F342035

General Info

Members Datasets Scaffolds Average Seq Length
229 156 228 148

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_12118347|Ga0157378_121183471
Length 174
Sequence VAVEECGCNGFNGVMPAAGGFYPRKETDMSLQPLVVTRNDYPRPLHVVGEQITVLASGAGTGSYEIFMQEGAEGSGPPPHSHPWDEAFYVTRGEVAFGLGPDQLTAVAGTLVHIPAGTIHWFRFGQGGGAMFSVTTKLGASRMFEEIDREISPTAPDMGKLVQIATQHGLTLAM

Samples

Sample ID Description Type Environment
1 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
124 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
125 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
128 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.44
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 2.18
Rhizosphere 97.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100275356 3300005329 Bacteria 1601
2 Ga0070690_101208692 3300005330 Unclassified 603
3 Ga0070670_101036221 3300005331 Unclassified 747
4 Ga0070666_10154051 3300005335 Bacteria 1604
5 Ga0070666_10213547 3300005335 Bacteria 1359
6 Ga0070666_11195911 3300005335 Bacteria 566
7 Ga0070680_100391449 3300005336 Bacteria 1184
8 Ga0070680_101150083 3300005336 Unclassified 671
9 Ga0068868_101059065 3300005338 Unclassified 744
10 Ga0070675_100109096 3300005354 Bacteria 2339
11 Ga0070675_101039633 3300005354 Unclassified 752
12 Ga0070671_100003968 3300005355 Bacteria 11650
13 Ga0070671_100330622 3300005355 Bacteria 1299
14 Ga0070673_100936403 3300005364 Unclassified 804
15 Ga0070659_100928866 3300005366 Bacteria 761
16 Ga0070667_100217649 3300005367 Bacteria 1699
17 Ga0070667_100721015 3300005367 Unclassified 923
18 Ga0070667_100858326 3300005367 Unclassified 844
19 Ga0070667_101276410 3300005367 Bacteria 688
20 Ga0070678_100818763 3300005456 Unclassified 846
21 Ga0068867_100965773 3300005459 Unclassified 770
22 Ga0070685_10059769 3300005466 Bacteria 2226
23 Ga0070685_11531884 3300005466 Bacteria 514
24 Ga0070706_100343284 3300005467 Bacteria 1392
25 Ga0070706_100631010 3300005467 Bacteria 995
26 Ga0070707_100187563 3300005468 Bacteria 2016
27 Ga0070679_100143209 3300005530 Bacteria 2369
28 Ga0070679_100741156 3300005530 Bacteria 925
29 Ga0068853_100261361 3300005539 Bacteria 1591
30 Ga0068853_100274468 3300005539 Bacteria 1553
31 Ga0070672_100122522 3300005543 Unclassified 2130
32 Ga0070672_100962508 3300005543 Unclassified 755
33 Ga0070696_100359777 3300005546 Unclassified 1129
34 Ga0070665_100879778 3300005548 Bacteria 909
35 Ga0070704_100175637 3300005549 Unclassified 1708
36 Ga0068855_100083942 3300005563 Bacteria 3689
37 Ga0070664_100997667 3300005564 Bacteria 787
38 Ga0068857_101226307 3300005577 Bacteria 727
39 Ga0068856_100579450 3300005614 Bacteria 1143
40 Ga0068859_101208384 3300005617 Unclassified 833
41 Ga0068864_100604459 3300005618 Bacteria 1064
42 Ga0068866_11048154 3300005718 Unclassified 582
43 Ga0068861_100171980 3300005719 Bacteria 1796
44 Ga0068861_100623802 3300005719 Unclassified 992
45 Ga0068863_100146923 3300005841 Bacteria 2255
46 Ga0068863_101218229 3300005841 Bacteria 759
47 Ga0068863_101809799 3300005841 Bacteria 620
48 Ga0068858_100462964 3300005842 Unclassified 1223
49 Ga0068860_100315975 3300005843 Unclassified 1532
50 Ga0068860_100385049 3300005843 Unclassified 1385
51 Ga0068862_100133830 3300005844 Unclassified 2195
52 Ga0068862_100656144 3300005844 Unclassified 1012
53 Ga0070712_100664440 3300006175 Bacteria 886
54 Ga0097621_100417669 3300006237 Bacteria 1203
55 Ga0097621_101151195 3300006237 Unclassified 729
56 Ga0068871_100599783 3300006358 Bacteria 1001
57 Ga0075428_100377516 3300006844 Bacteria 1520
58 Ga0075430_100274881 3300006846 Bacteria 1394
59 Ga0075430_100360178 3300006846 Unclassified 1201
60 Ga0075431_100785656 3300006847 Bacteria 926
61 Ga0075429_100332737 3300006880 Bacteria 1329
62 Ga0075429_100377353 3300006880 Bacteria 1241
63 Ga0097620_101208453 3300006931 Unclassified 833
64 Ga0105240_10006128 3300009093 Bacteria 17734
65 Ga0105240_10025366 3300009093 Bacteria 7792
66 Ga0105240_11048908 3300009093 Bacteria 870
67 Ga0111539_10007847 3300009094 Bacteria 13632
68 Ga0111539_10021855 3300009094 Bacteria 7866
69 Ga0111539_10541740 3300009094 Unclassified 1356
70 Ga0111539_12494884 3300009094 Bacteria 600
71 Ga0105243_11510094 3300009148 Unclassified 696
72 Ga0105241_10471692 3300009174 Bacteria 1114
73 Ga0105242_11998719 3300009176 Unclassified 622
74 Ga0105248_11568925 3300009177 Unclassified 746
75 Ga0105238_10026944 3300009551 Bacteria 5858
76 Ga0105238_12216320 3300009551 Unclassified 584
77 Ga0105249_10006602 3300009553 Bacteria 10094
78 Ga0105249_11124461 3300009553 Unclassified 856
79 Ga0105249_11865611 3300009553 Unclassified 674
80 Ga0105239_10041759 3300010375 Bacteria 5026
81 Ga0157369_10460606 3300013105 Bacteria 1316
82 Ga0157378_12118347 3300013297 Bacteria 613
83 Ga0157378_12650604 3300013297 Unclassified 554
84 Ga0163162_11714376 3300013306 Unclassified 718
85 Ga0163162_12130069 3300013306 Bacteria 643
86 Ga0157375_10019909 3300013308 Bacteria 6118
87 Ga0157375_10804697 3300013308 Unclassified 1088
88 Ga0157375_11055516 3300013308 Unclassified 950
89 Ga0163163_10802171 3300014325 Bacteria 1005
90 Ga0157380_10457861 3300014326 Bacteria 1227
91 Ga0157380_11973131 3300014326 Unclassified 645
92 Ga0157379_10007024 3300014968 Bacteria 9731
93 Ga0157379_11115434 3300014968 Unclassified 756
94 Ga0163161_10000079 3300017792 Bacteria 97522
95 Ga0207680_10002657 3300025903 Bacteria 8356
96 Ga0207645_10780062 3300025907 Unclassified 650
97 Ga0207684_10395728 3300025910 Bacteria 1188
98 Ga0207654_10223428 3300025911 Bacteria 1250
99 Ga0207695_10004836 3300025913 Bacteria 18184
100 Ga0207695_10069630 3300025913 Bacteria 3599
101 Ga0207652_10645522 3300025921 Unclassified 947
102 Ga0207652_11004007 3300025921 Bacteria 733
103 Ga0207646_10176636 3300025922 Bacteria 1929
104 Ga0207681_10114676 3300025923 Bacteria 1966
105 Ga0207681_11422106 3300025923 Bacteria 582
106 Ga0207694_10085297 3300025924 Bacteria 2485
107 Ga0207659_11100855 3300025926 Unclassified 683
108 Ga0207644_10021745 3300025931 Bacteria 4374
109 Ga0207644_10071016 3300025931 Bacteria 2546
110 Ga0207644_10771927 3300025931 Unclassified 803
111 Ga0207644_10961341 3300025931 Unclassified 716
112 Ga0207690_10624698 3300025932 Bacteria 881
113 Ga0207706_10075623 3300025933 Unclassified 2962
114 Ga0207706_10785623 3300025933 Bacteria 809
115 Ga0207706_11287283 3300025933 Unclassified 604
116 Ga0207691_10127071 3300025940 Unclassified 2255
117 Ga0207691_11020257 3300025940 Unclassified 690
118 Ga0207711_11080022 3300025941 Unclassified 743
119 Ga0207661_10143401 3300025944 Bacteria 2058
120 Ga0207679_10504028 3300025945 Bacteria 1080
121 Ga0207667_10008257 3300025949 Bacteria 12393
122 Ga0207651_10958291 3300025960 Unclassified 763
123 Ga0207712_10021314 3300025961 Bacteria 4254
124 Ga0207668_10333371 3300025972 Unclassified 1263
125 Ga0207658_10243084 3300025986 Bacteria 1526
126 Ga0207658_11391876 3300025986 Unclassified 642
127 Ga0207677_11092857 3300026023 Unclassified 727
128 Ga0207703_10242710 3300026035 Unclassified 1620
129 Ga0207703_10396726 3300026035 Bacteria 1279
130 Ga0207703_11342296 3300026035 Unclassified 688
131 Ga0207639_10211503 3300026041 Bacteria 1670
132 Ga0207641_10005738 3300026088 Bacteria 10545
133 Ga0207641_10190244 3300026088 Bacteria 1886
134 Ga0207641_11486066 3300026088 Bacteria 679
135 Ga0207648_10228507 3300026089 Unclassified 1655
136 Ga0207676_10838602 3300026095 Unclassified 898
137 Ga0207675_100056881 3300026118 Bacteria 3648
138 Ga0207675_100601256 3300026118 Bacteria 1103
139 Ga0207675_102732070 3300026118 Bacteria 502
140 Ga0207683_10809657 3300026121 Unclassified 869
141 Ga0207683_11364146 3300026121 Bacteria 656
142 Ga0207683_11893759 3300026121 Unclassified 545
143 Ga0207698_10800892 3300026142 Unclassified 944
144 Ga0207428_10010401 3300027907 Bacteria 8312
145 Ga0207428_10015529 3300027907 Bacteria 6584
146 Ga0207428_10346243 3300027907 Bacteria 1094
147 Ga0268266_10800763 3300028379 Bacteria 910
148 Ga0268264_11297354 3300028381 Unclassified 738
149 Ga0265334_10135517 3300028573 Bacteria 874
150 Ga0316579_10035156 3300031691 Bacteria 2308
151 Ga0316578_10149521 3300031728 Bacteria 1407
152 Ga0307405_10876461 3300031731 Unclassified 758
153 Ga0307405_11420422 3300031731 Unclassified 607
154 Ga0307410_10007909 3300031852 Bacteria 5858
155 Ga0307406_10208757 3300031901 Bacteria 1443
156 Ga0307406_10758265 3300031901 Unclassified 815
157 Ga0307412_10022657 3300031911 Bacteria 3855
158 Ga0307412_10250052 3300031911 Bacteria 1376
159 Ga0307409_100326411 3300031995 Bacteria 1438
160 Ga0307416_100034840 3300032002 Bacteria 3837
161 Ga0307415_100039302 3300032126 Bacteria 3126
162 Ga0316583_10068943 3300032133 Bacteria 1237
163 Ga0373934_0063345 3300035086 Bacteria 1475
164 Ga0373923_0073858 3300035111 Bacteria 1469
165 Ga0373936_0072765 3300035113 Bacteria 1420
166 Ga0373946_0037378 3300035171 Bacteria 1973
167 Ga0373935_0056378 3300035692 Bacteria 2505
168 Ga0373927_0186307 3300035695 Bacteria 1361
169 Ga0373933_0201098 3300035724 Bacteria 1275
170 Ga0373947_0032554 3300035725 Bacteria 3073
171 Ga0373937_0206256 3300036401 Bacteria 1848
172 Ga0316582_0040327 3300036647 Bacteria 2913
173 Ga0373925_0021829 3300037068 Bacteria 4667
174 Ga0373925_0151352 3300037068 Bacteria 1822
175 Ga0395899_0032403 3300037312 Bacteria 3925
176 Ga0395900_0026436 3300037418 Bacteria 5942
177 Ga0395898_0339508 3300037466 Bacteria 1432
178 Ga0395905_0027098 3300037471 Bacteria 5404
179 Ga0395905_0212228 3300037471 Bacteria 1813
180 Ga0395905_0258318 3300037471 Bacteria 1626
181 Ga0395905_0685540 3300037471 Bacteria 927
182 Ga0316581_0011059 3300037588 Bacteria 2516
183 Ga0395901_0021158 3300038443 Bacteria 6663
184 Ga0451797_0366004 3300041453 Bacteria 566
185 Ga0451802_1857936 3300041460 Bacteria 681
186 Ga0439433_0024533 3300041999 Bacteria 1359
187 Ga0439449_0000321 3300042007 Bacteria 17412
188 Ga0439462_0001735 3300042015 Bacteria 4927
189 Ga0450916_098106 3300042530 Bacteria 517
190 Ga0466969_0006597 3300044656 Bacteria 6171
191 Ga0466969_0521117 3300044656 Bacteria 543
192 Ga0466966_0034332 3300044684 Bacteria 3280
193 Ga0466966_0355095 3300044684 Bacteria 881
194 Ga0466961_0009434 3300044693 Bacteria 6212
195 Ga0466959_0206772 3300045049 Unclassified 1365
196 Ga0495580_0000931 3300046472 Bacteria 25570
197 Ga0495580_0041262 3300046472 Bacteria 3291
198 Ga0495606_0300574 3300046507 Bacteria 870
199 Ga0495642_0011550 3300046528 Bacteria 3395
200 Ga0495642_0266034 3300046528 Unclassified 750
201 Ga0495642_0368627 3300046528 Bacteria 632
202 Ga0495621_0364979 3300046539 Bacteria 608
203 Ga0495597_0422785 3300046542 Bacteria 505
204 Ga0495656_0022370 3300046615 Bacteria 2475
205 Ga0495656_0202114 3300046615 Unclassified 986
206 Ga0495668_0004549 3300046616 Bacteria 9779
207 Ga0495625_0614690 3300046660 Bacteria 651
208 Ga0495588_0073837 3300046674 Bacteria 1776
209 Ga0495588_0216575 3300046674 Bacteria 1011
210 Ga0495658_0304603 3300046683 Unclassified 1008
211 Ga0495669_0302272 3300046684 Bacteria 771
212 Ga0495669_0343676 3300046684 Unclassified 721
213 Ga0495677_0235967 3300047445 Bacteria 714
214 Ga0495685_113229 3300047447 Bacteria 892
215 Ga0496106_0634694 3300048909 Unclassified 854
216 Ga0496108_0810944 3300048911 Unclassified 807
217 Ga0496114_1047719 3300048917 Unclassified 700
218 Ga0501257_080584 3300049686 Bacteria 839
219 nmdc:mga09592_245849_c1 3300050508 Bacteria 1550
220 nmdc:mga09592_717564_c1 3300050508 Bacteria 850
221 nmdc:mga0qj67_543545_c1 3300050509 Bacteria 932
222 nmdc:mga08y16_124671_c1 3300050511 Unclassified 2680
223 nmdc:mga08y16_20850_c1 3300050511 Bacteria 6919
224 nmdc:mga08y16_22927_c1 3300050511 Bacteria 6590
225 nmdc:mga0a205_169797_c1 3300050515 Bacteria 2077
226 Ga0500594_0267651 3300053118 Bacteria 570
227 Ga0501084_1116558 3300054114 Bacteria 662
228 Ga0587115_085190 3300059626 Bacteria 566

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_100417669 Ga0097621_1004176692 138
2 iso_pu_bacteria 2883291878 2883296220 140
3 3300005335 Ga0070666_10154051 Ga0070666_101540513 142
4 3300005366 Ga0070659_100928866 Ga0070659_1009288662 142
5 3300005367 Ga0070667_101276410 Ga0070667_1012764101 142
6 3300005530 Ga0070679_100741156 Ga0070679_1007411562 142
7 3300005614 Ga0068856_100579450 Ga0068856_1005794502 142
8 3300009093 Ga0105240_10006128 Ga0105240_100061286 142
9 3300009093 Ga0105240_11048908 Ga0105240_110489081 142
10 3300025913 Ga0207695_10004836 Ga0207695_1000483611 142
11 3300025921 Ga0207652_10645522 Ga0207652_106455222 142
12 3300025932 Ga0207690_10624698 Ga0207690_106246981 142
13 3300059626 Ga0587115_085190 Ga0587115_085190_57_494 142
14 3300005329 Ga0070683_100275356 Ga0070683_1002753563 143
15 3300005330 Ga0070690_101208692 Ga0070690_1012086921 143
16 3300005331 Ga0070670_101036221 Ga0070670_1010362211 143
17 3300005335 Ga0070666_10213547 Ga0070666_102135472 143
18 3300005335 Ga0070666_11195911 Ga0070666_111959111 143
19 3300005336 Ga0070680_100391449 Ga0070680_1003914492 143
20 3300005336 Ga0070680_101150083 Ga0070680_1011500831 143
21 3300005338 Ga0068868_101059065 Ga0068868_1010590651 143
22 3300005354 Ga0070675_100109096 Ga0070675_1001090963 143
23 3300005354 Ga0070675_101039633 Ga0070675_1010396331 143
24 3300005355 Ga0070671_100003968 Ga0070671_1000039687 143
25 3300005355 Ga0070671_100330622 Ga0070671_1003306222 143
26 3300005364 Ga0070673_100936403 Ga0070673_1009364031 143
27 3300005367 Ga0070667_100217649 Ga0070667_1002176492 143
28 3300005367 Ga0070667_100721015 Ga0070667_1007210151 143
29 3300005367 Ga0070667_100858326 Ga0070667_1008583261 143
30 3300005456 Ga0070678_100818763 Ga0070678_1008187631 143
31 3300005459 Ga0068867_100965773 Ga0068867_1009657731 143
32 3300005466 Ga0070685_10059769 Ga0070685_100597693 143
33 3300005466 Ga0070685_11531884 Ga0070685_115318841 143
34 3300005467 Ga0070706_100343284 Ga0070706_1003432841 143
35 3300005467 Ga0070706_100631010 Ga0070706_1006310102 143
36 3300005468 Ga0070707_100187563 Ga0070707_1001875631 143
37 3300005530 Ga0070679_100143209 Ga0070679_1001432093 143
38 3300005539 Ga0068853_100261361 Ga0068853_1002613613 143
39 3300005539 Ga0068853_100274468 Ga0068853_1002744683 143
40 3300005543 Ga0070672_100122522 Ga0070672_1001225221 143
41 3300005543 Ga0070672_100962508 Ga0070672_1009625081 143
42 3300005546 Ga0070696_100359777 Ga0070696_1003597771 143
43 3300005548 Ga0070665_100879778 Ga0070665_1008797782 143
44 3300005549 Ga0070704_100175637 Ga0070704_1001756371 143
45 3300005563 Ga0068855_100083942 Ga0068855_1000839422 143
46 3300005564 Ga0070664_100997667 Ga0070664_1009976672 143
47 3300005577 Ga0068857_101226307 Ga0068857_1012263072 143
48 3300005617 Ga0068859_101208384 Ga0068859_1012083841 143
49 3300005618 Ga0068864_100604459 Ga0068864_1006044591 143
50 3300005718 Ga0068866_11048154 Ga0068866_110481541 143
51 3300005719 Ga0068861_100171980 Ga0068861_1001719803 143
52 3300005719 Ga0068861_100623802 Ga0068861_1006238021 143
53 3300005841 Ga0068863_100146923 Ga0068863_1001469231 143
54 3300005841 Ga0068863_101218229 Ga0068863_1012182292 143
55 3300005841 Ga0068863_101809799 Ga0068863_1018097992 143
56 3300005842 Ga0068858_100462964 Ga0068858_1004629641 143
57 3300005843 Ga0068860_100315975 Ga0068860_1003159751 143
58 3300005843 Ga0068860_100385049 Ga0068860_1003850491 143
59 3300005844 Ga0068862_100133830 Ga0068862_1001338302 143
60 3300005844 Ga0068862_100656144 Ga0068862_1006561441 143
61 3300006175 Ga0070712_100664440 Ga0070712_1006644402 143
62 3300006237 Ga0097621_101151195 Ga0097621_1011511951 143
63 3300006358 Ga0068871_100599783 Ga0068871_1005997832 143
64 3300006844 Ga0075428_100377516 Ga0075428_1003775162 143
65 3300006846 Ga0075430_100274881 Ga0075430_1002748811 143
66 3300006846 Ga0075430_100360178 Ga0075430_1003601782 143
67 3300006847 Ga0075431_100785656 Ga0075431_1007856562 143
68 3300006880 Ga0075429_100332737 Ga0075429_1003327372 143
69 3300006880 Ga0075429_100377353 Ga0075429_1003773532 143
70 3300006931 Ga0097620_101208453 Ga0097620_1012084532 143
71 3300009093 Ga0105240_10025366 Ga0105240_100253665 143
72 3300009094 Ga0111539_10007847 Ga0111539_100078475 143
73 3300009094 Ga0111539_10021855 Ga0111539_100218552 143
74 3300009094 Ga0111539_10541740 Ga0111539_105417403 143
75 3300009094 Ga0111539_12494884 Ga0111539_124948841 143
76 3300009148 Ga0105243_11510094 Ga0105243_115100941 143
77 3300009174 Ga0105241_10471692 Ga0105241_104716922 143
78 3300009176 Ga0105242_11998719 Ga0105242_119987191 143
79 3300009177 Ga0105248_11568925 Ga0105248_115689251 143
80 3300009551 Ga0105238_10026944 Ga0105238_100269444 143
81 3300009551 Ga0105238_12216320 Ga0105238_122163201 143
82 3300009553 Ga0105249_10006602 Ga0105249_100066027 143
83 3300009553 Ga0105249_11124461 Ga0105249_111244611 143
84 3300009553 Ga0105249_11865611 Ga0105249_118656111 143
85 3300010375 Ga0105239_10041759 Ga0105239_100417595 143
86 3300013105 Ga0157369_10460606 Ga0157369_104606062 143
87 3300013297 Ga0157378_12118347 Ga0157378_121183471 143
88 3300013297 Ga0157378_12650604 Ga0157378_126506041 143
89 3300013306 Ga0163162_11714376 Ga0163162_117143761 143
90 3300013306 Ga0163162_12130069 Ga0163162_121300691 143
91 3300013308 Ga0157375_10019909 Ga0157375_100199094 143
92 3300013308 Ga0157375_10804697 Ga0157375_108046971 143
93 3300013308 Ga0157375_11055516 Ga0157375_110555162 143
94 3300014325 Ga0163163_10802171 Ga0163163_108021712 143
95 3300014326 Ga0157380_10457861 Ga0157380_104578612 143
96 3300014326 Ga0157380_11973131 Ga0157380_119731312 143
97 3300014968 Ga0157379_10007024 Ga0157379_100070243 143
98 3300014968 Ga0157379_11115434 Ga0157379_111154341 143
99 3300017792 Ga0163161_10000079 Ga0163161_1000007961 143
100 3300025903 Ga0207680_10002657 Ga0207680_1000265711 143
101 3300025907 Ga0207645_10780062 Ga0207645_107800621 143
102 3300025910 Ga0207684_10395728 Ga0207684_103957281 143
103 3300025911 Ga0207654_10223428 Ga0207654_102234281 143
104 3300025913 Ga0207695_10069630 Ga0207695_100696305 143
105 3300025921 Ga0207652_11004007 Ga0207652_110040072 143
106 3300025922 Ga0207646_10176636 Ga0207646_101766363 143
107 3300025923 Ga0207681_10114676 Ga0207681_101146761 143
108 3300025923 Ga0207681_11422106 Ga0207681_114221061 143
109 3300025924 Ga0207694_10085297 Ga0207694_100852973 143
110 3300025926 Ga0207659_11100855 Ga0207659_111008551 143
111 3300025931 Ga0207644_10021745 Ga0207644_100217455 143
112 3300025931 Ga0207644_10071016 Ga0207644_100710163 143
113 3300025931 Ga0207644_10771927 Ga0207644_107719272 143
114 3300025931 Ga0207644_10961341 Ga0207644_109613411 143
115 3300025933 Ga0207706_10075623 Ga0207706_100756233 143
116 3300025933 Ga0207706_10785623 Ga0207706_107856232 143
117 3300025933 Ga0207706_11287283 Ga0207706_112872831 143
118 3300025940 Ga0207691_10127071 Ga0207691_101270712 143
119 3300025940 Ga0207691_11020257 Ga0207691_110202571 143
120 3300025941 Ga0207711_11080022 Ga0207711_110800221 143
121 3300025944 Ga0207661_10143401 Ga0207661_101434012 143
122 3300025945 Ga0207679_10504028 Ga0207679_105040281 143
123 3300025949 Ga0207667_10008257 Ga0207667_1000825711 143
124 3300025960 Ga0207651_10958291 Ga0207651_109582911 143
125 3300025961 Ga0207712_10021314 Ga0207712_100213144 143
126 3300025972 Ga0207668_10333371 Ga0207668_103333712 143
127 3300025986 Ga0207658_10243084 Ga0207658_102430842 143
128 3300025986 Ga0207658_11391876 Ga0207658_113918761 143
129 3300026023 Ga0207677_11092857 Ga0207677_110928571 143
130 3300026035 Ga0207703_10242710 Ga0207703_102427103 143
131 3300026035 Ga0207703_10396726 Ga0207703_103967261 143
132 3300026035 Ga0207703_11342296 Ga0207703_113422962 143
133 3300026041 Ga0207639_10211503 Ga0207639_102115033 143
134 3300026088 Ga0207641_10005738 Ga0207641_1000573815 143
135 3300026088 Ga0207641_10190244 Ga0207641_101902442 143
136 3300026088 Ga0207641_11486066 Ga0207641_114860661 143
137 3300026089 Ga0207648_10228507 Ga0207648_102285073 143
138 3300026095 Ga0207676_10838602 Ga0207676_108386021 143
139 3300026118 Ga0207675_100056881 Ga0207675_1000568816 143
140 3300026118 Ga0207675_100601256 Ga0207675_1006012562 143
141 3300026118 Ga0207675_102732070 Ga0207675_1027320701 143
142 3300026121 Ga0207683_10809657 Ga0207683_108096571 143
143 3300026121 Ga0207683_11364146 Ga0207683_113641461 143
144 3300026121 Ga0207683_11893759 Ga0207683_118937591 143
145 3300026142 Ga0207698_10800892 Ga0207698_108008922 143
146 3300027907 Ga0207428_10010401 Ga0207428_100104015 143
147 3300027907 Ga0207428_10015529 Ga0207428_100155292 143
148 3300027907 Ga0207428_10346243 Ga0207428_103462432 143
149 3300028379 Ga0268266_10800763 Ga0268266_108007632 143
150 3300028381 Ga0268264_11297354 Ga0268264_112973541 143
151 3300028573 Ga0265334_10135517 Ga0265334_101355171 143
152 3300031691 Ga0316579_10035156 Ga0316579_100351561 143
153 3300031728 Ga0316578_10149521 Ga0316578_101495212 143
154 3300031731 Ga0307405_10876461 Ga0307405_108764612 143
155 3300031731 Ga0307405_11420422 Ga0307405_114204222 143
156 3300031852 Ga0307410_10007909 Ga0307410_100079092 143
157 3300031901 Ga0307406_10208757 Ga0307406_102087571 143
158 3300031901 Ga0307406_10758265 Ga0307406_107582651 143
159 3300031911 Ga0307412_10022657 Ga0307412_100226572 143
160 3300031911 Ga0307412_10250052 Ga0307412_102500521 143
161 3300031995 Ga0307409_100326411 Ga0307409_1003264111 143
162 3300032002 Ga0307416_100034840 Ga0307416_1000348402 143
163 3300032126 Ga0307415_100039302 Ga0307415_1000393022 143
164 3300032133 Ga0316583_10068943 Ga0316583_100689431 143
165 3300035086 Ga0373934_0063345 Ga0373934_0063345_737_1177 143
166 3300035111 Ga0373923_0073858 Ga0373923_0073858_13_453 143
167 3300035113 Ga0373936_0072765 Ga0373936_0072765_910_1350 143
168 3300035171 Ga0373946_0037378 Ga0373946_0037378_371_811 143
169 3300035692 Ga0373935_0056378 Ga0373935_0056378_1086_1526 143
170 3300035695 Ga0373927_0186307 Ga0373927_0186307_459_899 143
171 3300035724 Ga0373933_0201098 Ga0373933_0201098_152_592 143
172 3300035725 Ga0373947_0032554 Ga0373947_0032554_641_1081 143
173 3300036401 Ga0373937_0206256 Ga0373937_0206256_155_595 143
174 3300036647 Ga0316582_0040327 Ga0316582_0040327_525_965 143
175 3300037068 Ga0373925_0021829 Ga0373925_0021829_1082_1522 143
176 3300037068 Ga0373925_0151352 Ga0373925_0151352_103_543 143
177 3300037312 Ga0395899_0032403 Ga0395899_0032403_1612_2115 143
178 3300037418 Ga0395900_0026436 Ga0395900_0026436_851_1354 143
179 3300037466 Ga0395898_0339508 Ga0395898_0339508_964_1404 143
180 3300037471 Ga0395905_0027098 Ga0395905_0027098_442_960 143
181 3300037471 Ga0395905_0212228 Ga0395905_0212228_1294_1797 143
182 3300037471 Ga0395905_0258318 Ga0395905_0258318_868_1308 143
183 3300037471 Ga0395905_0685540 Ga0395905_0685540_343_801 143
184 3300037588 Ga0316581_0011059 Ga0316581_0011059_457_897 143
185 3300038443 Ga0395901_0021158 Ga0395901_0021158_546_1049 143
186 3300041453 Ga0451797_0366004 Ga0451797_0366004_85_528 143
187 3300041460 Ga0451802_1857936 Ga0451802_1857936_205_648 143
188 3300041999 Ga0439433_0024533 Ga0439433_0024533_540_1088 143
189 3300042007 Ga0439449_0000321 Ga0439449_0000321_14730_15278 143
190 3300042015 Ga0439462_0001735 Ga0439462_0001735_592_1140 143
191 3300042530 Ga0450916_098106 Ga0450916_098106_60_500 143
192 3300044656 Ga0466969_0006597 Ga0466969_0006597_5047_5520 143
193 3300044656 Ga0466969_0521117 Ga0466969_0521117_46_513 143
194 3300044684 Ga0466966_0034332 Ga0466966_0034332_1514_1987 143
195 3300044684 Ga0466966_0355095 Ga0466966_0355095_373_840 143
196 3300044693 Ga0466961_0009434 Ga0466961_0009434_3609_4082 143
197 3300045049 Ga0466959_0206772 Ga0466959_0206772_357_830 143
198 3300046472 Ga0495580_0000931 Ga0495580_0000931_15329_15769 143
199 3300046472 Ga0495580_0041262 Ga0495580_0041262_814_1254 143
200 3300046507 Ga0495606_0300574 Ga0495606_0300574_335_781 143
201 3300046528 Ga0495642_0011550 Ga0495642_0011550_1043_1516 143
202 3300046528 Ga0495642_0266034 Ga0495642_0266034_181_627 143
203 3300046528 Ga0495642_0368627 Ga0495642_0368627_168_614 143
204 3300046539 Ga0495621_0364979 Ga0495621_0364979_88_528 143
205 3300046542 Ga0495597_0422785 Ga0495597_0422785_10_456 143
206 3300046615 Ga0495656_0022370 Ga0495656_0022370_1675_2154 143
207 3300046615 Ga0495656_0202114 Ga0495656_0202114_248_721 143
208 3300046616 Ga0495668_0004549 Ga0495668_0004549_6441_6887 143
209 3300046660 Ga0495625_0614690 Ga0495625_0614690_105_551 143
210 3300046674 Ga0495588_0073837 Ga0495588_0073837_239_682 143
211 3300046674 Ga0495588_0216575 Ga0495588_0216575_43_516 143
212 3300046683 Ga0495658_0304603 Ga0495658_0304603_238_684 143
213 3300046684 Ga0495669_0302272 Ga0495669_0302272_210_656 143
214 3300046684 Ga0495669_0343676 Ga0495669_0343676_95_568 143
215 3300047445 Ga0495677_0235967 Ga0495677_0235967_101_547 143
216 3300047447 Ga0495685_113229 Ga0495685_113229_403_849 143
217 3300048909 Ga0496106_0634694 Ga0496106_0634694_130_570 143
218 3300048911 Ga0496108_0810944 Ga0496108_0810944_219_659 143
219 3300048917 Ga0496114_1047719 Ga0496114_1047719_207_647 143
220 3300049686 Ga0501257_080584 Ga0501257_080584_211_654 143
221 3300050508 nmdc:mga09592_245849_c1 nmdc:mga09592_245849_c1_1077_1517 143
222 3300050508 nmdc:mga09592_717564_c1 nmdc:mga09592_717564_c1_360_800 143
223 3300050509 nmdc:mga0qj67_543545_c1 nmdc:mga0qj67_543545_c1_340_780 143
224 3300050511 nmdc:mga08y16_124671_c1 nmdc:mga08y16_124671_c1_1956_2396 143
225 3300050511 nmdc:mga08y16_20850_c1 nmdc:mga08y16_20850_c1_2018_2458 143
226 3300050511 nmdc:mga08y16_22927_c1 nmdc:mga08y16_22927_c1_5253_5693 143
227 3300050515 nmdc:mga0a205_169797_c1 nmdc:mga0a205_169797_c1_282_722 143
228 3300053118 Ga0500594_0267651 Ga0500594_0267651_78_524 143
229 3300054114 Ga0501084_1116558 Ga0501084_1116558_73_513 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

67

134

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9475 33 107
8awn-assembly1.cif.gz_A-2 crystal structure of a manganese-containing cupin (tm1459) from thermotoga maritima, variant c106q 0.9289 4 107
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9286 22 107
6l2e-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h52a mutant) in copper (cu) substituted form 0.9238 4 106
8hjy-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h52a/h58e/f104w mutant) in copper (cu) substituted form 0.9215 3 106
ID Description Score Start End Superfamily
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9439 34 105 2.60.120.10
5cu1A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.916 33 105 2.60.120.10
af_Q54K96_70_313_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9128 34 106 2.60.120.650
af_A0A1D6JGF3_359_568_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.91 34 107 2.60.120.650
1gqhB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9038 5 117 2.60.120.10
ID Description Score Start End GO Terms
AF-B8KU04-F1-model_v4 Cupin 2, conserved barrel 0.981 17 143
AF-A0A0Q8LWT7-F1-model_v4 Cupin 0.979 1 143
AF-A0A075JVT6-F1-model_v4 Cupin 0.9789 1 143
AF-A0A1V5AX55-F1-model_v4 Cupin domain protein 0.9733 19 106
AF-A0A0Q8LWT7-F1-model_v4 Cupin 0.9723 1 143

Feature Viewer

pLDDT pTM Quality
92.88 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map