F342147

General Info

Members Datasets Scaffolds Average Seq Length
229 163 458 154

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10230625|Ga0307405_102306252
Length 186
Sequence MRVTSPSSWHAPDLVYGVRRRWTWRAAVCDPAPMPRTDSASRVVNADVPRVFAALLDPAQLREWLPPQGMTGRFERFDPRPGGSYRLVLTYETSTPGSGKATADSDVVEARFLDIVPNARVVQAVEFVSDDPAFAGTMTMTWEVAAQSDGTQVTIRAVDVPEGISAEDHAVGLSSSLAQLAAVVEA

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
121 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
122 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
123 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
155 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
157 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
158 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
159 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
160 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
161 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
162 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
163 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 0.44
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 0
Rhizoplane 2.18
Rhizosphere 88.21
Stem 0
Stem Tuber 0
Unclassified 3.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10230625 3300031731 Bacteria 1365
2 JGI24741J21665_1000775 3300001915 Bacteria 9599
3 JGI24737J22298_10011196 3300001990 Bacteria 2943
4 JGI24742J22300_10001491 3300002244 Bacteria 3700
5 JGI25153J46596_10000005 3300003215 Bacteria 492839
6 JGI25407J50210_10177494 3300003373 Bacteria 525
7 Ga0055542_1000293 3300003762 Bacteria 55815
8 Ga0055529_1000034 3300003763 Bacteria 244657
9 Ga0070658_10026692 3300005327 Bacteria 4635
10 Ga0070676_10021102 3300005328 Bacteria 3644
11 Ga0070683_100261324 3300005329 Bacteria 1647
12 Ga0070677_10116602 3300005333 Bacteria 1200
13 Ga0070682_100468416 3300005337 Bacteria 969
14 Ga0070660_100075904 3300005339 Bacteria 2632
15 Ga0070675_100281498 3300005354 Bacteria 1461
16 Ga0070675_100551232 3300005354 Bacteria 1043
17 Ga0070671_100114001 3300005355 Bacteria 2272
18 Ga0070674_100022122 3300005356 Bacteria 4096
19 Ga0070659_100144291 3300005366 Bacteria 1939
20 Ga0070667_100055889 3300005367 Bacteria 3333
21 Ga0070709_10000658 3300005434 Bacteria 19667
22 Ga0070709_10439857 3300005434 Bacteria 980
23 Ga0070709_10452594 3300005434 Bacteria 967
24 Ga0070714_100023196 3300005435 Bacteria 5094
25 Ga0070714_100471521 3300005435 Bacteria 1194
26 Ga0070714_102497693 3300005435 Bacteria 501
27 Ga0070713_100005899 3300005436 Bacteria 8422
28 Ga0070713_100327289 3300005436 Bacteria 1417
29 Ga0070713_100456870 3300005436 Bacteria 1200
30 Ga0070713_100492096 3300005436 Bacteria 1156
31 Ga0070710_10244647 3300005437 Bacteria 1150
32 Ga0070710_10274609 3300005437 Bacteria 1091
33 Ga0070710_11285748 3300005437 Bacteria 543
34 Ga0070711_100407879 3300005439 Bacteria 1104
35 Ga0070711_100606870 3300005439 Bacteria 913
36 Ga0070705_100495264 3300005440 Bacteria 926
37 Ga0070700_100143611 3300005441 Bacteria 1625
38 Ga0070694_100198306 3300005444 Bacteria 1495
39 Ga0070663_100077760 3300005455 Bacteria 2430
40 Ga0070678_100165972 3300005456 Bacteria 1794
41 Ga0070662_100134473 3300005457 Bacteria 1910
42 Ga0070662_100279874 3300005457 Bacteria 1350
43 Ga0070698_100144926 3300005471 Bacteria 2325
44 Ga0070699_100387347 3300005518 Unclassified 1263
45 Ga0070684_100109344 3300005535 Bacteria 2478
46 Ga0068853_100219888 3300005539 Bacteria 1734
47 Ga0070665_100241305 3300005548 Bacteria 1808
48 Ga0068855_100313731 3300005563 Bacteria 1734
49 Ga0068855_100757636 3300005563 Bacteria 1035
50 Ga0070664_100122025 3300005564 Bacteria 2283
51 Ga0068857_100343815 3300005577 Bacteria 1380
52 Ga0068854_100135107 3300005578 Bacteria 1887
53 Ga0068856_100056323 3300005614 Bacteria 3879
54 Ga0070702_100719363 3300005615 Unclassified 763
55 Ga0068851_10052262 3300005834 Bacteria 2077
56 Ga0081538_10010622 3300005981 Bacteria 7535
57 Ga0081538_10012104 3300005981 Bacteria 6938
58 Ga0081538_10027582 3300005981 Bacteria 3933
59 Ga0070717_10031921 3300006028 Bacteria 4240
60 Ga0070717_10759543 3300006028 Bacteria 881
61 Ga0070715_10007652 3300006163 Bacteria 3729
62 Ga0070715_10075980 3300006163 Bacteria 1512
63 Ga0070715_10230500 3300006163 Bacteria 957
64 Ga0070716_100001668 3300006173 Bacteria 10014
65 Ga0070716_100132333 3300006173 Bacteria 1578
66 Ga0070716_100419406 3300006173 Bacteria 967
67 Ga0070716_100730723 3300006173 Bacteria 759
68 Ga0070712_100003111 3300006175 Bacteria 10236
69 Ga0070712_100513939 3300006175 Bacteria 1005
70 Ga0070712_100960407 3300006175 Bacteria 738
71 Ga0075427_10018871 3300006194 Bacteria 1084
72 Ga0068871_101010680 3300006358 Bacteria 775
73 Ga0075428_100020715 3300006844 Bacteria 7280
74 Ga0075430_100046861 3300006846 Bacteria 3650
75 Ga0075430_100127370 3300006846 Unclassified 2123
76 Ga0075431_100009226 3300006847 Bacteria 9900
77 Ga0075431_100056977 3300006847 Bacteria 4030
78 Ga0075434_100662771 3300006871 Bacteria 1062
79 Ga0075429_100295035 3300006880 Bacteria 1419
80 Ga0111539_10247647 3300009094 Bacteria 2075
81 Ga0111539_10792986 3300009094 Bacteria 1102
82 Ga0114129_10446709 3300009147 Unclassified 1696
83 Ga0105248_10959266 3300009177 Unclassified 966
84 Ga0105246_10771676 3300011119 Unclassified 850
85 Ga0157314_1033547 3300012500 Bacteria 589
86 Ga0157380_10317457 3300014326 Bacteria 1443
87 Ga0163161_10166110 3300017792 Bacteria 1685
88 Ga0206353_11579583 3300020082 Bacteria 1157
89 Ga0209646_1002469 3300025246 Bacteria 4076
90 Ga0209148_1000093 3300025254 Bacteria 245339
91 Ga0209233_1021410 3300025261 Bacteria 1674
92 Ga0209455_1000045 3300025272 Bacteria 383329
93 Ga0209758_1000001 3300025297 Bacteria 1981790
94 Ga0209758_1088819 3300025297 Bacteria 911
95 Ga0207656_10000833 3300025321 Bacteria 10068
96 Ga0207653_10012769 3300025885 Bacteria 2626
97 Ga0207682_10065404 3300025893 Bacteria 1531
98 Ga0207692_10026657 3300025898 Bacteria 2713
99 Ga0207692_10031863 3300025898 Bacteria 2528
100 Ga0207692_10133816 3300025898 Bacteria 1403
101 Ga0207642_10054481 3300025899 Bacteria 1825
102 Ga0207688_10676274 3300025901 Unclassified 652
103 Ga0207647_10018510 3300025904 Bacteria 4707
104 Ga0207685_10000728 3300025905 Bacteria 5982
105 Ga0207685_10036932 3300025905 Bacteria 1795
106 Ga0207685_10172378 3300025905 Bacteria 997
107 Ga0207699_10000355 3300025906 Bacteria 24243
108 Ga0207699_10039354 3300025906 Bacteria 2716
109 Ga0207699_10048481 3300025906 Bacteria 2495
110 Ga0207699_10425399 3300025906 Bacteria 949
111 Ga0207645_10185439 3300025907 Bacteria 1366
112 Ga0207645_10305917 3300025907 Bacteria 1059
113 Ga0207705_10025529 3300025909 Bacteria 4216
114 Ga0207705_11212740 3300025909 Bacteria 578
115 Ga0207684_10094456 3300025910 Bacteria 2550
116 Ga0207654_10003313 3300025911 Bacteria 8148
117 Ga0207695_10057203 3300025913 Bacteria 4053
118 Ga0207671_10008821 3300025914 Bacteria 8493
119 Ga0207693_10012502 3300025915 Bacteria 6856
120 Ga0207693_10487074 3300025915 Bacteria 963
121 Ga0207693_10529976 3300025915 Bacteria 919
122 Ga0207663_10002575 3300025916 Bacteria 8718
123 Ga0207663_10043086 3300025916 Bacteria 2761
124 Ga0207663_10052300 3300025916 Bacteria 2547
125 Ga0207663_10056314 3300025916 Bacteria 2471
126 Ga0207657_10100264 3300025919 Bacteria 2404
127 Ga0207649_10057778 3300025920 Bacteria 2427
128 Ga0207659_10094834 3300025926 Bacteria 2237
129 Ga0207700_10000427 3300025928 Bacteria 24804
130 Ga0207700_10056058 3300025928 Bacteria 2965
131 Ga0207700_10077730 3300025928 Bacteria 2579
132 Ga0207700_10332433 3300025928 Bacteria 1319
133 Ga0207664_10004298 3300025929 Bacteria 9643
134 Ga0207664_10067351 3300025929 Bacteria 2873
135 Ga0207664_10335889 3300025929 Bacteria 1335
136 Ga0207644_10194100 3300025931 Bacteria 1598
137 Ga0207690_10009709 3300025932 Bacteria 5714
138 Ga0207706_10105826 3300025933 Bacteria 2475
139 Ga0207706_10178512 3300025933 Bacteria 1865
140 Ga0207709_10000018 3300025935 Bacteria 431545
141 Ga0207709_10112425 3300025935 Bacteria 1824
142 Ga0207669_10003048 3300025937 Bacteria 7218
143 Ga0207665_10003945 3300025939 Bacteria 9930
144 Ga0207665_10029725 3300025939 Bacteria 3611
145 Ga0207665_10468682 3300025939 Bacteria 969
146 Ga0207665_10515721 3300025939 Bacteria 925
147 Ga0207661_10062956 3300025944 Bacteria 3003
148 Ga0207667_10000069 3300025949 Bacteria 180683
149 Ga0207668_10118514 3300025972 Bacteria 2000
150 Ga0207640_10001029 3300025981 Bacteria 15417
151 Ga0207658_10048831 3300025986 Bacteria 3106
152 Ga0207639_10009327 3300026041 Bacteria 6766
153 Ga0207678_10002303 3300026067 Bacteria 17294
154 Ga0207708_10129346 3300026075 Bacteria 1973
155 Ga0207702_10014385 3300026078 Bacteria 6569
156 Ga0207702_10308412 3300026078 Bacteria 1504
157 Ga0207674_10057130 3300026116 Bacteria 3957
158 Ga0268266_10254866 3300028379 Bacteria 1624
159 Ga0307408_100053803 3300031548 Bacteria 2909
160 Ga0307408_100192603 3300031548 Bacteria 1644
161 Ga0307405_10722384 3300031731 Bacteria 827
162 Ga0307413_10424545 3300031824 Bacteria 1048
163 Ga0307410_10024438 3300031852 Bacteria 3775
164 Ga0307410_10065636 3300031852 Bacteria 2497
165 Ga0307410_10192356 3300031852 Bacteria 1552
166 Ga0307410_10373452 3300031852 Bacteria 1145
167 Ga0307406_10055944 3300031901 Bacteria 2524
168 Ga0307407_10219226 3300031903 Bacteria 1285
169 Ga0307407_10394758 3300031903 Bacteria 991
170 Ga0307409_100002596 3300031995 Bacteria 9500
171 Ga0307409_101424803 3300031995 Bacteria 719
172 Ga0307416_100496267 3300032002 Bacteria 1284
173 Ga0307416_102885568 3300032002 Bacteria 575
174 Ga0307415_100001289 3300032126 Bacteria 11823
175 Ga0307415_101717375 3300032126 Bacteria 606
176 Ga0307510_10100106 3300033180 Bacteria 2694
177 Ga0373943_0493033 3300035170 Bacteria 715
178 Ga0373946_0382740 3300035171 Bacteria 708
179 Ga0373947_0099075 3300035725 Bacteria 1829
180 Ga0373925_0004178 3300037068 Bacteria 10963
181 Ga0451797_0522718 3300041453 Bacteria 1042
182 Ga0451802_2125947 3300041460 Bacteria 739
183 Ga0451833_0108920 3300041491 Bacteria 746
184 Ga0450907_002752 3300042146 Bacteria 3263
185 Ga0466969_0023722 3300044656 Bacteria 3160
186 Ga0466964_0317102 3300044706 Bacteria 791
187 Ga0466957_0692791 3300044842 Bacteria 719
188 Ga0466967_0028840 3300045976 Bacteria 4639
189 Ga0495617_048208 3300046452 Bacteria 1418
190 Ga0495629_0502892 3300046459 Bacteria 817
191 Ga0495639_0202923 3300046475 Bacteria 971
192 Ga0495585_0068676 3300046492 Bacteria 1935
193 Ga0495583_0004851 3300046506 Bacteria 9398
194 Ga0495583_0009822 3300046506 Bacteria 5671
195 Ga0495606_0000372 3300046507 Bacteria 76478
196 Ga0495630_0085652 3300046517 Bacteria 2379
197 Ga0495631_0037269 3300046518 Bacteria 2167
198 Ga0495637_0060510 3300046520 Bacteria 1555
199 Ga0495633_0071263 3300046558 Bacteria 1621
200 Ga0495611_0088221 3300046648 Bacteria 1432
201 Ga0495625_0009651 3300046660 Bacteria 8045
202 Ga0495625_0151584 3300046660 Bacteria 1558
203 Ga0495588_0047734 3300046674 Bacteria 2199
204 Ga0495600_0000952 3300046809 Bacteria 15558
205 Ga0496109_0425230 3300048912 Bacteria 1255
206 Ga0496110_0303328 3300048913 Bacteria 1455
207 Ga0496114_0435892 3300048917 Bacteria 1161
208 Ga0501034_0111461 3300049571 Bacteria 2727
209 Ga0501069_0348254 3300049585 Bacteria 873
210 Ga0501073_0390854 3300049589 Bacteria 961
211 Ga0501271_018335 3300049768 Bacteria 798
212 nmdc:mga00v17_19903_c1 3300050491 Bacteria 3838
213 nmdc:mga05p37_1809475_c1 3300050507 Bacteria 589
214 nmdc:mga05p37_226412_c1 3300050507 Unclassified 2254
215 nmdc:mga0qj67_458312_c1 3300050509 Bacteria 1026
216 nmdc:mga06r32_238388_c1 3300050510 Bacteria 1807
217 nmdc:mga08y16_108377_c1 3300050511 Bacteria 2891
218 nmdc:mga08y16_47631_c1 3300050511 Bacteria 4487
219 Ga0500646_0168921 3300053090 Unclassified 735
220 Ga0500583_0008566 3300053092 Bacteria 3678
221 Ga0500595_006740 3300053119 Bacteria 4841
222 Ga0500652_007355 3300053131 Bacteria 3601
223 Ga0500600_0123251 3300053149 Bacteria 1332
224 Ga0500600_0258300 3300053149 Bacteria 775
225 Ga0500619_030993 3300053154 Bacteria 1629
226 Ga0500596_002616 3300053735 Bacteria 3533
227 2837184082 2837183177 Bacteria 4637169
228 2932434695 2932431166 Bacteria 4215299
229 8047718769 8047710418 Bacteria 11023148
230 Ga0307405_10230625
231 JGI24741J21665_1000775
232 JGI24737J22298_10011196
233 JGI24742J22300_10001491
234 JGI25153J46596_10000005
235 JGI25407J50210_10177494
236 Ga0055542_1000293
237 Ga0055529_1000034
238 Ga0070658_10026692
239 Ga0070676_10021102
240 Ga0070683_100261324
241 Ga0070677_10116602
242 Ga0070682_100468416
243 Ga0070660_100075904
244 Ga0070675_100281498
245 Ga0070675_100551232
246 Ga0070671_100114001
247 Ga0070674_100022122
248 Ga0070659_100144291
249 Ga0070667_100055889
250 Ga0070709_10000658
251 Ga0070709_10439857
252 Ga0070709_10452594
253 Ga0070714_100023196
254 Ga0070714_100471521
255 Ga0070714_102497693
256 Ga0070713_100005899
257 Ga0070713_100327289
258 Ga0070713_100456870
259 Ga0070713_100492096
260 Ga0070710_10244647
261 Ga0070710_10274609
262 Ga0070710_11285748
263 Ga0070711_100407879
264 Ga0070711_100606870
265 Ga0070705_100495264
266 Ga0070700_100143611
267 Ga0070694_100198306
268 Ga0070663_100077760
269 Ga0070678_100165972
270 Ga0070662_100134473
271 Ga0070662_100279874
272 Ga0070698_100144926
273 Ga0070699_100387347
274 Ga0070684_100109344
275 Ga0068853_100219888
276 Ga0070665_100241305
277 Ga0068855_100313731
278 Ga0068855_100757636
279 Ga0070664_100122025
280 Ga0068857_100343815
281 Ga0068854_100135107
282 Ga0068856_100056323
283 Ga0070702_100719363
284 Ga0068851_10052262
285 Ga0081538_10010622
286 Ga0081538_10012104
287 Ga0081538_10027582
288 Ga0070717_10031921
289 Ga0070717_10759543
290 Ga0070715_10007652
291 Ga0070715_10075980
292 Ga0070715_10230500
293 Ga0070716_100001668
294 Ga0070716_100132333
295 Ga0070716_100419406
296 Ga0070716_100730723
297 Ga0070712_100003111
298 Ga0070712_100513939
299 Ga0070712_100960407
300 Ga0075427_10018871
301 Ga0068871_101010680
302 Ga0075428_100020715
303 Ga0075430_100046861
304 Ga0075430_100127370
305 Ga0075431_100009226
306 Ga0075431_100056977
307 Ga0075434_100662771
308 Ga0075429_100295035
309 Ga0111539_10247647
310 Ga0111539_10792986
311 Ga0114129_10446709
312 Ga0105248_10959266
313 Ga0105246_10771676
314 Ga0157314_1033547
315 Ga0157380_10317457
316 Ga0163161_10166110
317 Ga0206353_11579583
318 Ga0209646_1002469
319 Ga0209148_1000093
320 Ga0209233_1021410
321 Ga0209455_1000045
322 Ga0209758_1000001
323 Ga0209758_1088819
324 Ga0207656_10000833
325 Ga0207653_10012769
326 Ga0207682_10065404
327 Ga0207692_10026657
328 Ga0207692_10031863
329 Ga0207692_10133816
330 Ga0207642_10054481
331 Ga0207688_10676274
332 Ga0207647_10018510
333 Ga0207685_10000728
334 Ga0207685_10036932
335 Ga0207685_10172378
336 Ga0207699_10000355
337 Ga0207699_10039354
338 Ga0207699_10048481
339 Ga0207699_10425399
340 Ga0207645_10185439
341 Ga0207645_10305917
342 Ga0207705_10025529
343 Ga0207705_11212740
344 Ga0207684_10094456
345 Ga0207654_10003313
346 Ga0207695_10057203
347 Ga0207671_10008821
348 Ga0207693_10012502
349 Ga0207693_10487074
350 Ga0207693_10529976
351 Ga0207663_10002575
352 Ga0207663_10043086
353 Ga0207663_10052300
354 Ga0207663_10056314
355 Ga0207657_10100264
356 Ga0207649_10057778
357 Ga0207659_10094834
358 Ga0207700_10000427
359 Ga0207700_10056058
360 Ga0207700_10077730
361 Ga0207700_10332433
362 Ga0207664_10004298
363 Ga0207664_10067351
364 Ga0207664_10335889
365 Ga0207644_10194100
366 Ga0207690_10009709
367 Ga0207706_10105826
368 Ga0207706_10178512
369 Ga0207709_10000018
370 Ga0207709_10112425
371 Ga0207669_10003048
372 Ga0207665_10003945
373 Ga0207665_10029725
374 Ga0207665_10468682
375 Ga0207665_10515721
376 Ga0207661_10062956
377 Ga0207667_10000069
378 Ga0207668_10118514
379 Ga0207640_10001029
380 Ga0207658_10048831
381 Ga0207639_10009327
382 Ga0207678_10002303
383 Ga0207708_10129346
384 Ga0207702_10014385
385 Ga0207702_10308412
386 Ga0207674_10057130
387 Ga0268266_10254866
388 Ga0307408_100053803
389 Ga0307408_100192603
390 Ga0307405_10722384
391 Ga0307413_10424545
392 Ga0307410_10024438
393 Ga0307410_10065636
394 Ga0307410_10192356
395 Ga0307410_10373452
396 Ga0307406_10055944
397 Ga0307407_10219226
398 Ga0307407_10394758
399 Ga0307409_100002596
400 Ga0307409_101424803
401 Ga0307416_100496267
402 Ga0307416_102885568
403 Ga0307415_100001289
404 Ga0307415_101717375
405 Ga0307510_10100106
406 Ga0373943_0493033
407 Ga0373946_0382740
408 Ga0373947_0099075
409 Ga0373925_0004178
410 Ga0451797_0522718
411 Ga0451802_2125947
412 Ga0451833_0108920
413 Ga0450907_002752
414 Ga0466969_0023722
415 Ga0466964_0317102
416 Ga0466957_0692791
417 Ga0466967_0028840
418 Ga0495617_048208
419 Ga0495629_0502892
420 Ga0495639_0202923
421 Ga0495585_0068676
422 Ga0495583_0004851
423 Ga0495583_0009822
424 Ga0495606_0000372
425 Ga0495630_0085652
426 Ga0495631_0037269
427 Ga0495637_0060510
428 Ga0495633_0071263
429 Ga0495611_0088221
430 Ga0495625_0009651
431 Ga0495625_0151584
432 Ga0495588_0047734
433 Ga0495600_0000952
434 Ga0496109_0425230
435 Ga0496110_0303328
436 Ga0496114_0435892
437 Ga0501034_0111461
438 Ga0501069_0348254
439 Ga0501073_0390854
440 Ga0501271_018335
441 nmdc:mga00v17_19903_c1
442 nmdc:mga05p37_1809475_c1
443 nmdc:mga05p37_226412_c1
444 nmdc:mga0qj67_458312_c1
445 nmdc:mga06r32_238388_c1
446 nmdc:mga08y16_108377_c1
447 nmdc:mga08y16_47631_c1
448 Ga0500646_0168921
449 Ga0500583_0008566
450 Ga0500595_006740
451 Ga0500652_007355
452 Ga0500600_0123251
453 Ga0500600_0258300
454 Ga0500619_030993
455 Ga0500596_002616
456 2837184082
457 2932434695
458 8047718769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

45

185

0.86

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

37

185

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9467 4 153
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9362 5 153
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9289 5 153
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9209 4 153
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9042 5 153
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9455 4 153 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9188 4 153 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8324 4 152 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8196 3 152 3.30.530.20
3q64A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8056 4 152 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4Z0WD85-F1-model_v4 ATPase 0.967 4 152
AF-A0A4R0YJS6-F1-model_v4 ATPase 0.9668 4 153
AF-A0A7G8UEQ9-F1-model_v4 SRPBCC domain-containing protein 0.9645 3 152
AF-A0A5Q5BP41-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9627 3 152 GO:0030638
AF-A0A1T2A816-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9619 3 153

Map