F341990

General Info

Members Datasets Scaffolds Average Seq Length
229 168 458 265

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10481396|Ga0105241_104813962
Length 289
Sequence MMPCLARDYTPHRITRMSAFEPAHSYDTVNLLRKGPAAKVELNRPDTMNAWNRQFGIDLLAAIEAVAADDEVRAVMITGAGRGFSSGADLKEMGTNDDVTPEGRPNVRKTLTERYHPIITTIRRMPKPVVAAVNGPAVGIGLSLALASDLIVAKESAYFLLAFVNIGLVPDGGSSLFVPTRIGMARAAEMSMLGERIPAPQALEWGLINRVFTDDEFASASEQLVDRLAAGPTRSYAGTKRQLNNWLYTRMDEQLELEADIQQEMAGSGDFVEGVTAFVQKRQAAFGGH

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0
Rhizoplane 8.73
Rhizosphere 87.77
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10481396 3300009174 Bacteria 1103
2 Ga0070658_10025316 3300005327 Bacteria 4758
3 Ga0070676_10189275 3300005328 Bacteria 1343
4 Ga0070683_100231486 3300005329 Bacteria 1757
5 Ga0070683_100238759 3300005329 Bacteria 1728
6 Ga0070683_100544208 3300005329 Bacteria 1110
7 Ga0070683_100621748 3300005329 Bacteria 1034
8 Ga0070680_100194445 3300005336 Bacteria 1710
9 Ga0068868_100463007 3300005338 Bacteria 1105
10 Ga0070660_100006364 3300005339 Bacteria 8184
11 Ga0070660_100111071 3300005339 Bacteria 2181
12 Ga0070668_100144044 3300005347 Bacteria 1922
13 Ga0070675_100100976 3300005354 Bacteria 2430
14 Ga0070675_100325743 3300005354 Bacteria 1358
15 Ga0070671_100116434 3300005355 Bacteria 2247
16 Ga0070674_100025875 3300005356 Bacteria 3825
17 Ga0070659_100120006 3300005366 Bacteria 2129
18 Ga0070709_10244589 3300005434 Bacteria 1290
19 Ga0070714_100014097 3300005435 Bacteria 6415
20 Ga0070714_100114856 3300005435 Bacteria 2389
21 Ga0070714_100159400 3300005435 Bacteria 2040
22 Ga0070700_100018993 3300005441 Bacteria 3962
23 Ga0070708_100056149 3300005445 Bacteria 3502
24 Ga0070663_100174042 3300005455 Bacteria 1665
25 Ga0070678_100310802 3300005456 Bacteria 1343
26 Ga0070681_10032301 3300005458 Bacteria 5252
27 Ga0070707_100039840 3300005468 Bacteria 4493
28 Ga0070698_100021477 3300005471 Bacteria 6761
29 Ga0070679_100125008 3300005530 Bacteria 2555
30 Ga0070679_100192580 3300005530 Bacteria 2007
31 Ga0070684_100096767 3300005535 Bacteria 2632
32 Ga0070684_100171613 3300005535 Bacteria 1970
33 Ga0070697_100107869 3300005536 Unclassified 2317
34 Ga0070697_100202129 3300005536 Bacteria 1689
35 Ga0070672_100070606 3300005543 Bacteria 2775
36 Ga0070664_100119247 3300005564 Bacteria 2309
37 Ga0068857_100035065 3300005577 Bacteria 4441
38 Ga0068856_100266224 3300005614 Bacteria 1730
39 Ga0070702_100182360 3300005615 Bacteria 1375
40 Ga0068864_100165727 3300005618 Bacteria 2011
41 Ga0068861_100033714 3300005719 Bacteria 3780
42 Ga0081455_10022291 3300005937 Bacteria 5922
43 Ga0081455_10144717 3300005937 Bacteria 1841
44 Ga0081538_10002338 3300005981 Bacteria 18695
45 Ga0081539_10012994 3300005985 Bacteria 6326
46 Ga0081539_10024943 3300005985 Bacteria 3865
47 Ga0070717_10213970 3300006028 Bacteria 1692
48 Ga0075432_10089844 3300006058 Bacteria 1123
49 Ga0070716_100173879 3300006173 Bacteria 1408
50 Ga0070712_100004280 3300006175 Bacteria 8789
51 Ga0070712_100038417 3300006175 Bacteria 3271
52 Ga0075428_100206540 3300006844 Bacteria 2123
53 Ga0075433_10007942 3300006852 Bacteria 8445
54 Ga0075434_100000525 3300006871 Bacteria 29189
55 Ga0068865_100472517 3300006881 Bacteria 1040
56 Ga0105245_10147239 3300009098 Bacteria 2223
57 Ga0105245_10250672 3300009098 Bacteria 1720
58 Ga0105245_10268039 3300009098 Bacteria 1664
59 Ga0114129_10027700 3300009147 Bacteria 8023
60 Ga0105243_10028894 3300009148 Bacteria 4260
61 Ga0105243_10046913 3300009148 Bacteria 3400
62 Ga0105243_10121824 3300009148 Bacteria 2200
63 Ga0105242_10343058 3300009176 Unclassified 1377
64 Ga0105242_10385236 3300009176 Bacteria 1304
65 Ga0105248_10323987 3300009177 Bacteria 1736
66 Ga0105237_10005724 3300009545 Bacteria 13971
67 Ga0105249_10227646 3300009553 Bacteria 1838
68 Ga0105033_104310 3300009986 Bacteria 1209
69 Ga0105246_10020681 3300011119 Bacteria 4224
70 Ga0157371_10507502 3300013102 Bacteria 891
71 Ga0157369_10277374 3300013105 Bacteria 1746
72 Ga0157378_10142471 3300013297 Bacteria 2227
73 Ga0157372_10756522 3300013307 Bacteria 1130
74 Ga0163163_10394418 3300014325 Bacteria 1442
75 Ga0157377_10050731 3300014745 Bacteria 2338
76 Ga0157377_10176504 3300014745 Bacteria 1340
77 Ga0157379_10000487 3300014968 Bacteria 32201
78 Ga0157379_10699443 3300014968 Bacteria 951
79 Ga0206353_10824379 3300020082 Bacteria 2172
80 Ga0224712_10007231 3300022467 Bacteria 3220
81 Ga0207426_1062370 3300025302 Bacteria 1067
82 Ga0207692_10060098 3300025898 Bacteria 1964
83 Ga0207688_10010780 3300025901 Bacteria 4975
84 Ga0207688_10042067 3300025901 Bacteria 2543
85 Ga0207647_10034636 3300025904 Bacteria 3222
86 Ga0207699_10007136 3300025906 Bacteria 5450
87 Ga0207699_10184542 3300025906 Bacteria 1404
88 Ga0207645_10064464 3300025907 Bacteria 2341
89 Ga0207705_10003475 3300025909 Bacteria 11984
90 Ga0207707_10004844 3300025912 Bacteria 11808
91 Ga0207671_10012254 3300025914 Bacteria 6907
92 Ga0207693_10012340 3300025915 Bacteria 6903
93 Ga0207693_10021702 3300025915 Bacteria 5104
94 Ga0207693_10080337 3300025915 Bacteria 2553
95 Ga0207693_10126600 3300025915 Bacteria 2008
96 Ga0207663_10086530 3300025916 Bacteria 2067
97 Ga0207663_10168798 3300025916 Bacteria 1552
98 Ga0207657_10003898 3300025919 Bacteria 15832
99 Ga0207657_10052774 3300025919 Bacteria 3527
100 Ga0207652_10005590 3300025921 Bacteria 10192
101 Ga0207652_10114657 3300025921 Bacteria 2393
102 Ga0207646_10115182 3300025922 Bacteria 2414
103 Ga0207646_10304458 3300025922 Bacteria 1440
104 Ga0207694_10482071 3300025924 Bacteria 1037
105 Ga0207659_10276702 3300025926 Bacteria 1371
106 Ga0207687_10183793 3300025927 Bacteria 1621
107 Ga0207700_10275996 3300025928 Bacteria 1444
108 Ga0207664_10071587 3300025929 Bacteria 2793
109 Ga0207664_10175135 3300025929 Bacteria 1839
110 Ga0207706_10062341 3300025933 Bacteria 3283
111 Ga0207686_10211352 3300025934 Bacteria 1395
112 Ga0207709_10066424 3300025935 Bacteria 2272
113 Ga0207704_10071157 3300025938 Bacteria 2206
114 Ga0207665_10049499 3300025939 Bacteria 2824
115 Ga0207691_10036210 3300025940 Bacteria 4572
116 Ga0207661_10041382 3300025944 Bacteria 3627
117 Ga0207661_10172518 3300025944 Bacteria 1883
118 Ga0207661_10303394 3300025944 Bacteria 1432
119 Ga0207661_10636568 3300025944 Bacteria 980
120 Ga0207712_10480189 3300025961 Bacteria 1059
121 Ga0207668_10186384 3300025972 Bacteria 1641
122 Ga0207677_10561911 3300026023 Bacteria 996
123 Ga0207678_10046035 3300026067 Bacteria 3773
124 Ga0207708_10016839 3300026075 Bacteria 5503
125 Ga0207702_10308289 3300026078 Bacteria 1504
126 Ga0207676_10121370 3300026095 Bacteria 2205
127 Ga0207674_10019653 3300026116 Bacteria 7315
128 Ga0207674_10045173 3300026116 Bacteria 4533
129 Ga0207674_10278854 3300026116 Bacteria 1619
130 Ga0207675_100074198 3300026118 Bacteria 3183
131 Ga0207675_100655217 3300026118 Bacteria 1056
132 Ga0207428_10068971 3300027907 Bacteria 2780
133 Ga0268265_10771613 3300028380 Bacteria 935
134 Ga0265338_10008683 3300028800 Bacteria 12291
135 Ga0265338_10009550 3300028800 Bacteria 11544
136 Ga0265327_10017941 3300031251 Bacteria 4412
137 Ga0307408_100465189 3300031548 Bacteria 1100
138 Ga0307405_10303806 3300031731 Bacteria 1212
139 Ga0307413_10115018 3300031824 Bacteria 1809
140 Ga0307406_10062350 3300031901 Bacteria 2412
141 Ga0307409_100007001 3300031995 Bacteria 6701
142 Ga0307409_100375030 3300031995 Bacteria 1350
143 Ga0307409_100808205 3300031995 Bacteria 946
144 Ga0307416_100332330 3300032002 Bacteria 1528
145 Ga0307416_100472099 3300032002 Bacteria 1312
146 Ga0316216_1002514 3300033548 Bacteria 1306
147 Ga0373934_0021747 3300035086 Bacteria 2472
148 Ga0373953_0005309 3300035117 Bacteria 4170
149 Ga0373956_0009322 3300035119 Bacteria 3991
150 Ga0373957_0041090 3300035120 Bacteria 1740
151 Ga0373961_0089047 3300035241 Unclassified 983
152 Ga0373924_0029882 3300035410 Bacteria 2181
153 Ga0373935_0097228 3300035692 Bacteria 1936
154 Ga0373933_0006596 3300035724 Bacteria 6325
155 Ga0373933_0369450 3300035724 Bacteria 933
156 Ga0373925_0000001 3300037068 Bacteria 402692
157 Ga0373925_0129848 3300037068 Bacteria 1964
158 Ga0395898_0100613 3300037466 Bacteria 2776
159 Ga0395898_0236566 3300037466 Bacteria 1742
160 Ga0395898_0368228 3300037466 Bacteria 1370
161 Ga0395901_0081257 3300038443 Bacteria 3385
162 Ga0395901_0348708 3300038443 Bacteria 1528
163 Ga0395901_0548408 3300038443 Bacteria 1172
164 Ga0466963_0042279 3300044694 Bacteria 2992
165 Ga0466963_0139034 3300044694 Bacteria 1681
166 Ga0466963_0169809 3300044694 Bacteria 1520
167 Ga0466957_0049877 3300044842 Bacteria 2546
168 Ga0466957_0102863 3300044842 Bacteria 1802
169 Ga0466958_0322311 3300045836 Bacteria 993
170 Ga0466967_0005108 3300045976 Bacteria 9017
171 Ga0466967_0020743 3300045976 Bacteria 5320
172 Ga0495603_0210356 3300046455 Bacteria 1123
173 Ga0495651_0013676 3300046462 Bacteria 6271
174 Ga0495650_0000035 3300046471 Bacteria 403799
175 Ga0495580_0190492 3300046472 Bacteria 1414
176 Ga0495608_0161350 3300046511 Bacteria 1425
177 Ga0495628_0377443 3300046516 Bacteria 1039
178 Ga0495630_0221268 3300046517 Bacteria 1445
179 Ga0495586_0245480 3300046535 Bacteria 1021
180 Ga0495645_0077069 3300046543 Bacteria 2397
181 Ga0495667_0085228 3300046559 Bacteria 2050
182 Ga0495634_0053901 3300046642 Bacteria 2692
183 Ga0495635_0023733 3300046663 Bacteria 4273
184 Ga0495623_0109826 3300046679 Bacteria 1673
185 Ga0495646_0079427 3300046680 Bacteria 1915
186 Ga0495600_0013991 3300046809 Bacteria 5056
187 Ga0495674_0022967 3300047319 Bacteria 5746
188 Ga0495676_0012422 3300047321 Bacteria 7672
189 Ga0496102_0000002 3300048905 Bacteria 814588
190 Ga0496103_0000303 3300048906 Bacteria 45367
191 Ga0496103_0111939 3300048906 Bacteria 1734
192 Ga0496104_0008603 3300048907 Bacteria 9076
193 Ga0496104_0347943 3300048907 Bacteria 1395
194 Ga0496105_0101046 3300048908 Bacteria 2381
195 Ga0496105_0195036 3300048908 Bacteria 1655
196 Ga0496106_0000614 3300048909 Bacteria 25472
197 Ga0496106_0441451 3300048909 Bacteria 1046
198 Ga0496107_0111207 3300048910 Bacteria 2013
199 Ga0496107_0271644 3300048910 Bacteria 1262
200 Ga0496108_0074840 3300048911 Bacteria 2860
201 Ga0496108_0186544 3300048911 Bacteria 1797
202 Ga0496110_0658065 3300048913 Bacteria 948
203 Ga0496111_0124114 3300048914 Bacteria 1908
204 Ga0496111_0307864 3300048914 Bacteria 1174
205 Ga0496112_0132570 3300048915 Bacteria 2462
206 Ga0496112_0177345 3300048915 Bacteria 2095
207 Ga0496113_0007907 3300048916 Bacteria 6882
208 Ga0496115_0477406 3300048918 Bacteria 1004
209 Ga0496119_0042657 3300048922 Bacteria 2875
210 Ga0496123_0160385 3300048926 Bacteria 1200
211 Ga0496126_0150582 3300048929 Bacteria 1994
212 Ga0496126_0174650 3300048929 Bacteria 1828
213 Ga0501034_0013734 3300049571 Bacteria 8330
214 Ga0501074_0125437 3300049590 Bacteria 1836
215 Ga0501074_0170923 3300049590 Bacteria 1551
216 Ga0501075_0395647 3300049591 Bacteria 1053
217 Ga0501080_0033106 3300049742 Bacteria 4824
218 Ga0501081_0320172 3300049743 Bacteria 1140
219 nmdc:mga06z11_392970_c1 3300050494 Bacteria 834
220 nmdc:mga05p37_3040_c1 3300050507 Bacteria 19471
221 nmdc:mga0qj67_423580_c1 3300050509 Bacteria 1073
222 nmdc:mga0n895_274_c1 3300050512 Bacteria 33774
223 nmdc:mga0rr50_271912_c1 3300050513 Bacteria 1412
224 nmdc:mga0a205_16014_c1 3300050515 Bacteria 7017
225 Ga0495601_0022287 3300053077 Bacteria 3887
226 Ga0495601_0064518 3300053077 Bacteria 2329
227 Ga0495619_0057811 3300053085 Bacteria 2574
228 Ga0500616_0003052 3300053153 Bacteria 13174
229 Ga0530510_0095242 3300061734 Bacteria 2175
230 Ga0105241_10481396
231 Ga0070658_10025316
232 Ga0070676_10189275
233 Ga0070683_100231486
234 Ga0070683_100238759
235 Ga0070683_100544208
236 Ga0070683_100621748
237 Ga0070680_100194445
238 Ga0068868_100463007
239 Ga0070660_100006364
240 Ga0070660_100111071
241 Ga0070668_100144044
242 Ga0070675_100100976
243 Ga0070675_100325743
244 Ga0070671_100116434
245 Ga0070674_100025875
246 Ga0070659_100120006
247 Ga0070709_10244589
248 Ga0070714_100014097
249 Ga0070714_100114856
250 Ga0070714_100159400
251 Ga0070700_100018993
252 Ga0070708_100056149
253 Ga0070663_100174042
254 Ga0070678_100310802
255 Ga0070681_10032301
256 Ga0070707_100039840
257 Ga0070698_100021477
258 Ga0070679_100125008
259 Ga0070679_100192580
260 Ga0070684_100096767
261 Ga0070684_100171613
262 Ga0070697_100107869
263 Ga0070697_100202129
264 Ga0070672_100070606
265 Ga0070664_100119247
266 Ga0068857_100035065
267 Ga0068856_100266224
268 Ga0070702_100182360
269 Ga0068864_100165727
270 Ga0068861_100033714
271 Ga0081455_10022291
272 Ga0081455_10144717
273 Ga0081538_10002338
274 Ga0081539_10012994
275 Ga0081539_10024943
276 Ga0070717_10213970
277 Ga0075432_10089844
278 Ga0070716_100173879
279 Ga0070712_100004280
280 Ga0070712_100038417
281 Ga0075428_100206540
282 Ga0075433_10007942
283 Ga0075434_100000525
284 Ga0068865_100472517
285 Ga0105245_10147239
286 Ga0105245_10250672
287 Ga0105245_10268039
288 Ga0114129_10027700
289 Ga0105243_10028894
290 Ga0105243_10046913
291 Ga0105243_10121824
292 Ga0105242_10343058
293 Ga0105242_10385236
294 Ga0105248_10323987
295 Ga0105237_10005724
296 Ga0105249_10227646
297 Ga0105033_104310
298 Ga0105246_10020681
299 Ga0157371_10507502
300 Ga0157369_10277374
301 Ga0157378_10142471
302 Ga0157372_10756522
303 Ga0163163_10394418
304 Ga0157377_10050731
305 Ga0157377_10176504
306 Ga0157379_10000487
307 Ga0157379_10699443
308 Ga0206353_10824379
309 Ga0224712_10007231
310 Ga0207426_1062370
311 Ga0207692_10060098
312 Ga0207688_10010780
313 Ga0207688_10042067
314 Ga0207647_10034636
315 Ga0207699_10007136
316 Ga0207699_10184542
317 Ga0207645_10064464
318 Ga0207705_10003475
319 Ga0207707_10004844
320 Ga0207671_10012254
321 Ga0207693_10012340
322 Ga0207693_10021702
323 Ga0207693_10080337
324 Ga0207693_10126600
325 Ga0207663_10086530
326 Ga0207663_10168798
327 Ga0207657_10003898
328 Ga0207657_10052774
329 Ga0207652_10005590
330 Ga0207652_10114657
331 Ga0207646_10115182
332 Ga0207646_10304458
333 Ga0207694_10482071
334 Ga0207659_10276702
335 Ga0207687_10183793
336 Ga0207700_10275996
337 Ga0207664_10071587
338 Ga0207664_10175135
339 Ga0207706_10062341
340 Ga0207686_10211352
341 Ga0207709_10066424
342 Ga0207704_10071157
343 Ga0207665_10049499
344 Ga0207691_10036210
345 Ga0207661_10041382
346 Ga0207661_10172518
347 Ga0207661_10303394
348 Ga0207661_10636568
349 Ga0207712_10480189
350 Ga0207668_10186384
351 Ga0207677_10561911
352 Ga0207678_10046035
353 Ga0207708_10016839
354 Ga0207702_10308289
355 Ga0207676_10121370
356 Ga0207674_10019653
357 Ga0207674_10045173
358 Ga0207674_10278854
359 Ga0207675_100074198
360 Ga0207675_100655217
361 Ga0207428_10068971
362 Ga0268265_10771613
363 Ga0265338_10008683
364 Ga0265338_10009550
365 Ga0265327_10017941
366 Ga0307408_100465189
367 Ga0307405_10303806
368 Ga0307413_10115018
369 Ga0307406_10062350
370 Ga0307409_100007001
371 Ga0307409_100375030
372 Ga0307409_100808205
373 Ga0307416_100332330
374 Ga0307416_100472099
375 Ga0316216_1002514
376 Ga0373934_0021747
377 Ga0373953_0005309
378 Ga0373956_0009322
379 Ga0373957_0041090
380 Ga0373961_0089047
381 Ga0373924_0029882
382 Ga0373935_0097228
383 Ga0373933_0006596
384 Ga0373933_0369450
385 Ga0373925_0000001
386 Ga0373925_0129848
387 Ga0395898_0100613
388 Ga0395898_0236566
389 Ga0395898_0368228
390 Ga0395901_0081257
391 Ga0395901_0348708
392 Ga0395901_0548408
393 Ga0466963_0042279
394 Ga0466963_0139034
395 Ga0466963_0169809
396 Ga0466957_0049877
397 Ga0466957_0102863
398 Ga0466958_0322311
399 Ga0466967_0005108
400 Ga0466967_0020743
401 Ga0495603_0210356
402 Ga0495651_0013676
403 Ga0495650_0000035
404 Ga0495580_0190492
405 Ga0495608_0161350
406 Ga0495628_0377443
407 Ga0495630_0221268
408 Ga0495586_0245480
409 Ga0495645_0077069
410 Ga0495667_0085228
411 Ga0495634_0053901
412 Ga0495635_0023733
413 Ga0495623_0109826
414 Ga0495646_0079427
415 Ga0495600_0013991
416 Ga0495674_0022967
417 Ga0495676_0012422
418 Ga0496102_0000002
419 Ga0496103_0000303
420 Ga0496103_0111939
421 Ga0496104_0008603
422 Ga0496104_0347943
423 Ga0496105_0101046
424 Ga0496105_0195036
425 Ga0496106_0000614
426 Ga0496106_0441451
427 Ga0496107_0111207
428 Ga0496107_0271644
429 Ga0496108_0074840
430 Ga0496108_0186544
431 Ga0496110_0658065
432 Ga0496111_0124114
433 Ga0496111_0307864
434 Ga0496112_0132570
435 Ga0496112_0177345
436 Ga0496113_0007907
437 Ga0496115_0477406
438 Ga0496119_0042657
439 Ga0496123_0160385
440 Ga0496126_0150582
441 Ga0496126_0174650
442 Ga0501034_0013734
443 Ga0501074_0125437
444 Ga0501074_0170923
445 Ga0501075_0395647
446 Ga0501080_0033106
447 Ga0501081_0320172
448 nmdc:mga06z11_392970_c1
449 nmdc:mga05p37_3040_c1
450 nmdc:mga0qj67_423580_c1
451 nmdc:mga0n895_274_c1
452 nmdc:mga0rr50_271912_c1
453 nmdc:mga0a205_16014_c1
454 Ga0495601_0022287
455 Ga0495601_0064518
456 Ga0495619_0057811
457 Ga0500616_0003052
458 Ga0530510_0095242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

33

289

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

37

247

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lk5-assembly1.cif.gz_A crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9565 7 259
4lk5-assembly1.cif.gz_A crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9488 7 259
4lk5-assembly1.cif.gz_B crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9429 7 269
4lk5-assembly1.cif.gz_C crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9403 8 269
3p5m-assembly1.cif.gz_D crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.9396 8 271
ID Description Score Start End Superfamily
2ej5A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9632 8 213 3.90.226.10
2ej5A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9583 8 213 3.90.226.10
3p5mE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9539 215 271 1.10.12.10
4lk5A00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.953 7 259 3.90.226.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9472 12 213 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A1F8PRL7-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.9687 8 269 GO:0003824
AF-A0A1F8PRL7-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.965 8 269 GO:0003824
AF-A0A173LJH8-F1-model_v4 Putative enoyl-CoA hydratase echA12 0.9609 10 268
AF-A0A7J3S1L9-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein 0.9574 8 271 GO:0003857
GO:0004300
GO:0005777
GO:0006635
GO:0070403
AF-A0A0D5AGL4-F1-model_v4 deleted 0.956 11 271

Map