F342068

General Info

Members Datasets Scaffolds Average Seq Length
229 188 459 453

Family's Representative Sequence

Representative Sequence 3300025225|Ga0209566_100137|Ga0209566_10013716
Length 491
Sequence MSGLPGRTPARLSAYDVAVIEERQRVMDVEIALTSLHWVYLAFILFIMAMLVMRRDTMLVCVLGVLALGLIATDSLGSSVSGIFNSFIYAIKELIGTILIISIIVSMSRILIRTGINEAMVAPLTRFIRTPAMAYWGIGIIMMITSWFFWPSPGVALIGAVLLPVAVRVGLPALGAAMAMNLFGHGIALSGDYIIQGAPKLTADAAGLPVSQVMEASIPLVAVMGLVTTVAAYWLMKRDMKRGTFRDGLVAEETAGNPTSAEAIPMAPALKRLLAVIIPLLFLADVGAMIVFDLQGGDATALIGGTAVLILIAVTLLAHGNRGLEATTDYLIEGLQFGFRVFGPVIPIAAFFYLGDSAFTDLIGKLPEGSHGIVNDLGVALANRVPLNGAVSSVTLTVVGAITGLDGSGFSGISLAGSIARMFGASVGGTDTLTALGQVAAIWVGGGTIIPWALIPAAAICGVSPFELARRNLVPVLIGLAVTTVVAMFLI

Samples

Sample ID Description Type Environment
1 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
21 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
22 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
25 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
32 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
37 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
38 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
39 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
40 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
41 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
42 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
43 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
44 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
45 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
46 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
47 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
48 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
49 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
50 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
51 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
52 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
53 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
54 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
55 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
56 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
57 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
58 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
59 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
60 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
61 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
62 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
63 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
64 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
65 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
66 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
67 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
68 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
69 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
70 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
71 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
72 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
73 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
74 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
75 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
76 2643221729 Bacillus sp. Root11 Isolate Unclassified
77 2643221730 Bacillus sp. Root131 Isolate Unclassified
78 2643221731 Bacillus sp. Root147 Isolate Unclassified
79 2643221732 Bacillus sp. Root239 Isolate Unclassified
80 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
81 2671180694 Paenibacillus sp. A3 Isolate Unclassified
82 2684622632 Bacillus cereus 905 Isolate Unclassified
83 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
84 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
85 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
86 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
87 2738541295 Bacillus sp. OK085 Isolate Unclassified
88 2738541358 Bacillus sp. OV752 Isolate Unclassified
89 2738543006 Bacillus sp. OK077 Isolate Unclassified
90 2738543017 Bacillus sp. OV186 Isolate Unclassified
91 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
92 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
93 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
94 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
95 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
96 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
97 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
98 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
99 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
100 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
101 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
102 2818991459 Paenibacillus sp. 597 Isolate Unclassified
103 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
104 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
105 2842682962 Bacillus sp. R-72492 Isolate Unclassified
106 2842882022 Bacillus sp. R-71893 Isolate Unclassified
107 2849139964 Bacillus sp. R-71875 Isolate Unclassified
108 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
109 2857472729 Cohnella sp. R-74144 Isolate Unclassified
110 2857581216 Bacillus sp. R-71922 Isolate Unclassified
111 2857586860 Bacillus sp. R-71935 Isolate Unclassified
112 2860837431 Bacillus sp. WR11 Isolate Unclassified
113 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
114 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
115 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
116 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
117 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
118 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
119 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
120 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
121 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
122 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
123 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
124 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
125 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
126 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
127 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
128 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
129 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
130 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
131 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
132 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
133 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
134 2919720352 Priestia megaterium 4340 Isolate Unclassified
135 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
136 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
137 2929004312 Priestia megaterium 1104 Isolate Unclassified
138 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
139 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
140 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
141 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
142 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
143 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
144 2938917290 Bacillus sp. CR71 Isolate Unclassified
145 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
146 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
147 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
148 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
149 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
150 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
151 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
152 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
153 2965761152 Bacillus sp. COPE52 Isolate Unclassified
154 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
155 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
156 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
157 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
158 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
159 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
160 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
161 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
162 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
163 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
164 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
165 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
166 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
167 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
168 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
169 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
170 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
171 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
172 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
173 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
174 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
175 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
176 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
177 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
178 8022653035 Bacillus sp. Rc4 Isolate Unclassified
179 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
180 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
181 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
182 8023438354 Bacillus sp. BH2 Isolate Unclassified
183 8023444577 Bacillus sp. BH32 Isolate Unclassified
184 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
185 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
186 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
187 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
188 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 45.85
Metatranscriptomes 0
Isolates 54.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.28
Nodule 1.31
Rhizoplane 7.86
Rhizosphere 36.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209566_100137 3300025225 Bacteria 89967
2 JGI25151J46595_10000375 3300003187 Bacteria 46716
3 JGI25151J46595_10005101 3300003187 Bacteria 6823
4 JGI25151J46595_10007988 3300003187 Bacteria 5130
5 JGI25151J46595_10012586 3300003187 Bacteria 3843
6 JGI25151J46595_10021953 3300003187 Bacteria 2660
7 JGI25151J46595_10030178 3300003187 Bacteria 2135
8 rootH1_10004972 3300003316 Bacteria 34087
9 rootH1_10004972 3300003323 Bacteria 2958
10 rootH2_10181791 3300003320 Bacteria 8602
11 rootL2_10028608 3300003322 Bacteria 31444
12 Ga0055538_1001184 3300003751 Bacteria 5493
13 Ga0055532_1000086 3300003758 Bacteria 109784
14 Ga0055536_1007636 3300003781 Bacteria 4796
15 Ga0055541_1002194 3300003841 Bacteria 3967
16 Ga0055541_1002354 3300003841 Bacteria 3802
17 Ga0055541_1004047 3300003841 Bacteria 2698
18 Ga0070682_100091181 3300005337 Bacteria 1994
19 Ga0070671_100012529 3300005355 Bacteria 6829
20 Ga0079104_1008271 3300006946 Bacteria 3664
21 Ga0105251_10005948 3300009011 Bacteria 7876
22 Ga0105244_10034540 3300009036 Bacteria 2660
23 Ga0105244_10036597 3300009036 Bacteria 2570
24 Ga0105250_10031538 3300009092 Bacteria 2127
25 Ga0105245_10012431 3300009098 Bacteria 7408
26 Ga0105247_10012442 3300009101 Bacteria 5110
27 Ga0105242_10122770 3300009176 Bacteria 2232
28 Ga0105246_10014432 3300011119 Bacteria 4969
29 Ga0157378_10055711 3300013297 Bacteria 3522
30 Ga0157376_10304331 3300014969 Bacteria 1510
31 Ga0209784_100102 3300025224 Bacteria 99732
32 Ga0209784_100106 3300025224 Bacteria 98148
33 Ga0209566_100033 3300025225 Bacteria 332650
34 Ga0209566_100080 3300025225 Bacteria 156454
35 Ga0209566_100239 3300025225 Bacteria 52741
36 Ga0209566_104481 3300025225 Bacteria 1900
37 Ga0209147_100169 3300025229 Bacteria 87841
38 Ga0209147_102803 3300025229 Bacteria 3893
39 Ga0209437_100726 3300025233 Bacteria 16731
40 Ga0209258_101766 3300025242 Bacteria 6643
41 Ga0209130_1001533 3300025284 Bacteria 14785
42 Ga0209676_1000347 3300025292 Bacteria 87634
43 Ga0209025_1000236 3300025294 Bacteria 129742
44 Ga0209025_1000621 3300025294 Bacteria 62957
45 Ga0209025_1001223 3300025294 Bacteria 35868
46 Ga0209025_1001474 3300025294 Bacteria 30636
47 Ga0209025_1003607 3300025294 Bacteria 14414
48 Ga0209025_1003813 3300025294 Bacteria 13770
49 Ga0209025_1008330 3300025294 Bacteria 7474
50 Ga0209025_1010060 3300025294 Bacteria 6472
51 Ga0209025_1010644 3300025294 Bacteria 6201
52 Ga0209025_1013376 3300025294 Bacteria 5164
53 Ga0207696_1005258 3300025711 Bacteria 5400
54 Ga0207696_1011500 3300025711 Bacteria 3182
55 Ga0207713_1003043 3300025735 Bacteria 11684
56 Ga0209281_1000608 3300027111 Bacteria 40379
57 Ga0209281_1007032 3300027111 Bacteria 2853
58 Ga0237817_10494 3300030083 Bacteria 5350
59 Ga0307408_100006108 3300031548 Bacteria 8007
60 Ga0307408_100058572 3300031548 Bacteria 2801
61 Ga0307412_10045250 3300031911 Bacteria 2876
62 Ga0307416_100079185 3300032002 Bacteria 2768
63 Ga0237819_00722 3300038705 Bacteria 10679
64 Ga0237819_01083 3300038705 Bacteria 8039
65 Ga0439439_0000382 3300041406 Bacteria 7294
66 Ga0439449_0010245 3300042007 Bacteria 3541
67 Ga0439462_0006793 3300042015 Bacteria 2855
68 Ga0495661_0048678 3300046665 Bacteria 2575
69 Ga0495676_0102724 3300047321 Bacteria 2112
70 Ga0495681_0033998 3300047470 Bacteria 2545
71 Ga0496100_0010754 3300048903 Bacteria 5189
72 Ga0496101_0007838 3300048904 Bacteria 6945
73 Ga0496102_0002365 3300048905 Bacteria 16091
74 Ga0496103_0071971 3300048906 Bacteria 2164
75 Ga0496104_0003258 3300048907 Bacteria 13999
76 Ga0496105_0004431 3300048908 Bacteria 10574
77 Ga0496107_0000379 3300048910 Bacteria 24154
78 Ga0496108_0001851 3300048911 Bacteria 16912
79 Ga0496109_0005624 3300048912 Bacteria 10484
80 Ga0496110_0002308 3300048913 Bacteria 14255
81 Ga0496110_0069563 3300048913 Bacteria 3117
82 Ga0496111_0004588 3300048914 Bacteria 8746
83 Ga0496111_0005197 3300048914 Bacteria 8301
84 Ga0496112_0010667 3300048915 Bacteria 8348
85 Ga0496112_0179152 3300048915 Bacteria 2083
86 Ga0496113_0043228 3300048916 Bacteria 3333
87 Ga0496116_0002965 3300048919 Bacteria 17270
88 Ga0496116_0011123 3300048919 Bacteria 7481
89 Ga0496116_0017887 3300048919 Bacteria 5484
90 Ga0496116_0050440 3300048919 Bacteria 2772
91 Ga0496116_0076724 3300048919 Bacteria 2092
92 Ga0496119_0018104 3300048922 Bacteria 5261
93 Ga0496122_0005451 3300048925 Bacteria 15140
94 Ga0496122_0018971 3300048925 Bacteria 6311
95 Ga0496122_0029153 3300048925 Bacteria 4662
96 Ga0496122_0090472 3300048925 Bacteria 2088
97 Ga0496123_0022602 3300048926 Bacteria 4840
98 Ga0496124_0001602 3300048927 Bacteria 32542
99 Ga0496124_0149228 3300048927 Bacteria 1836
100 Ga0496125_0000612 3300048928 Bacteria 60537
101 Ga0496125_0001843 3300048928 Bacteria 29237
102 Ga0496125_0004431 3300048928 Bacteria 16201
103 Ga0496125_0009041 3300048928 Bacteria 10315
104 Ga0496126_0022480 3300048929 Bacteria 6136
105 Ga0501217_001170 3300049661 Bacteria 4819
106 Ga0501245_004765 3300049708 Bacteria 1867
107 2512730299 2512564039 Bacteria 8739048
108 2540606145 2540341094 Bacteria 4061186
109 2550904374 2548877040 Bacteria 7507281
110 2553391014 2551306519 Bacteria 5465154
111 2578339242 2576861424 Bacteria 5270569
112 2587741555 2585428059 Bacteria 8696589
113 2595089651 2593339131 Bacteria 5116855
114 2595316205 2593339198 Bacteria 7267884
115 2601640224 2600255286 Bacteria 5390125
116 2643739847 2643221543 Bacteria 6628015
117 2644424283 2643221676 Bacteria 8119172
118 2644705225 2643221729 Bacteria 6621700
119 2644709918 2643221730 Bacteria 6523787
120 2644721056 2643221731 Bacteria 5623886
121 2644722540 2643221732 Bacteria 5756404
122 2672334218 2671180330 Bacteria 5521719
123 2673822019 2671180694 Bacteria 7506943
124 2685151846 2684622632 Bacteria 5380049
125 2698321318 2695420987 Bacteria 6152737
126 2705995790 2703719227 Bacteria 5631989
127 2721507011 2718218445 Bacteria 5113413
128 2728533544 2728368933 Bacteria 7044283
129 2738812538 2738541295 Bacteria 5730091
130 2739154952 2738541358 Bacteria 5932299
131 2739207676 2738543006 Bacteria 5904091
132 2739271341 2738543017 Bacteria 4271950
133 2745166287 2744054657 Bacteria 5016802
134 2757567777 2757320391 Bacteria 4746095
135 2777762880 2775507177 Bacteria 4384303
136 2777836728 2775507192 Bacteria 4622234
137 2791212610 2788500588 Bacteria 4584915
138 2793182222 2791355222 Bacteria 5898266
139 2808868153 2808606364 Bacteria 4465927
140 2809054347 2808606399 Bacteria 4021018
141 2817618361 2816332336 Bacteria 5207640
142 2819581068 2818991443 Bacteria 6598732
143 2819629297 2818991451 Bacteria 4697364
144 2819671562 2818991459 Bacteria 8736032
145 2819711644 2818991465 Bacteria 5388835
146 2821113704 2821111986 Bacteria 6894338
147 2842685910 2842682962 Bacteria 5589973
148 2842887208 2842882022 Bacteria 6158489
149 2849142031 2849139964 Bacteria 5613304
150 2857458910 2857453340 Bacteria 8090534
151 2857473567 2857472729 Bacteria 6568124
152 2857585944 2857581216 Bacteria 5522813
153 2857589962 2857586860 Bacteria 4354574
154 2860838520 2860837431 Bacteria 4202080
155 2864734023 2864733723 Bacteria 6770668
156 2864999660 2864997549 Bacteria 5139696
157 2865003749 2865002811 Bacteria 6333767
158 2881638743 2881636855 Bacteria 5205297
159 2885527077 2885526491 Bacteria 7164189
160 2888581226 2888578766 Bacteria 6743310
161 2889044672 2889042446 Bacteria 7618936
162 2889050095 2889049205 Bacteria 7524325
163 2889299990 2889295896 Bacteria 4704906
164 2904115194 2904113452 Bacteria 7796941
165 2904165602 2904162308 Bacteria 7086713
166 2904491558 2904490793 Bacteria 7046938
167 2904529639 2904524088 Bacteria 5887454
168 2904606873 2904606771 Bacteria 4684500
169 2904761034 2904755435 Bacteria 7986759
170 2907207015 2907202186 Bacteria 6632024
171 2919148849 2919143609 Bacteria 6219228
172 2919160816 2919160200 Bacteria 6929020
173 2919418102 2919414237 Bacteria 5429133
174 2919428125 2919425241 Bacteria 8055701
175 2919522315 2919517244 Bacteria 5858162
176 2919725512 2919720352 Bacteria 5986006
177 2925327187 2925326138 Bacteria 9652120
178 2928099195 2928093941 Bacteria 5965005
179 2929009195 2929004312 Bacteria 5678476
180 2929210197 2929206907 Bacteria 5918291
181 2929237536 2929233124 Bacteria 5948380
182 2931388108 2931384279 Bacteria 7299545
183 2936341047 2936340661 Bacteria 5139038
184 2936366577 2936361878 Bacteria 5632809
185 2938655646 2938649242 Bacteria 7118381
186 2938921732 2938917290 Bacteria 5914775
187 2939681525 2939679117 Bacteria 6921672
188 2945993286 2945991243 Bacteria 7008369
189 2946056039 2946053406 Bacteria 6978655
190 2947430623 2947426588 Bacteria 5357194
191 2956901384 2956897341 Bacteria 5447711
192 2960324710 2960319331 Bacteria 5502575
193 2960378143 2960375949 Bacteria 5361395
194 2962291881 2962290636 Bacteria 4072939
195 2965765195 2965761152 Bacteria 5806513
196 2968558764 2968558590 Bacteria 6956864
197 2969137927 2969136845 Bacteria 3923176
198 2969768288 2969765954 Bacteria 4216713
199 2969771711 2969770375 Bacteria 4271280
200 2971409513 2971403814 Bacteria 7370929
201 2971413409 2971410472 Bacteria 8311090
202 2971514156 2971511577 Bacteria 5404012
203 2977258787 2977254563 Bacteria 4828420
204 2980180369 2980176882 Bacteria 5397533
205 2980493702 2980492589 Bacteria 4072961
206 2981286920 2981284811 Bacteria 4641497
207 2981291871 2981289755 Bacteria 4641509
208 2981982558 2981980479 Bacteria 4641628
209 2981987656 2981985349 Bacteria 4641497
210 2988226167 2988225383 Bacteria 7221625
211 2990279814 2990275345 Bacteria 4887158
212 2996638794 2996632988 Bacteria 6921523
213 3001893876 3001892409 Bacteria 6328293
214 3006830741 3006826541 Bacteria 4678913
215 3006880170 3006879489 Bacteria 4064221
216 3006974255 3006973921 Bacteria 4423788
217 3006978740 3006978542 Bacteria 5328100
218 8002323917 8002317523 Bacteria 8051857
219 8022623751 8022621104 Bacteria 5241040
220 8022655092 8022653035 Bacteria 4035078
221 8022894678 8022893055 Bacteria 5300455
222 8022915160 8022914991 Bacteria 5584517
223 8022951313 8022948649 Bacteria 5366783
224 8023440626 8023438354 Bacteria 5779374
225 8023444730 8023444577 Bacteria 5661597
226 8054471733 8054465665 Bacteria 7323556
227 8055533327 8055531788 Bacteria 5249694
228 8055634487 8055632911 Bacteria 5283357
229 8056534551 8056533031 Bacteria 8964429
230 8057736340 8057733483 Bacteria 6578323
231 Ga0209566_100137
232 JGI25151J46595_10000375
233 JGI25151J46595_10005101
234 JGI25151J46595_10007988
235 JGI25151J46595_10012586
236 JGI25151J46595_10021953
237 JGI25151J46595_10030178
238 rootH1_10004972
239 rootH2_10181791
240 rootL2_10028608
241 Ga0055538_1001184
242 Ga0055532_1000086
243 Ga0055536_1007636
244 Ga0055541_1002194
245 Ga0055541_1002354
246 Ga0055541_1004047
247 Ga0070682_100091181
248 Ga0070671_100012529
249 Ga0079104_1008271
250 Ga0105251_10005948
251 Ga0105244_10034540
252 Ga0105244_10036597
253 Ga0105250_10031538
254 Ga0105245_10012431
255 Ga0105247_10012442
256 Ga0105242_10122770
257 Ga0105246_10014432
258 Ga0157378_10055711
259 Ga0157376_10304331
260 Ga0209784_100102
261 Ga0209784_100106
262 Ga0209566_100033
263 Ga0209566_100080
264 Ga0209566_100239
265 Ga0209566_104481
266 Ga0209147_100169
267 Ga0209147_102803
268 Ga0209437_100726
269 Ga0209258_101766
270 Ga0209130_1001533
271 Ga0209676_1000347
272 Ga0209025_1000236
273 Ga0209025_1000621
274 Ga0209025_1001223
275 Ga0209025_1001474
276 Ga0209025_1003607
277 Ga0209025_1003813
278 Ga0209025_1008330
279 Ga0209025_1010060
280 Ga0209025_1010644
281 Ga0209025_1013376
282 Ga0207696_1005258
283 Ga0207696_1011500
284 Ga0207713_1003043
285 Ga0209281_1000608
286 Ga0209281_1007032
287 Ga0237817_10494
288 Ga0307408_100006108
289 Ga0307408_100058572
290 Ga0307412_10045250
291 Ga0307416_100079185
292 Ga0237819_00722
293 Ga0237819_01083
294 Ga0439439_0000382
295 Ga0439449_0010245
296 Ga0439462_0006793
297 Ga0495661_0048678
298 Ga0495676_0102724
299 Ga0495681_0033998
300 Ga0496100_0010754
301 Ga0496101_0007838
302 Ga0496102_0002365
303 Ga0496103_0071971
304 Ga0496104_0003258
305 Ga0496105_0004431
306 Ga0496107_0000379
307 Ga0496108_0001851
308 Ga0496109_0005624
309 Ga0496110_0002308
310 Ga0496110_0069563
311 Ga0496111_0004588
312 Ga0496111_0005197
313 Ga0496112_0010667
314 Ga0496112_0179152
315 Ga0496113_0043228
316 Ga0496116_0002965
317 Ga0496116_0011123
318 Ga0496116_0017887
319 Ga0496116_0050440
320 Ga0496116_0076724
321 Ga0496119_0018104
322 Ga0496122_0005451
323 Ga0496122_0018971
324 Ga0496122_0029153
325 Ga0496122_0090472
326 Ga0496123_0022602
327 Ga0496124_0001602
328 Ga0496124_0149228
329 Ga0496125_0000612
330 Ga0496125_0001843
331 Ga0496125_0004431
332 Ga0496125_0009041
333 Ga0496126_0022480
334 Ga0501217_001170
335 Ga0501245_004765
336 2512730299
337 2540606145
338 2550904374
339 2553391014
340 2578339242
341 2587741555
342 2595089651
343 2595316205
344 2601640224
345 2643739847
346 2644424283
347 2644705225
348 2644709918
349 2644721056
350 2644722540
351 2672334218
352 2673822019
353 2685151846
354 2698321318
355 2705995790
356 2721507011
357 2728533544
358 2738812538
359 2739154952
360 2739207676
361 2739271341
362 2745166287
363 2757567777
364 2777762880
365 2777836728
366 2791212610
367 2793182222
368 2808868153
369 2809054347
370 2817618361
371 2819581068
372 2819629297
373 2819671562
374 2819711644
375 2821113704
376 2842685910
377 2842887208
378 2849142031
379 2857458910
380 2857473567
381 2857585944
382 2857589962
383 2860838520
384 2864734023
385 2864999660
386 2865003749
387 2881638743
388 2885527077
389 2888581226
390 2889044672
391 2889050095
392 2889299990
393 2904115194
394 2904165602
395 2904491558
396 2904529639
397 2904606873
398 2904761034
399 2907207015
400 2919148849
401 2919160816
402 2919418102
403 2919428125
404 2919522315
405 2919725512
406 2925327187
407 2928099195
408 2929009195
409 2929210197
410 2929237536
411 2931388108
412 2936341047
413 2936366577
414 2938655646
415 2938921732
416 2939681525
417 2945993286
418 2946056039
419 2947430623
420 2956901384
421 2960324710
422 2960378143
423 2962291881
424 2965765195
425 2968558764
426 2969137927
427 2969768288
428 2969771711
429 2971409513
430 2971413409
431 2971514156
432 2977258787
433 2980180369
434 2980493702
435 2981286920
436 2981291871
437 2981982558
438 2981987656
439 2988226167
440 2990279814
441 2996638794
442 3001893876
443 3006830741
444 3006880170
445 3006974255
446 3006978740
447 8002323917
448 8022623751
449 8022655092
450 8022894678
451 8022915160
452 8022951313
453 8023440626
454 8023444730
455 8054471733
456 8055533327
457 8055634487
458 8056534551
459 8057736340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.5441 22 431
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.5245 13 431
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.5205 22 431
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.5028 13 431
4r0c-assembly1.cif.gz_B crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology 0.4568 55 431
ID Description Score Start End Superfamily
af_F4I9E1_318_552_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2894 96 314 1.20.1250.20
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2622 275 431 1.20.1250.20
af_A0A0R0FY39_10_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2495 55 306 1.20.1250.20
af_Q04301_289_484_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2488 58 291 1.20.1250.20
af_F4I9E1_318_552_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2372 96 314 1.20.1250.20
ID Description Score Start End GO Terms
AF-R9C6K3-F1-model_v4 deleted 0.913 1 393
AF-R7ZA70-F1-model_v4 Transporter 0.8976 1 327 GO:0016020
AF-A0A6M8GSW7-F1-model_v4 deleted 0.8968 1 433
AF-A0A6M8GSW7-F1-model_v4 deleted 0.8948 1 433
AF-A0A5C8MSR5-F1-model_v4 Uncharacterized protein 0.8939 1 284 GO:0016020

Map