F342035
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 229 | 156 | 228 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_12118347|Ga0157378_121183471 |
| Length | 174 |
| Sequence | VAVEECGCNGFNGVMPAAGGFYPRKETDMSLQPLVVTRNDYPRPLHVVGEQITVLASGAGTGSYEIFMQEGAEGSGPPPHSHPWDEAFYVTRGEVAFGLGPDQLTAVAGTLVHIPAGTIHWFRFGQGGGAMFSVTTKLGASRMFEEIDREISPTAPDMGKLVQIATQHGLTLAM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 97 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 98 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 100 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 101 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 102 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 103 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 104 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 105 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 106 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 107 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 109 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 112 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 113 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 124 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 126 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 127 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 128 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 129 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 130 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 131 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 132 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 133 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 149 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 150 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 155 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0.44 |
| Isolates | 0.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.44 |
| Nodule | 0 |
| Rhizoplane | 2.18 |
| Rhizosphere | 97.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100275356 | 3300005329 | Bacteria | 1601 |
| 2 | Ga0070690_101208692 | 3300005330 | Unclassified | 603 |
| 3 | Ga0070670_101036221 | 3300005331 | Unclassified | 747 |
| 4 | Ga0070666_10154051 | 3300005335 | Bacteria | 1604 |
| 5 | Ga0070666_10213547 | 3300005335 | Bacteria | 1359 |
| 6 | Ga0070666_11195911 | 3300005335 | Bacteria | 566 |
| 7 | Ga0070680_100391449 | 3300005336 | Bacteria | 1184 |
| 8 | Ga0070680_101150083 | 3300005336 | Unclassified | 671 |
| 9 | Ga0068868_101059065 | 3300005338 | Unclassified | 744 |
| 10 | Ga0070675_100109096 | 3300005354 | Bacteria | 2339 |
| 11 | Ga0070675_101039633 | 3300005354 | Unclassified | 752 |
| 12 | Ga0070671_100003968 | 3300005355 | Bacteria | 11650 |
| 13 | Ga0070671_100330622 | 3300005355 | Bacteria | 1299 |
| 14 | Ga0070673_100936403 | 3300005364 | Unclassified | 804 |
| 15 | Ga0070659_100928866 | 3300005366 | Bacteria | 761 |
| 16 | Ga0070667_100217649 | 3300005367 | Bacteria | 1699 |
| 17 | Ga0070667_100721015 | 3300005367 | Unclassified | 923 |
| 18 | Ga0070667_100858326 | 3300005367 | Unclassified | 844 |
| 19 | Ga0070667_101276410 | 3300005367 | Bacteria | 688 |
| 20 | Ga0070678_100818763 | 3300005456 | Unclassified | 846 |
| 21 | Ga0068867_100965773 | 3300005459 | Unclassified | 770 |
| 22 | Ga0070685_10059769 | 3300005466 | Bacteria | 2226 |
| 23 | Ga0070685_11531884 | 3300005466 | Bacteria | 514 |
| 24 | Ga0070706_100343284 | 3300005467 | Bacteria | 1392 |
| 25 | Ga0070706_100631010 | 3300005467 | Bacteria | 995 |
| 26 | Ga0070707_100187563 | 3300005468 | Bacteria | 2016 |
| 27 | Ga0070679_100143209 | 3300005530 | Bacteria | 2369 |
| 28 | Ga0070679_100741156 | 3300005530 | Bacteria | 925 |
| 29 | Ga0068853_100261361 | 3300005539 | Bacteria | 1591 |
| 30 | Ga0068853_100274468 | 3300005539 | Bacteria | 1553 |
| 31 | Ga0070672_100122522 | 3300005543 | Unclassified | 2130 |
| 32 | Ga0070672_100962508 | 3300005543 | Unclassified | 755 |
| 33 | Ga0070696_100359777 | 3300005546 | Unclassified | 1129 |
| 34 | Ga0070665_100879778 | 3300005548 | Bacteria | 909 |
| 35 | Ga0070704_100175637 | 3300005549 | Unclassified | 1708 |
| 36 | Ga0068855_100083942 | 3300005563 | Bacteria | 3689 |
| 37 | Ga0070664_100997667 | 3300005564 | Bacteria | 787 |
| 38 | Ga0068857_101226307 | 3300005577 | Bacteria | 727 |
| 39 | Ga0068856_100579450 | 3300005614 | Bacteria | 1143 |
| 40 | Ga0068859_101208384 | 3300005617 | Unclassified | 833 |
| 41 | Ga0068864_100604459 | 3300005618 | Bacteria | 1064 |
| 42 | Ga0068866_11048154 | 3300005718 | Unclassified | 582 |
| 43 | Ga0068861_100171980 | 3300005719 | Bacteria | 1796 |
| 44 | Ga0068861_100623802 | 3300005719 | Unclassified | 992 |
| 45 | Ga0068863_100146923 | 3300005841 | Bacteria | 2255 |
| 46 | Ga0068863_101218229 | 3300005841 | Bacteria | 759 |
| 47 | Ga0068863_101809799 | 3300005841 | Bacteria | 620 |
| 48 | Ga0068858_100462964 | 3300005842 | Unclassified | 1223 |
| 49 | Ga0068860_100315975 | 3300005843 | Unclassified | 1532 |
| 50 | Ga0068860_100385049 | 3300005843 | Unclassified | 1385 |
| 51 | Ga0068862_100133830 | 3300005844 | Unclassified | 2195 |
| 52 | Ga0068862_100656144 | 3300005844 | Unclassified | 1012 |
| 53 | Ga0070712_100664440 | 3300006175 | Bacteria | 886 |
| 54 | Ga0097621_100417669 | 3300006237 | Bacteria | 1203 |
| 55 | Ga0097621_101151195 | 3300006237 | Unclassified | 729 |
| 56 | Ga0068871_100599783 | 3300006358 | Bacteria | 1001 |
| 57 | Ga0075428_100377516 | 3300006844 | Bacteria | 1520 |
| 58 | Ga0075430_100274881 | 3300006846 | Bacteria | 1394 |
| 59 | Ga0075430_100360178 | 3300006846 | Unclassified | 1201 |
| 60 | Ga0075431_100785656 | 3300006847 | Bacteria | 926 |
| 61 | Ga0075429_100332737 | 3300006880 | Bacteria | 1329 |
| 62 | Ga0075429_100377353 | 3300006880 | Bacteria | 1241 |
| 63 | Ga0097620_101208453 | 3300006931 | Unclassified | 833 |
| 64 | Ga0105240_10006128 | 3300009093 | Bacteria | 17734 |
| 65 | Ga0105240_10025366 | 3300009093 | Bacteria | 7792 |
| 66 | Ga0105240_11048908 | 3300009093 | Bacteria | 870 |
| 67 | Ga0111539_10007847 | 3300009094 | Bacteria | 13632 |
| 68 | Ga0111539_10021855 | 3300009094 | Bacteria | 7866 |
| 69 | Ga0111539_10541740 | 3300009094 | Unclassified | 1356 |
| 70 | Ga0111539_12494884 | 3300009094 | Bacteria | 600 |
| 71 | Ga0105243_11510094 | 3300009148 | Unclassified | 696 |
| 72 | Ga0105241_10471692 | 3300009174 | Bacteria | 1114 |
| 73 | Ga0105242_11998719 | 3300009176 | Unclassified | 622 |
| 74 | Ga0105248_11568925 | 3300009177 | Unclassified | 746 |
| 75 | Ga0105238_10026944 | 3300009551 | Bacteria | 5858 |
| 76 | Ga0105238_12216320 | 3300009551 | Unclassified | 584 |
| 77 | Ga0105249_10006602 | 3300009553 | Bacteria | 10094 |
| 78 | Ga0105249_11124461 | 3300009553 | Unclassified | 856 |
| 79 | Ga0105249_11865611 | 3300009553 | Unclassified | 674 |
| 80 | Ga0105239_10041759 | 3300010375 | Bacteria | 5026 |
| 81 | Ga0157369_10460606 | 3300013105 | Bacteria | 1316 |
| 82 | Ga0157378_12118347 | 3300013297 | Bacteria | 613 |
| 83 | Ga0157378_12650604 | 3300013297 | Unclassified | 554 |
| 84 | Ga0163162_11714376 | 3300013306 | Unclassified | 718 |
| 85 | Ga0163162_12130069 | 3300013306 | Bacteria | 643 |
| 86 | Ga0157375_10019909 | 3300013308 | Bacteria | 6118 |
| 87 | Ga0157375_10804697 | 3300013308 | Unclassified | 1088 |
| 88 | Ga0157375_11055516 | 3300013308 | Unclassified | 950 |
| 89 | Ga0163163_10802171 | 3300014325 | Bacteria | 1005 |
| 90 | Ga0157380_10457861 | 3300014326 | Bacteria | 1227 |
| 91 | Ga0157380_11973131 | 3300014326 | Unclassified | 645 |
| 92 | Ga0157379_10007024 | 3300014968 | Bacteria | 9731 |
| 93 | Ga0157379_11115434 | 3300014968 | Unclassified | 756 |
| 94 | Ga0163161_10000079 | 3300017792 | Bacteria | 97522 |
| 95 | Ga0207680_10002657 | 3300025903 | Bacteria | 8356 |
| 96 | Ga0207645_10780062 | 3300025907 | Unclassified | 650 |
| 97 | Ga0207684_10395728 | 3300025910 | Bacteria | 1188 |
| 98 | Ga0207654_10223428 | 3300025911 | Bacteria | 1250 |
| 99 | Ga0207695_10004836 | 3300025913 | Bacteria | 18184 |
| 100 | Ga0207695_10069630 | 3300025913 | Bacteria | 3599 |
| 101 | Ga0207652_10645522 | 3300025921 | Unclassified | 947 |
| 102 | Ga0207652_11004007 | 3300025921 | Bacteria | 733 |
| 103 | Ga0207646_10176636 | 3300025922 | Bacteria | 1929 |
| 104 | Ga0207681_10114676 | 3300025923 | Bacteria | 1966 |
| 105 | Ga0207681_11422106 | 3300025923 | Bacteria | 582 |
| 106 | Ga0207694_10085297 | 3300025924 | Bacteria | 2485 |
| 107 | Ga0207659_11100855 | 3300025926 | Unclassified | 683 |
| 108 | Ga0207644_10021745 | 3300025931 | Bacteria | 4374 |
| 109 | Ga0207644_10071016 | 3300025931 | Bacteria | 2546 |
| 110 | Ga0207644_10771927 | 3300025931 | Unclassified | 803 |
| 111 | Ga0207644_10961341 | 3300025931 | Unclassified | 716 |
| 112 | Ga0207690_10624698 | 3300025932 | Bacteria | 881 |
| 113 | Ga0207706_10075623 | 3300025933 | Unclassified | 2962 |
| 114 | Ga0207706_10785623 | 3300025933 | Bacteria | 809 |
| 115 | Ga0207706_11287283 | 3300025933 | Unclassified | 604 |
| 116 | Ga0207691_10127071 | 3300025940 | Unclassified | 2255 |
| 117 | Ga0207691_11020257 | 3300025940 | Unclassified | 690 |
| 118 | Ga0207711_11080022 | 3300025941 | Unclassified | 743 |
| 119 | Ga0207661_10143401 | 3300025944 | Bacteria | 2058 |
| 120 | Ga0207679_10504028 | 3300025945 | Bacteria | 1080 |
| 121 | Ga0207667_10008257 | 3300025949 | Bacteria | 12393 |
| 122 | Ga0207651_10958291 | 3300025960 | Unclassified | 763 |
| 123 | Ga0207712_10021314 | 3300025961 | Bacteria | 4254 |
| 124 | Ga0207668_10333371 | 3300025972 | Unclassified | 1263 |
| 125 | Ga0207658_10243084 | 3300025986 | Bacteria | 1526 |
| 126 | Ga0207658_11391876 | 3300025986 | Unclassified | 642 |
| 127 | Ga0207677_11092857 | 3300026023 | Unclassified | 727 |
| 128 | Ga0207703_10242710 | 3300026035 | Unclassified | 1620 |
| 129 | Ga0207703_10396726 | 3300026035 | Bacteria | 1279 |
| 130 | Ga0207703_11342296 | 3300026035 | Unclassified | 688 |
| 131 | Ga0207639_10211503 | 3300026041 | Bacteria | 1670 |
| 132 | Ga0207641_10005738 | 3300026088 | Bacteria | 10545 |
| 133 | Ga0207641_10190244 | 3300026088 | Bacteria | 1886 |
| 134 | Ga0207641_11486066 | 3300026088 | Bacteria | 679 |
| 135 | Ga0207648_10228507 | 3300026089 | Unclassified | 1655 |
| 136 | Ga0207676_10838602 | 3300026095 | Unclassified | 898 |
| 137 | Ga0207675_100056881 | 3300026118 | Bacteria | 3648 |
| 138 | Ga0207675_100601256 | 3300026118 | Bacteria | 1103 |
| 139 | Ga0207675_102732070 | 3300026118 | Bacteria | 502 |
| 140 | Ga0207683_10809657 | 3300026121 | Unclassified | 869 |
| 141 | Ga0207683_11364146 | 3300026121 | Bacteria | 656 |
| 142 | Ga0207683_11893759 | 3300026121 | Unclassified | 545 |
| 143 | Ga0207698_10800892 | 3300026142 | Unclassified | 944 |
| 144 | Ga0207428_10010401 | 3300027907 | Bacteria | 8312 |
| 145 | Ga0207428_10015529 | 3300027907 | Bacteria | 6584 |
| 146 | Ga0207428_10346243 | 3300027907 | Bacteria | 1094 |
| 147 | Ga0268266_10800763 | 3300028379 | Bacteria | 910 |
| 148 | Ga0268264_11297354 | 3300028381 | Unclassified | 738 |
| 149 | Ga0265334_10135517 | 3300028573 | Bacteria | 874 |
| 150 | Ga0316579_10035156 | 3300031691 | Bacteria | 2308 |
| 151 | Ga0316578_10149521 | 3300031728 | Bacteria | 1407 |
| 152 | Ga0307405_10876461 | 3300031731 | Unclassified | 758 |
| 153 | Ga0307405_11420422 | 3300031731 | Unclassified | 607 |
| 154 | Ga0307410_10007909 | 3300031852 | Bacteria | 5858 |
| 155 | Ga0307406_10208757 | 3300031901 | Bacteria | 1443 |
| 156 | Ga0307406_10758265 | 3300031901 | Unclassified | 815 |
| 157 | Ga0307412_10022657 | 3300031911 | Bacteria | 3855 |
| 158 | Ga0307412_10250052 | 3300031911 | Bacteria | 1376 |
| 159 | Ga0307409_100326411 | 3300031995 | Bacteria | 1438 |
| 160 | Ga0307416_100034840 | 3300032002 | Bacteria | 3837 |
| 161 | Ga0307415_100039302 | 3300032126 | Bacteria | 3126 |
| 162 | Ga0316583_10068943 | 3300032133 | Bacteria | 1237 |
| 163 | Ga0373934_0063345 | 3300035086 | Bacteria | 1475 |
| 164 | Ga0373923_0073858 | 3300035111 | Bacteria | 1469 |
| 165 | Ga0373936_0072765 | 3300035113 | Bacteria | 1420 |
| 166 | Ga0373946_0037378 | 3300035171 | Bacteria | 1973 |
| 167 | Ga0373935_0056378 | 3300035692 | Bacteria | 2505 |
| 168 | Ga0373927_0186307 | 3300035695 | Bacteria | 1361 |
| 169 | Ga0373933_0201098 | 3300035724 | Bacteria | 1275 |
| 170 | Ga0373947_0032554 | 3300035725 | Bacteria | 3073 |
| 171 | Ga0373937_0206256 | 3300036401 | Bacteria | 1848 |
| 172 | Ga0316582_0040327 | 3300036647 | Bacteria | 2913 |
| 173 | Ga0373925_0021829 | 3300037068 | Bacteria | 4667 |
| 174 | Ga0373925_0151352 | 3300037068 | Bacteria | 1822 |
| 175 | Ga0395899_0032403 | 3300037312 | Bacteria | 3925 |
| 176 | Ga0395900_0026436 | 3300037418 | Bacteria | 5942 |
| 177 | Ga0395898_0339508 | 3300037466 | Bacteria | 1432 |
| 178 | Ga0395905_0027098 | 3300037471 | Bacteria | 5404 |
| 179 | Ga0395905_0212228 | 3300037471 | Bacteria | 1813 |
| 180 | Ga0395905_0258318 | 3300037471 | Bacteria | 1626 |
| 181 | Ga0395905_0685540 | 3300037471 | Bacteria | 927 |
| 182 | Ga0316581_0011059 | 3300037588 | Bacteria | 2516 |
| 183 | Ga0395901_0021158 | 3300038443 | Bacteria | 6663 |
| 184 | Ga0451797_0366004 | 3300041453 | Bacteria | 566 |
| 185 | Ga0451802_1857936 | 3300041460 | Bacteria | 681 |
| 186 | Ga0439433_0024533 | 3300041999 | Bacteria | 1359 |
| 187 | Ga0439449_0000321 | 3300042007 | Bacteria | 17412 |
| 188 | Ga0439462_0001735 | 3300042015 | Bacteria | 4927 |
| 189 | Ga0450916_098106 | 3300042530 | Bacteria | 517 |
| 190 | Ga0466969_0006597 | 3300044656 | Bacteria | 6171 |
| 191 | Ga0466969_0521117 | 3300044656 | Bacteria | 543 |
| 192 | Ga0466966_0034332 | 3300044684 | Bacteria | 3280 |
| 193 | Ga0466966_0355095 | 3300044684 | Bacteria | 881 |
| 194 | Ga0466961_0009434 | 3300044693 | Bacteria | 6212 |
| 195 | Ga0466959_0206772 | 3300045049 | Unclassified | 1365 |
| 196 | Ga0495580_0000931 | 3300046472 | Bacteria | 25570 |
| 197 | Ga0495580_0041262 | 3300046472 | Bacteria | 3291 |
| 198 | Ga0495606_0300574 | 3300046507 | Bacteria | 870 |
| 199 | Ga0495642_0011550 | 3300046528 | Bacteria | 3395 |
| 200 | Ga0495642_0266034 | 3300046528 | Unclassified | 750 |
| 201 | Ga0495642_0368627 | 3300046528 | Bacteria | 632 |
| 202 | Ga0495621_0364979 | 3300046539 | Bacteria | 608 |
| 203 | Ga0495597_0422785 | 3300046542 | Bacteria | 505 |
| 204 | Ga0495656_0022370 | 3300046615 | Bacteria | 2475 |
| 205 | Ga0495656_0202114 | 3300046615 | Unclassified | 986 |
| 206 | Ga0495668_0004549 | 3300046616 | Bacteria | 9779 |
| 207 | Ga0495625_0614690 | 3300046660 | Bacteria | 651 |
| 208 | Ga0495588_0073837 | 3300046674 | Bacteria | 1776 |
| 209 | Ga0495588_0216575 | 3300046674 | Bacteria | 1011 |
| 210 | Ga0495658_0304603 | 3300046683 | Unclassified | 1008 |
| 211 | Ga0495669_0302272 | 3300046684 | Bacteria | 771 |
| 212 | Ga0495669_0343676 | 3300046684 | Unclassified | 721 |
| 213 | Ga0495677_0235967 | 3300047445 | Bacteria | 714 |
| 214 | Ga0495685_113229 | 3300047447 | Bacteria | 892 |
| 215 | Ga0496106_0634694 | 3300048909 | Unclassified | 854 |
| 216 | Ga0496108_0810944 | 3300048911 | Unclassified | 807 |
| 217 | Ga0496114_1047719 | 3300048917 | Unclassified | 700 |
| 218 | Ga0501257_080584 | 3300049686 | Bacteria | 839 |
| 219 | nmdc:mga09592_245849_c1 | 3300050508 | Bacteria | 1550 |
| 220 | nmdc:mga09592_717564_c1 | 3300050508 | Bacteria | 850 |
| 221 | nmdc:mga0qj67_543545_c1 | 3300050509 | Bacteria | 932 |
| 222 | nmdc:mga08y16_124671_c1 | 3300050511 | Unclassified | 2680 |
| 223 | nmdc:mga08y16_20850_c1 | 3300050511 | Bacteria | 6919 |
| 224 | nmdc:mga08y16_22927_c1 | 3300050511 | Bacteria | 6590 |
| 225 | nmdc:mga0a205_169797_c1 | 3300050515 | Bacteria | 2077 |
| 226 | Ga0500594_0267651 | 3300053118 | Bacteria | 570 |
| 227 | Ga0501084_1116558 | 3300054114 | Bacteria | 662 |
| 228 | Ga0587115_085190 | 3300059626 | Bacteria | 566 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006237 | Ga0097621_100417669 | Ga0097621_1004176692 | 138 |
| 2 | iso_pu_bacteria | 2883291878 | 2883296220 | 140 |
| 3 | 3300005335 | Ga0070666_10154051 | Ga0070666_101540513 | 142 |
| 4 | 3300005366 | Ga0070659_100928866 | Ga0070659_1009288662 | 142 |
| 5 | 3300005367 | Ga0070667_101276410 | Ga0070667_1012764101 | 142 |
| 6 | 3300005530 | Ga0070679_100741156 | Ga0070679_1007411562 | 142 |
| 7 | 3300005614 | Ga0068856_100579450 | Ga0068856_1005794502 | 142 |
| 8 | 3300009093 | Ga0105240_10006128 | Ga0105240_100061286 | 142 |
| 9 | 3300009093 | Ga0105240_11048908 | Ga0105240_110489081 | 142 |
| 10 | 3300025913 | Ga0207695_10004836 | Ga0207695_1000483611 | 142 |
| 11 | 3300025921 | Ga0207652_10645522 | Ga0207652_106455222 | 142 |
| 12 | 3300025932 | Ga0207690_10624698 | Ga0207690_106246981 | 142 |
| 13 | 3300059626 | Ga0587115_085190 | Ga0587115_085190_57_494 | 142 |
| 14 | 3300005329 | Ga0070683_100275356 | Ga0070683_1002753563 | 143 |
| 15 | 3300005330 | Ga0070690_101208692 | Ga0070690_1012086921 | 143 |
| 16 | 3300005331 | Ga0070670_101036221 | Ga0070670_1010362211 | 143 |
| 17 | 3300005335 | Ga0070666_10213547 | Ga0070666_102135472 | 143 |
| 18 | 3300005335 | Ga0070666_11195911 | Ga0070666_111959111 | 143 |
| 19 | 3300005336 | Ga0070680_100391449 | Ga0070680_1003914492 | 143 |
| 20 | 3300005336 | Ga0070680_101150083 | Ga0070680_1011500831 | 143 |
| 21 | 3300005338 | Ga0068868_101059065 | Ga0068868_1010590651 | 143 |
| 22 | 3300005354 | Ga0070675_100109096 | Ga0070675_1001090963 | 143 |
| 23 | 3300005354 | Ga0070675_101039633 | Ga0070675_1010396331 | 143 |
| 24 | 3300005355 | Ga0070671_100003968 | Ga0070671_1000039687 | 143 |
| 25 | 3300005355 | Ga0070671_100330622 | Ga0070671_1003306222 | 143 |
| 26 | 3300005364 | Ga0070673_100936403 | Ga0070673_1009364031 | 143 |
| 27 | 3300005367 | Ga0070667_100217649 | Ga0070667_1002176492 | 143 |
| 28 | 3300005367 | Ga0070667_100721015 | Ga0070667_1007210151 | 143 |
| 29 | 3300005367 | Ga0070667_100858326 | Ga0070667_1008583261 | 143 |
| 30 | 3300005456 | Ga0070678_100818763 | Ga0070678_1008187631 | 143 |
| 31 | 3300005459 | Ga0068867_100965773 | Ga0068867_1009657731 | 143 |
| 32 | 3300005466 | Ga0070685_10059769 | Ga0070685_100597693 | 143 |
| 33 | 3300005466 | Ga0070685_11531884 | Ga0070685_115318841 | 143 |
| 34 | 3300005467 | Ga0070706_100343284 | Ga0070706_1003432841 | 143 |
| 35 | 3300005467 | Ga0070706_100631010 | Ga0070706_1006310102 | 143 |
| 36 | 3300005468 | Ga0070707_100187563 | Ga0070707_1001875631 | 143 |
| 37 | 3300005530 | Ga0070679_100143209 | Ga0070679_1001432093 | 143 |
| 38 | 3300005539 | Ga0068853_100261361 | Ga0068853_1002613613 | 143 |
| 39 | 3300005539 | Ga0068853_100274468 | Ga0068853_1002744683 | 143 |
| 40 | 3300005543 | Ga0070672_100122522 | Ga0070672_1001225221 | 143 |
| 41 | 3300005543 | Ga0070672_100962508 | Ga0070672_1009625081 | 143 |
| 42 | 3300005546 | Ga0070696_100359777 | Ga0070696_1003597771 | 143 |
| 43 | 3300005548 | Ga0070665_100879778 | Ga0070665_1008797782 | 143 |
| 44 | 3300005549 | Ga0070704_100175637 | Ga0070704_1001756371 | 143 |
| 45 | 3300005563 | Ga0068855_100083942 | Ga0068855_1000839422 | 143 |
| 46 | 3300005564 | Ga0070664_100997667 | Ga0070664_1009976672 | 143 |
| 47 | 3300005577 | Ga0068857_101226307 | Ga0068857_1012263072 | 143 |
| 48 | 3300005617 | Ga0068859_101208384 | Ga0068859_1012083841 | 143 |
| 49 | 3300005618 | Ga0068864_100604459 | Ga0068864_1006044591 | 143 |
| 50 | 3300005718 | Ga0068866_11048154 | Ga0068866_110481541 | 143 |
| 51 | 3300005719 | Ga0068861_100171980 | Ga0068861_1001719803 | 143 |
| 52 | 3300005719 | Ga0068861_100623802 | Ga0068861_1006238021 | 143 |
| 53 | 3300005841 | Ga0068863_100146923 | Ga0068863_1001469231 | 143 |
| 54 | 3300005841 | Ga0068863_101218229 | Ga0068863_1012182292 | 143 |
| 55 | 3300005841 | Ga0068863_101809799 | Ga0068863_1018097992 | 143 |
| 56 | 3300005842 | Ga0068858_100462964 | Ga0068858_1004629641 | 143 |
| 57 | 3300005843 | Ga0068860_100315975 | Ga0068860_1003159751 | 143 |
| 58 | 3300005843 | Ga0068860_100385049 | Ga0068860_1003850491 | 143 |
| 59 | 3300005844 | Ga0068862_100133830 | Ga0068862_1001338302 | 143 |
| 60 | 3300005844 | Ga0068862_100656144 | Ga0068862_1006561441 | 143 |
| 61 | 3300006175 | Ga0070712_100664440 | Ga0070712_1006644402 | 143 |
| 62 | 3300006237 | Ga0097621_101151195 | Ga0097621_1011511951 | 143 |
| 63 | 3300006358 | Ga0068871_100599783 | Ga0068871_1005997832 | 143 |
| 64 | 3300006844 | Ga0075428_100377516 | Ga0075428_1003775162 | 143 |
| 65 | 3300006846 | Ga0075430_100274881 | Ga0075430_1002748811 | 143 |
| 66 | 3300006846 | Ga0075430_100360178 | Ga0075430_1003601782 | 143 |
| 67 | 3300006847 | Ga0075431_100785656 | Ga0075431_1007856562 | 143 |
| 68 | 3300006880 | Ga0075429_100332737 | Ga0075429_1003327372 | 143 |
| 69 | 3300006880 | Ga0075429_100377353 | Ga0075429_1003773532 | 143 |
| 70 | 3300006931 | Ga0097620_101208453 | Ga0097620_1012084532 | 143 |
| 71 | 3300009093 | Ga0105240_10025366 | Ga0105240_100253665 | 143 |
| 72 | 3300009094 | Ga0111539_10007847 | Ga0111539_100078475 | 143 |
| 73 | 3300009094 | Ga0111539_10021855 | Ga0111539_100218552 | 143 |
| 74 | 3300009094 | Ga0111539_10541740 | Ga0111539_105417403 | 143 |
| 75 | 3300009094 | Ga0111539_12494884 | Ga0111539_124948841 | 143 |
| 76 | 3300009148 | Ga0105243_11510094 | Ga0105243_115100941 | 143 |
| 77 | 3300009174 | Ga0105241_10471692 | Ga0105241_104716922 | 143 |
| 78 | 3300009176 | Ga0105242_11998719 | Ga0105242_119987191 | 143 |
| 79 | 3300009177 | Ga0105248_11568925 | Ga0105248_115689251 | 143 |
| 80 | 3300009551 | Ga0105238_10026944 | Ga0105238_100269444 | 143 |
| 81 | 3300009551 | Ga0105238_12216320 | Ga0105238_122163201 | 143 |
| 82 | 3300009553 | Ga0105249_10006602 | Ga0105249_100066027 | 143 |
| 83 | 3300009553 | Ga0105249_11124461 | Ga0105249_111244611 | 143 |
| 84 | 3300009553 | Ga0105249_11865611 | Ga0105249_118656111 | 143 |
| 85 | 3300010375 | Ga0105239_10041759 | Ga0105239_100417595 | 143 |
| 86 | 3300013105 | Ga0157369_10460606 | Ga0157369_104606062 | 143 |
| 87 | 3300013297 | Ga0157378_12118347 | Ga0157378_121183471 | 143 |
| 88 | 3300013297 | Ga0157378_12650604 | Ga0157378_126506041 | 143 |
| 89 | 3300013306 | Ga0163162_11714376 | Ga0163162_117143761 | 143 |
| 90 | 3300013306 | Ga0163162_12130069 | Ga0163162_121300691 | 143 |
| 91 | 3300013308 | Ga0157375_10019909 | Ga0157375_100199094 | 143 |
| 92 | 3300013308 | Ga0157375_10804697 | Ga0157375_108046971 | 143 |
| 93 | 3300013308 | Ga0157375_11055516 | Ga0157375_110555162 | 143 |
| 94 | 3300014325 | Ga0163163_10802171 | Ga0163163_108021712 | 143 |
| 95 | 3300014326 | Ga0157380_10457861 | Ga0157380_104578612 | 143 |
| 96 | 3300014326 | Ga0157380_11973131 | Ga0157380_119731312 | 143 |
| 97 | 3300014968 | Ga0157379_10007024 | Ga0157379_100070243 | 143 |
| 98 | 3300014968 | Ga0157379_11115434 | Ga0157379_111154341 | 143 |
| 99 | 3300017792 | Ga0163161_10000079 | Ga0163161_1000007961 | 143 |
| 100 | 3300025903 | Ga0207680_10002657 | Ga0207680_1000265711 | 143 |
| 101 | 3300025907 | Ga0207645_10780062 | Ga0207645_107800621 | 143 |
| 102 | 3300025910 | Ga0207684_10395728 | Ga0207684_103957281 | 143 |
| 103 | 3300025911 | Ga0207654_10223428 | Ga0207654_102234281 | 143 |
| 104 | 3300025913 | Ga0207695_10069630 | Ga0207695_100696305 | 143 |
| 105 | 3300025921 | Ga0207652_11004007 | Ga0207652_110040072 | 143 |
| 106 | 3300025922 | Ga0207646_10176636 | Ga0207646_101766363 | 143 |
| 107 | 3300025923 | Ga0207681_10114676 | Ga0207681_101146761 | 143 |
| 108 | 3300025923 | Ga0207681_11422106 | Ga0207681_114221061 | 143 |
| 109 | 3300025924 | Ga0207694_10085297 | Ga0207694_100852973 | 143 |
| 110 | 3300025926 | Ga0207659_11100855 | Ga0207659_111008551 | 143 |
| 111 | 3300025931 | Ga0207644_10021745 | Ga0207644_100217455 | 143 |
| 112 | 3300025931 | Ga0207644_10071016 | Ga0207644_100710163 | 143 |
| 113 | 3300025931 | Ga0207644_10771927 | Ga0207644_107719272 | 143 |
| 114 | 3300025931 | Ga0207644_10961341 | Ga0207644_109613411 | 143 |
| 115 | 3300025933 | Ga0207706_10075623 | Ga0207706_100756233 | 143 |
| 116 | 3300025933 | Ga0207706_10785623 | Ga0207706_107856232 | 143 |
| 117 | 3300025933 | Ga0207706_11287283 | Ga0207706_112872831 | 143 |
| 118 | 3300025940 | Ga0207691_10127071 | Ga0207691_101270712 | 143 |
| 119 | 3300025940 | Ga0207691_11020257 | Ga0207691_110202571 | 143 |
| 120 | 3300025941 | Ga0207711_11080022 | Ga0207711_110800221 | 143 |
| 121 | 3300025944 | Ga0207661_10143401 | Ga0207661_101434012 | 143 |
| 122 | 3300025945 | Ga0207679_10504028 | Ga0207679_105040281 | 143 |
| 123 | 3300025949 | Ga0207667_10008257 | Ga0207667_1000825711 | 143 |
| 124 | 3300025960 | Ga0207651_10958291 | Ga0207651_109582911 | 143 |
| 125 | 3300025961 | Ga0207712_10021314 | Ga0207712_100213144 | 143 |
| 126 | 3300025972 | Ga0207668_10333371 | Ga0207668_103333712 | 143 |
| 127 | 3300025986 | Ga0207658_10243084 | Ga0207658_102430842 | 143 |
| 128 | 3300025986 | Ga0207658_11391876 | Ga0207658_113918761 | 143 |
| 129 | 3300026023 | Ga0207677_11092857 | Ga0207677_110928571 | 143 |
| 130 | 3300026035 | Ga0207703_10242710 | Ga0207703_102427103 | 143 |
| 131 | 3300026035 | Ga0207703_10396726 | Ga0207703_103967261 | 143 |
| 132 | 3300026035 | Ga0207703_11342296 | Ga0207703_113422962 | 143 |
| 133 | 3300026041 | Ga0207639_10211503 | Ga0207639_102115033 | 143 |
| 134 | 3300026088 | Ga0207641_10005738 | Ga0207641_1000573815 | 143 |
| 135 | 3300026088 | Ga0207641_10190244 | Ga0207641_101902442 | 143 |
| 136 | 3300026088 | Ga0207641_11486066 | Ga0207641_114860661 | 143 |
| 137 | 3300026089 | Ga0207648_10228507 | Ga0207648_102285073 | 143 |
| 138 | 3300026095 | Ga0207676_10838602 | Ga0207676_108386021 | 143 |
| 139 | 3300026118 | Ga0207675_100056881 | Ga0207675_1000568816 | 143 |
| 140 | 3300026118 | Ga0207675_100601256 | Ga0207675_1006012562 | 143 |
| 141 | 3300026118 | Ga0207675_102732070 | Ga0207675_1027320701 | 143 |
| 142 | 3300026121 | Ga0207683_10809657 | Ga0207683_108096571 | 143 |
| 143 | 3300026121 | Ga0207683_11364146 | Ga0207683_113641461 | 143 |
| 144 | 3300026121 | Ga0207683_11893759 | Ga0207683_118937591 | 143 |
| 145 | 3300026142 | Ga0207698_10800892 | Ga0207698_108008922 | 143 |
| 146 | 3300027907 | Ga0207428_10010401 | Ga0207428_100104015 | 143 |
| 147 | 3300027907 | Ga0207428_10015529 | Ga0207428_100155292 | 143 |
| 148 | 3300027907 | Ga0207428_10346243 | Ga0207428_103462432 | 143 |
| 149 | 3300028379 | Ga0268266_10800763 | Ga0268266_108007632 | 143 |
| 150 | 3300028381 | Ga0268264_11297354 | Ga0268264_112973541 | 143 |
| 151 | 3300028573 | Ga0265334_10135517 | Ga0265334_101355171 | 143 |
| 152 | 3300031691 | Ga0316579_10035156 | Ga0316579_100351561 | 143 |
| 153 | 3300031728 | Ga0316578_10149521 | Ga0316578_101495212 | 143 |
| 154 | 3300031731 | Ga0307405_10876461 | Ga0307405_108764612 | 143 |
| 155 | 3300031731 | Ga0307405_11420422 | Ga0307405_114204222 | 143 |
| 156 | 3300031852 | Ga0307410_10007909 | Ga0307410_100079092 | 143 |
| 157 | 3300031901 | Ga0307406_10208757 | Ga0307406_102087571 | 143 |
| 158 | 3300031901 | Ga0307406_10758265 | Ga0307406_107582651 | 143 |
| 159 | 3300031911 | Ga0307412_10022657 | Ga0307412_100226572 | 143 |
| 160 | 3300031911 | Ga0307412_10250052 | Ga0307412_102500521 | 143 |
| 161 | 3300031995 | Ga0307409_100326411 | Ga0307409_1003264111 | 143 |
| 162 | 3300032002 | Ga0307416_100034840 | Ga0307416_1000348402 | 143 |
| 163 | 3300032126 | Ga0307415_100039302 | Ga0307415_1000393022 | 143 |
| 164 | 3300032133 | Ga0316583_10068943 | Ga0316583_100689431 | 143 |
| 165 | 3300035086 | Ga0373934_0063345 | Ga0373934_0063345_737_1177 | 143 |
| 166 | 3300035111 | Ga0373923_0073858 | Ga0373923_0073858_13_453 | 143 |
| 167 | 3300035113 | Ga0373936_0072765 | Ga0373936_0072765_910_1350 | 143 |
| 168 | 3300035171 | Ga0373946_0037378 | Ga0373946_0037378_371_811 | 143 |
| 169 | 3300035692 | Ga0373935_0056378 | Ga0373935_0056378_1086_1526 | 143 |
| 170 | 3300035695 | Ga0373927_0186307 | Ga0373927_0186307_459_899 | 143 |
| 171 | 3300035724 | Ga0373933_0201098 | Ga0373933_0201098_152_592 | 143 |
| 172 | 3300035725 | Ga0373947_0032554 | Ga0373947_0032554_641_1081 | 143 |
| 173 | 3300036401 | Ga0373937_0206256 | Ga0373937_0206256_155_595 | 143 |
| 174 | 3300036647 | Ga0316582_0040327 | Ga0316582_0040327_525_965 | 143 |
| 175 | 3300037068 | Ga0373925_0021829 | Ga0373925_0021829_1082_1522 | 143 |
| 176 | 3300037068 | Ga0373925_0151352 | Ga0373925_0151352_103_543 | 143 |
| 177 | 3300037312 | Ga0395899_0032403 | Ga0395899_0032403_1612_2115 | 143 |
| 178 | 3300037418 | Ga0395900_0026436 | Ga0395900_0026436_851_1354 | 143 |
| 179 | 3300037466 | Ga0395898_0339508 | Ga0395898_0339508_964_1404 | 143 |
| 180 | 3300037471 | Ga0395905_0027098 | Ga0395905_0027098_442_960 | 143 |
| 181 | 3300037471 | Ga0395905_0212228 | Ga0395905_0212228_1294_1797 | 143 |
| 182 | 3300037471 | Ga0395905_0258318 | Ga0395905_0258318_868_1308 | 143 |
| 183 | 3300037471 | Ga0395905_0685540 | Ga0395905_0685540_343_801 | 143 |
| 184 | 3300037588 | Ga0316581_0011059 | Ga0316581_0011059_457_897 | 143 |
| 185 | 3300038443 | Ga0395901_0021158 | Ga0395901_0021158_546_1049 | 143 |
| 186 | 3300041453 | Ga0451797_0366004 | Ga0451797_0366004_85_528 | 143 |
| 187 | 3300041460 | Ga0451802_1857936 | Ga0451802_1857936_205_648 | 143 |
| 188 | 3300041999 | Ga0439433_0024533 | Ga0439433_0024533_540_1088 | 143 |
| 189 | 3300042007 | Ga0439449_0000321 | Ga0439449_0000321_14730_15278 | 143 |
| 190 | 3300042015 | Ga0439462_0001735 | Ga0439462_0001735_592_1140 | 143 |
| 191 | 3300042530 | Ga0450916_098106 | Ga0450916_098106_60_500 | 143 |
| 192 | 3300044656 | Ga0466969_0006597 | Ga0466969_0006597_5047_5520 | 143 |
| 193 | 3300044656 | Ga0466969_0521117 | Ga0466969_0521117_46_513 | 143 |
| 194 | 3300044684 | Ga0466966_0034332 | Ga0466966_0034332_1514_1987 | 143 |
| 195 | 3300044684 | Ga0466966_0355095 | Ga0466966_0355095_373_840 | 143 |
| 196 | 3300044693 | Ga0466961_0009434 | Ga0466961_0009434_3609_4082 | 143 |
| 197 | 3300045049 | Ga0466959_0206772 | Ga0466959_0206772_357_830 | 143 |
| 198 | 3300046472 | Ga0495580_0000931 | Ga0495580_0000931_15329_15769 | 143 |
| 199 | 3300046472 | Ga0495580_0041262 | Ga0495580_0041262_814_1254 | 143 |
| 200 | 3300046507 | Ga0495606_0300574 | Ga0495606_0300574_335_781 | 143 |
| 201 | 3300046528 | Ga0495642_0011550 | Ga0495642_0011550_1043_1516 | 143 |
| 202 | 3300046528 | Ga0495642_0266034 | Ga0495642_0266034_181_627 | 143 |
| 203 | 3300046528 | Ga0495642_0368627 | Ga0495642_0368627_168_614 | 143 |
| 204 | 3300046539 | Ga0495621_0364979 | Ga0495621_0364979_88_528 | 143 |
| 205 | 3300046542 | Ga0495597_0422785 | Ga0495597_0422785_10_456 | 143 |
| 206 | 3300046615 | Ga0495656_0022370 | Ga0495656_0022370_1675_2154 | 143 |
| 207 | 3300046615 | Ga0495656_0202114 | Ga0495656_0202114_248_721 | 143 |
| 208 | 3300046616 | Ga0495668_0004549 | Ga0495668_0004549_6441_6887 | 143 |
| 209 | 3300046660 | Ga0495625_0614690 | Ga0495625_0614690_105_551 | 143 |
| 210 | 3300046674 | Ga0495588_0073837 | Ga0495588_0073837_239_682 | 143 |
| 211 | 3300046674 | Ga0495588_0216575 | Ga0495588_0216575_43_516 | 143 |
| 212 | 3300046683 | Ga0495658_0304603 | Ga0495658_0304603_238_684 | 143 |
| 213 | 3300046684 | Ga0495669_0302272 | Ga0495669_0302272_210_656 | 143 |
| 214 | 3300046684 | Ga0495669_0343676 | Ga0495669_0343676_95_568 | 143 |
| 215 | 3300047445 | Ga0495677_0235967 | Ga0495677_0235967_101_547 | 143 |
| 216 | 3300047447 | Ga0495685_113229 | Ga0495685_113229_403_849 | 143 |
| 217 | 3300048909 | Ga0496106_0634694 | Ga0496106_0634694_130_570 | 143 |
| 218 | 3300048911 | Ga0496108_0810944 | Ga0496108_0810944_219_659 | 143 |
| 219 | 3300048917 | Ga0496114_1047719 | Ga0496114_1047719_207_647 | 143 |
| 220 | 3300049686 | Ga0501257_080584 | Ga0501257_080584_211_654 | 143 |
| 221 | 3300050508 | nmdc:mga09592_245849_c1 | nmdc:mga09592_245849_c1_1077_1517 | 143 |
| 222 | 3300050508 | nmdc:mga09592_717564_c1 | nmdc:mga09592_717564_c1_360_800 | 143 |
| 223 | 3300050509 | nmdc:mga0qj67_543545_c1 | nmdc:mga0qj67_543545_c1_340_780 | 143 |
| 224 | 3300050511 | nmdc:mga08y16_124671_c1 | nmdc:mga08y16_124671_c1_1956_2396 | 143 |
| 225 | 3300050511 | nmdc:mga08y16_20850_c1 | nmdc:mga08y16_20850_c1_2018_2458 | 143 |
| 226 | 3300050511 | nmdc:mga08y16_22927_c1 | nmdc:mga08y16_22927_c1_5253_5693 | 143 |
| 227 | 3300050515 | nmdc:mga0a205_169797_c1 | nmdc:mga0a205_169797_c1_282_722 | 143 |
| 228 | 3300053118 | Ga0500594_0267651 | Ga0500594_0267651_78_524 | 143 |
| 229 | 3300054114 | Ga0501084_1116558 | Ga0501084_1116558_73_513 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oa2-assembly1.cif.gz_A-2 | crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution | 0.9475 | 33 | 107 |
| 8awn-assembly1.cif.gz_A-2 | crystal structure of a manganese-containing cupin (tm1459) from thermotoga maritima, variant c106q | 0.9289 | 4 | 107 |
| 3fjs-assembly2.cif.gz_D | crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution | 0.9286 | 22 | 107 |
| 6l2e-assembly1.cif.gz_B | crystal structure of a cupin protein (tm1459, h52a mutant) in copper (cu) substituted form | 0.9238 | 4 | 106 |
| 8hjy-assembly1.cif.gz_B | crystal structure of a cupin protein (tm1459, h52a/h58e/f104w mutant) in copper (cu) substituted form | 0.9215 | 3 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9439 | 34 | 105 | 2.60.120.10 |
| 5cu1A00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.916 | 33 | 105 | 2.60.120.10 |
| af_Q54K96_70_313_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.9128 | 34 | 106 | 2.60.120.650 |
| af_A0A1D6JGF3_359_568_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.91 | 34 | 107 | 2.60.120.650 |
| 1gqhB01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9038 | 5 | 117 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B8KU04-F1-model_v4 | Cupin 2, conserved barrel | 0.981 | 17 | 143 |
|
| AF-A0A0Q8LWT7-F1-model_v4 | Cupin | 0.979 | 1 | 143 |
|
| AF-A0A075JVT6-F1-model_v4 | Cupin | 0.9789 | 1 | 143 |
|
| AF-A0A1V5AX55-F1-model_v4 | Cupin domain protein | 0.9733 | 19 | 106 |
|
| AF-A0A0Q8LWT7-F1-model_v4 | Cupin | 0.9723 | 1 | 143 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar