F342327

General Info

Members Datasets Scaffolds Average Seq Length
229 123 458 296

Family's Representative Sequence

Representative Sequence 3300046525|Ga0495663_0046458|Ga0495663_0046458_214_1134
Length 306
Sequence LSLGVPMKSLGTPIALTGSMTAHHFTVDLEEYFQVSALESCVARSTWDSYTPRLLQQMKPLLEMLARHGAKATFFVLGWVAERQRELIHTIAAAGHEIASHGWDHVRVTHQTPAQFRDSIRRTKNLLEAITGQPVLGFRAPSFSIVTGREWALDLLIEEGYRYDSSLFPVRRPGGGYGYPDGSPDPHWLERPAGRLAEIPPTTLRWCGVRLPAAGGAYFRLLPYNLVRAAFRQCERRGVRGTFYIHPWELDAAQPRLNVSWVTRVRHYGGLHRTAPRLQRLLADFRFTAIRDTVDRFDATVAAQPV

Samples

Sample ID Description Type Environment
1 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.31
Rhizosphere 98.69
Stem 0
Stem Tuber 0
Unclassified 19.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495663_0046458 3300046525 Bacteria 1334
2 Ga0070683_100000421 3300005329 Bacteria 29305
3 Ga0070683_100108133 3300005329 Unclassified 2622
4 Ga0070683_100203088 3300005329 Unclassified 1882
5 Ga0070680_100006356 3300005336 Bacteria 8973
6 Ga0070680_100046310 3300005336 Bacteria 3538
7 Ga0070680_100105005 3300005336 Bacteria 2348
8 Ga0070680_100166792 3300005336 Bacteria 1852
9 Ga0070689_100251552 3300005340 Bacteria 1458
10 Ga0070691_10001309 3300005341 Bacteria 10575
11 Ga0070687_100071713 3300005343 Bacteria 1862
12 Ga0070661_100009212 3300005344 Bacteria 6824
13 Ga0070692_10028137 3300005345 Unclassified 2793
14 Ga0070671_100000945 3300005355 Bacteria 21284
15 Ga0070709_10004062 3300005434 Bacteria 7894
16 Ga0070711_100000042 3300005439 Bacteria 84000
17 Ga0070711_100055941 3300005439 Bacteria 2727
18 Ga0070711_100186703 3300005439 Bacteria 1590
19 Ga0070705_100005652 3300005440 Bacteria 6102
20 Ga0070705_100054407 3300005440 Bacteria 2348
21 Ga0070705_100062263 3300005440 Bacteria 2221
22 Ga0070694_100004121 3300005444 Bacteria 8727
23 Ga0070694_100009704 3300005444 Bacteria 5911
24 Ga0070694_100014580 3300005444 Unclassified 4920
25 Ga0070694_100076950 3300005444 Bacteria 2311
26 Ga0070708_100000981 3300005445 Bacteria 21711
27 Ga0070708_100036797 3300005445 Bacteria 4269
28 Ga0070681_10003372 3300005458 Bacteria 14936
29 Ga0070706_100175892 3300005467 Unclassified 1999
30 Ga0070706_100353662 3300005467 Unclassified 1369
31 Ga0070706_100420502 3300005467 Bacteria 1244
32 Ga0070707_100030510 3300005468 Bacteria 5133
33 Ga0070707_100198572 3300005468 Bacteria 1955
34 Ga0070698_100066609 3300005471 Bacteria 3624
35 Ga0070699_100013291 3300005518 Bacteria 7100
36 Ga0070699_100015002 3300005518 Bacteria 6659
37 Ga0070699_100139791 3300005518 Unclassified 2138
38 Ga0070679_100001332 3300005530 Bacteria 21779
39 Ga0070679_100004188 3300005530 Bacteria 13301
40 Ga0070679_100014534 3300005530 Bacteria 7562
41 Ga0070684_100002362 3300005535 Bacteria 13916
42 Ga0070684_100048433 3300005535 Bacteria 3687
43 Ga0070684_100069613 3300005535 Unclassified 3094
44 Ga0070697_100000716 3300005536 Bacteria 24733
45 Ga0070697_100021834 3300005536 Bacteria 5075
46 Ga0070697_100074434 3300005536 Bacteria 2790
47 Ga0070697_100229616 3300005536 Bacteria 1583
48 Ga0070697_100472993 3300005536 Bacteria 1094
49 Ga0070695_100002539 3300005545 Bacteria 10533
50 Ga0070695_100008207 3300005545 Bacteria 6192
51 Ga0070695_100008850 3300005545 Bacteria 5981
52 Ga0070695_100012647 3300005545 Bacteria 5067
53 Ga0070695_100019428 3300005545 Unclassified 4137
54 Ga0070695_100245262 3300005545 Bacteria 1301
55 Ga0070696_100002154 3300005546 Bacteria 12964
56 Ga0070696_100006365 3300005546 Bacteria 7898
57 Ga0070696_100006904 3300005546 Bacteria 7578
58 Ga0070696_100012949 3300005546 Bacteria 5601
59 Ga0070696_100017717 3300005546 Unclassified 4810
60 Ga0070696_100212883 3300005546 Bacteria 1447
61 Ga0070704_100003727 3300005549 Bacteria 8775
62 Ga0070704_100003952 3300005549 Bacteria 8537
63 Ga0070704_100010193 3300005549 Bacteria 5715
64 Ga0070704_100030603 3300005549 Bacteria 3608
65 Ga0070704_100040609 3300005549 Bacteria 3204
66 Ga0068855_100091804 3300005563 Unclassified 3502
67 Ga0068857_100054455 3300005577 Bacteria 3550
68 Ga0068856_100387973 3300005614 Bacteria 1416
69 Ga0070702_100078946 3300005615 Unclassified 1966
70 Ga0081455_10225631 3300005937 Unclassified 1386
71 Ga0070716_100151719 3300006173 Bacteria 1491
72 Ga0075428_100400964 3300006844 Unclassified 1470
73 Ga0075430_100086278 3300006846 Bacteria 2628
74 Ga0075431_100078292 3300006847 Bacteria 3412
75 Ga0075433_10000392 3300006852 Bacteria 27791
76 Ga0075433_10014223 3300006852 Bacteria 6497
77 Ga0075434_100001577 3300006871 Bacteria 19314
78 Ga0075434_100052296 3300006871 Bacteria 4058
79 Ga0075434_100166215 3300006871 Unclassified 2226
80 Ga0075434_100741256 3300006871 Unclassified 999
81 Ga0075429_100025219 3300006880 Bacteria 5161
82 Ga0075436_100233532 3300006914 Bacteria 1307
83 Ga0075436_100293124 3300006914 Unclassified 1165
84 Ga0075435_100004902 3300007076 Archaea 9272
85 Ga0105240_10002758 3300009093 Bacteria 27746
86 Ga0105240_10007429 3300009093 Bacteria 15920
87 Ga0105240_10046767 3300009093 Bacteria 5480
88 Ga0105240_10195051 3300009093 Unclassified 2378
89 Ga0114129_10062942 3300009147 Bacteria 5182
90 Ga0114129_10102230 3300009147 Bacteria 3964
91 Ga0114129_10315508 3300009147 Bacteria 2080
92 Ga0105241_10034553 3300009174 Unclassified 3799
93 Ga0105237_10257854 3300009545 Bacteria 1746
94 Ga0105238_10006970 3300009551 Bacteria 11292
95 Ga0157373_10010026 3300013100 Bacteria 6982
96 Ga0157373_10015248 3300013100 Bacteria 5619
97 Ga0157373_10111055 3300013100 Unclassified 1927
98 Ga0157370_10001256 3300013104 Bacteria 31658
99 Ga0157370_10002408 3300013104 Bacteria 22551
100 Ga0157370_10009588 3300013104 Bacteria 10308
101 Ga0157370_10362678 3300013104 Unclassified 1335
102 Ga0157369_10014475 3300013105 Bacteria 8903
103 Ga0157369_10199848 3300013105 Unclassified 2098
104 Ga0157369_10274936 3300013105 Unclassified 1755
105 Ga0157369_10341720 3300013105 Bacteria 1555
106 Ga0157372_10005569 3300013307 Bacteria 13387
107 Ga0157372_10006908 3300013307 Bacteria 12079
108 Ga0157372_10009131 3300013307 Bacteria 10531
109 Ga0157372_10014414 3300013307 Bacteria 8455
110 Ga0157372_10079063 3300013307 Unclassified 3718
111 Ga0207699_10098146 3300025906 Bacteria 1852
112 Ga0207684_10300495 3300025910 Unclassified 1384
113 Ga0207684_10373884 3300025910 Unclassified 1226
114 Ga0207707_10002149 3300025912 Bacteria 17840
115 Ga0207707_10012336 3300025912 Bacteria 7426
116 Ga0207695_10037427 3300025913 Bacteria 5235
117 Ga0207695_10037469 3300025913 Bacteria 5232
118 Ga0207695_10049223 3300025913 Bacteria 4445
119 Ga0207695_10060423 3300025913 Bacteria 3923
120 Ga0207695_10072301 3300025913 Unclassified 3520
121 Ga0207671_10351889 3300025914 Bacteria 1168
122 Ga0207663_10000029 3300025916 Bacteria 99755
123 Ga0207660_10013959 3300025917 Bacteria 5272
124 Ga0207660_10017462 3300025917 Bacteria 4768
125 Ga0207660_10037915 3300025917 Bacteria 3362
126 Ga0207660_10109225 3300025917 Bacteria 2079
127 Ga0207660_10130696 3300025917 Bacteria 1911
128 Ga0207662_10097751 3300025918 Unclassified 1815
129 Ga0207652_10003477 3300025921 Bacteria 12985
130 Ga0207652_10004222 3300025921 Bacteria 11719
131 Ga0207652_10004980 3300025921 Bacteria 10756
132 Ga0207652_10031934 3300025921 Unclassified 4423
133 Ga0207644_10004355 3300025931 Bacteria 9186
134 Ga0207665_10089960 3300025939 Bacteria 2127
135 Ga0207665_10090282 3300025939 Bacteria 2123
136 Ga0207661_10002422 3300025944 Bacteria 12856
137 Ga0207661_10026802 3300025944 Unclassified 4396
138 Ga0207667_10070002 3300025949 Unclassified 3652
139 Ga0207640_10001629 3300025981 Bacteria 12040
140 Ga0207708_10036260 3300026075 Bacteria 3754
141 Ga0207648_10094815 3300026089 Bacteria 2610
142 Ga0207674_10051379 3300026116 Bacteria 4207
143 Ga0207698_10030528 3300026142 Bacteria 3877
144 Ga0316578_10002525 3300031728 Bacteria 8072
145 Ga0307416_100525971 3300032002 Bacteria 1252
146 Ga0373954_0110574 3300035118 Bacteria 1329
147 Ga0373956_0073716 3300035119 Bacteria 1560
148 Ga0373957_0037886 3300035120 Bacteria 1803
149 Ga0373927_0045403 3300035695 Bacteria 2842
150 Ga0373937_0048803 3300036401 Unclassified 3876
151 Ga0316582_0188130 3300036647 Bacteria 1406
152 Ga0316584_0001656 3300036712 Bacteria 13613
153 Ga0395898_0007089 3300037466 Bacteria 11907
154 Ga0395905_0034690 3300037471 Bacteria 4738
155 Ga0395901_0008333 3300038443 Bacteria 10477
156 Ga0451807_0235624 3300041486 Bacteria 2532
157 Ga0451577_0133093 3300042876 Bacteria 2232
158 Ga0451576_0010136 3300045051 Bacteria 10847
159 Ga0451576_0011345 3300045051 Bacteria 10139
160 Ga0451576_0056798 3300045051 Bacteria 4093
161 Ga0451576_0226064 3300045051 Bacteria 1954
162 Ga0495592_0122361 3300046454 Bacteria 1829
163 Ga0495651_0014101 3300046462 Bacteria 6181
164 Ga0495651_0229334 3300046462 Bacteria 1280
165 Ga0495580_0017084 3300046472 Bacteria 5435
166 Ga0495580_0071458 3300046472 Bacteria 2425
167 Ga0495580_0219409 3300046472 Bacteria 1307
168 Ga0495582_0041495 3300046473 Bacteria 2535
169 Ga0495664_0050089 3300046477 Bacteria 2479
170 Ga0495594_0010176 3300046499 Bacteria 4875
171 Ga0495594_0024507 3300046499 Bacteria 3241
172 Ga0495594_0092034 3300046499 Bacteria 1700
173 Ga0495608_0020756 3300046511 Bacteria 4513
174 Ga0495618_0013021 3300046514 Bacteria 5056
175 Ga0495630_0045459 3300046517 Bacteria 3281
176 Ga0495630_0166877 3300046517 Bacteria 1676
177 Ga0495630_0193025 3300046517 Bacteria 1553
178 Ga0495666_0006886 3300046526 Bacteria 5710
179 Ga0495652_0017861 3300046529 Bacteria 6331
180 Ga0495652_0029350 3300046529 Unclassified 4833
181 Ga0495665_0030589 3300046531 Bacteria 2882
182 Ga0495586_0008696 3300046535 Bacteria 5406
183 Ga0495586_0026523 3300046535 Bacteria 3100
184 Ga0495586_0030273 3300046535 Unclassified 2896
185 Ga0495587_0004556 3300046536 Bacteria 9104
186 Ga0495587_0006235 3300046536 Bacteria 7784
187 Ga0495645_0002531 3300046543 Bacteria 12411
188 Ga0495667_0007189 3300046559 Bacteria 7554
189 Ga0495667_0088334 3300046559 Bacteria 2009
190 Ga0495635_0108218 3300046663 Unclassified 1899
191 Ga0495657_0097426 3300046675 Archaea 1878
192 Ga0495599_0000961 3300046678 Bacteria 16113
193 Ga0495599_0019130 3300046678 Bacteria 4270
194 Ga0495623_0087411 3300046679 Bacteria 1920
195 Ga0495613_0166465 3300046689 Bacteria 1566
196 Ga0495624_0228960 3300046690 Unclassified 1126
197 Ga0495600_0059610 3300046809 Unclassified 2493
198 Ga0495604_0065904 3300047317 Unclassified 2756
199 Ga0495604_0183446 3300047317 Bacteria 1463
200 Ga0495674_0021878 3300047319 Bacteria 5908
201 Ga0495676_0186088 3300047321 Bacteria 1452
202 Ga0495675_0009199 3300047444 Bacteria 6144
203 Ga0495684_0014103 3300047471 Bacteria 6148
204 Ga0495684_0184118 3300047471 Unclassified 1547
205 Ga0495602_0091671 3300048088 Bacteria 2519
206 Ga0496104_0278054 3300048907 Bacteria 1587
207 Ga0496115_0116749 3300048918 Unclassified 2195
208 Ga0501073_0011426 3300049589 Bacteria 6497
209 Ga0501044_0038960 3300049823 Bacteria 4962
210 nmdc:mga05p37_287266_c1 3300050507 Unclassified 1959
211 nmdc:mga09592_31443_c1 3300050508 Bacteria 4423
212 nmdc:mga0qj67_324668_c1 3300050509 Bacteria 1246
213 nmdc:mga06r32_132346_c1 3300050510 Bacteria 2467
214 nmdc:mga06r32_178766_c1 3300050510 Bacteria 2107
215 nmdc:mga06r32_322762_c1 3300050510 Bacteria 1529
216 nmdc:mga06r32_345239_c1 3300050510 Unclassified 1473
217 nmdc:mga0n895_223408_c1 3300050512 Bacteria 1912
218 nmdc:mga0n895_24400_c1 3300050512 Bacteria 5699
219 nmdc:mga0n895_454303_c1 3300050512 Bacteria 1293
220 nmdc:mga0n895_527_c1 3300050512 Bacteria 26121
221 nmdc:mga0rr50_306792_c1 3300050513 Unclassified 1329
222 nmdc:mga08x19_18608_c2 3300050514 Archaea 2509
223 nmdc:mga08x19_7094_c1 3300050514 Bacteria 6651
224 nmdc:mga0a205_106081_c1 3300050515 Bacteria 2708
225 nmdc:mga0a205_10990_c1 3300050515 Archaea 6763
226 nmdc:mga0a205_319158_c1 3300050515 Bacteria 1425
227 nmdc:mga0a205_70_c1 3300050515 Bacteria 55862
228 Ga0495619_0060084 3300053085 Bacteria 2526
229 Ga0495619_0073008 3300053085 Unclassified 2299
230 Ga0495663_0046458
231 Ga0070683_100000421
232 Ga0070683_100108133
233 Ga0070683_100203088
234 Ga0070680_100006356
235 Ga0070680_100046310
236 Ga0070680_100105005
237 Ga0070680_100166792
238 Ga0070689_100251552
239 Ga0070691_10001309
240 Ga0070687_100071713
241 Ga0070661_100009212
242 Ga0070692_10028137
243 Ga0070671_100000945
244 Ga0070709_10004062
245 Ga0070711_100000042
246 Ga0070711_100055941
247 Ga0070711_100186703
248 Ga0070705_100005652
249 Ga0070705_100054407
250 Ga0070705_100062263
251 Ga0070694_100004121
252 Ga0070694_100009704
253 Ga0070694_100014580
254 Ga0070694_100076950
255 Ga0070708_100000981
256 Ga0070708_100036797
257 Ga0070681_10003372
258 Ga0070706_100175892
259 Ga0070706_100353662
260 Ga0070706_100420502
261 Ga0070707_100030510
262 Ga0070707_100198572
263 Ga0070698_100066609
264 Ga0070699_100013291
265 Ga0070699_100015002
266 Ga0070699_100139791
267 Ga0070679_100001332
268 Ga0070679_100004188
269 Ga0070679_100014534
270 Ga0070684_100002362
271 Ga0070684_100048433
272 Ga0070684_100069613
273 Ga0070697_100000716
274 Ga0070697_100021834
275 Ga0070697_100074434
276 Ga0070697_100229616
277 Ga0070697_100472993
278 Ga0070695_100002539
279 Ga0070695_100008207
280 Ga0070695_100008850
281 Ga0070695_100012647
282 Ga0070695_100019428
283 Ga0070695_100245262
284 Ga0070696_100002154
285 Ga0070696_100006365
286 Ga0070696_100006904
287 Ga0070696_100012949
288 Ga0070696_100017717
289 Ga0070696_100212883
290 Ga0070704_100003727
291 Ga0070704_100003952
292 Ga0070704_100010193
293 Ga0070704_100030603
294 Ga0070704_100040609
295 Ga0068855_100091804
296 Ga0068857_100054455
297 Ga0068856_100387973
298 Ga0070702_100078946
299 Ga0081455_10225631
300 Ga0070716_100151719
301 Ga0075428_100400964
302 Ga0075430_100086278
303 Ga0075431_100078292
304 Ga0075433_10000392
305 Ga0075433_10014223
306 Ga0075434_100001577
307 Ga0075434_100052296
308 Ga0075434_100166215
309 Ga0075434_100741256
310 Ga0075429_100025219
311 Ga0075436_100233532
312 Ga0075436_100293124
313 Ga0075435_100004902
314 Ga0105240_10002758
315 Ga0105240_10007429
316 Ga0105240_10046767
317 Ga0105240_10195051
318 Ga0114129_10062942
319 Ga0114129_10102230
320 Ga0114129_10315508
321 Ga0105241_10034553
322 Ga0105237_10257854
323 Ga0105238_10006970
324 Ga0157373_10010026
325 Ga0157373_10015248
326 Ga0157373_10111055
327 Ga0157370_10001256
328 Ga0157370_10002408
329 Ga0157370_10009588
330 Ga0157370_10362678
331 Ga0157369_10014475
332 Ga0157369_10199848
333 Ga0157369_10274936
334 Ga0157369_10341720
335 Ga0157372_10005569
336 Ga0157372_10006908
337 Ga0157372_10009131
338 Ga0157372_10014414
339 Ga0157372_10079063
340 Ga0207699_10098146
341 Ga0207684_10300495
342 Ga0207684_10373884
343 Ga0207707_10002149
344 Ga0207707_10012336
345 Ga0207695_10037427
346 Ga0207695_10037469
347 Ga0207695_10049223
348 Ga0207695_10060423
349 Ga0207695_10072301
350 Ga0207671_10351889
351 Ga0207663_10000029
352 Ga0207660_10013959
353 Ga0207660_10017462
354 Ga0207660_10037915
355 Ga0207660_10109225
356 Ga0207660_10130696
357 Ga0207662_10097751
358 Ga0207652_10003477
359 Ga0207652_10004222
360 Ga0207652_10004980
361 Ga0207652_10031934
362 Ga0207644_10004355
363 Ga0207665_10089960
364 Ga0207665_10090282
365 Ga0207661_10002422
366 Ga0207661_10026802
367 Ga0207667_10070002
368 Ga0207640_10001629
369 Ga0207708_10036260
370 Ga0207648_10094815
371 Ga0207674_10051379
372 Ga0207698_10030528
373 Ga0316578_10002525
374 Ga0307416_100525971
375 Ga0373954_0110574
376 Ga0373956_0073716
377 Ga0373957_0037886
378 Ga0373927_0045403
379 Ga0373937_0048803
380 Ga0316582_0188130
381 Ga0316584_0001656
382 Ga0395898_0007089
383 Ga0395905_0034690
384 Ga0395901_0008333
385 Ga0451807_0235624
386 Ga0451577_0133093
387 Ga0451576_0010136
388 Ga0451576_0011345
389 Ga0451576_0056798
390 Ga0451576_0226064
391 Ga0495592_0122361
392 Ga0495651_0014101
393 Ga0495651_0229334
394 Ga0495580_0017084
395 Ga0495580_0071458
396 Ga0495580_0219409
397 Ga0495582_0041495
398 Ga0495664_0050089
399 Ga0495594_0010176
400 Ga0495594_0024507
401 Ga0495594_0092034
402 Ga0495608_0020756
403 Ga0495618_0013021
404 Ga0495630_0045459
405 Ga0495630_0166877
406 Ga0495630_0193025
407 Ga0495666_0006886
408 Ga0495652_0017861
409 Ga0495652_0029350
410 Ga0495665_0030589
411 Ga0495586_0008696
412 Ga0495586_0026523
413 Ga0495586_0030273
414 Ga0495587_0004556
415 Ga0495587_0006235
416 Ga0495645_0002531
417 Ga0495667_0007189
418 Ga0495667_0088334
419 Ga0495635_0108218
420 Ga0495657_0097426
421 Ga0495599_0000961
422 Ga0495599_0019130
423 Ga0495623_0087411
424 Ga0495613_0166465
425 Ga0495624_0228960
426 Ga0495600_0059610
427 Ga0495604_0065904
428 Ga0495604_0183446
429 Ga0495674_0021878
430 Ga0495676_0186088
431 Ga0495675_0009199
432 Ga0495684_0014103
433 Ga0495684_0184118
434 Ga0495602_0091671
435 Ga0496104_0278054
436 Ga0496115_0116749
437 Ga0501073_0011426
438 Ga0501044_0038960
439 nmdc:mga05p37_287266_c1
440 nmdc:mga09592_31443_c1
441 nmdc:mga0qj67_324668_c1
442 nmdc:mga06r32_132346_c1
443 nmdc:mga06r32_178766_c1
444 nmdc:mga06r32_322762_c1
445 nmdc:mga06r32_345239_c1
446 nmdc:mga0n895_223408_c1
447 nmdc:mga0n895_24400_c1
448 nmdc:mga0n895_454303_c1
449 nmdc:mga0n895_527_c1
450 nmdc:mga0rr50_306792_c1
451 nmdc:mga08x19_18608_c2
452 nmdc:mga08x19_7094_c1
453 nmdc:mga0a205_106081_c1
454 nmdc:mga0a205_10990_c1
455 nmdc:mga0a205_319158_c1
456 nmdc:mga0a205_70_c1
457 Ga0495619_0060084
458 Ga0495619_0073008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11959

DUF3473

Domain of unknown function (DUF3473)

165

295

0.96

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

39

153

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wcj-assembly1.cif.gz_A structure of icab from ammonifex degensii 0.8242 54 165
6hm9-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. 0.7658 16 289
2cc0-assembly1.cif.gz_B family 4 carbohydrate esterase from streptomyces lividans in complex with acetate 0.764 19 278
7bkf-assembly1.cif.gz_A crystal structure of wt ba3943, a ce4 family pseudoenzyme from bacillus anthracis 0.7594 16 289
7bly-assembly1.cif.gz_A structure of the chitin deacetylase angcda from aspergillus niger 0.7565 18 297
ID Description Score Start End Superfamily
4wcjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8242 54 165 3.20.20.370
af_Q06702_109_291_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7681 19 287 3.20.20.370
2cc0B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.764 19 278 3.20.20.370
af_Q06702_109_291_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7568 19 287 3.20.20.370
2j13A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7496 18 290 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A351A2E7-F1-model_v4 Polysaccharide deacetylase family protein 0.9924 18 138 GO:0005975
GO:0016810
AF-A0A2W4N3D5-F1-model_v4 deleted 0.9835 23 103
AF-A0A3M1RPP2-F1-model_v4 DUF3473 domain-containing protein 0.9817 18 290 GO:0005975
GO:0016810
AF-A0A532V1T8-F1-model_v4 Polysaccharide deacetylase 0.9804 19 290 GO:0005975
GO:0016810
AF-A0A2V9D7I5-F1-model_v4 NodB homology domain-containing protein 0.9769 62 289 GO:0005975
GO:0016810

Map