR family transcriptional regulator 0.9193 2 179 GO:0000976
GO:0003700
AF-A0A4Y9NIS4-F1-model_v4 deleted 0.9115 2 182
AF-A0A6G7XUQ1-F1-model_v4 TetR/AcrR family transcriptional regulator 0.909 1 183 GO:0000976
GO:0003700
AF-R7XXZ8-F1-model_v4 Regulatory protein, TetR 0.9088 2 181 GO:0000976
GO:0003700

Map