F341601

General Info

Members Datasets Scaffolds Average Seq Length
229 134 229 142

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10002531|JGI25407J50210_100025315
Length 146
Sequence MSEPNVPLETRTTKAEQLAERYTAVWMEPDANRRRRMIAELWSEDAIHILQPTQEVYEAADERAVNPTWQVRGHDELEGRVTSAYEDFVATGQMAFRARPGAKRLGDVVTWRWEGVSPDGEVLGAGLEFVILAADGRIATDYQFVE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
80 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
81 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
82 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
83 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
84 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
85 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
86 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
89 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
90 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
91 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.68
Nodule 0
Rhizoplane 2.18
Rhizosphere 91.7
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10063962 3300003203 Bacteria 1177
2 JGI25407J50210_10002531 3300003373 Bacteria 4317
3 JGI25407J50210_10014465 3300003373 Bacteria 2033
4 JGI25407J50210_10048995 3300003373 Bacteria 1072
5 JGI25407J50210_10051591 3300003373 Unclassified 1042
6 Ga0070658_10990492 3300005327 Bacteria 731
7 Ga0070683_100569796 3300005329 Bacteria 1083
8 Ga0070683_100988205 3300005329 Bacteria 808
9 Ga0070683_102442865 3300005329 Unclassified 501
10 Ga0070670_101894763 3300005331 Bacteria 549
11 Ga0068868_101424234 3300005338 Unclassified 647
12 Ga0070661_101519748 3300005344 Bacteria 565
13 Ga0070668_101744832 3300005347 Bacteria 572
14 Ga0070710_10043621 3300005437 Bacteria 2485
15 Ga0070711_100182011 3300005439 Bacteria 1609
16 Ga0070662_100621725 3300005457 Bacteria 910
17 Ga0070662_101112965 3300005457 Unclassified 678
18 Ga0070699_100239071 3300005518 Unclassified 1620
19 Ga0070684_100254661 3300005535 Bacteria 1605
20 Ga0070684_101080356 3300005535 Bacteria 754
21 Ga0070686_101234735 3300005544 Bacteria 622
22 Ga0068856_101311701 3300005614 Bacteria 739
23 Ga0068859_100819882 3300005617 Bacteria 1017
24 Ga0068861_100753890 3300005719 Bacteria 910
25 Ga0068870_10542599 3300005840 Bacteria 782
26 Ga0068870_10917575 3300005840 Bacteria 620
27 Ga0068860_100101567 3300005843 Unclassified 2744
28 Ga0068860_101044058 3300005843 Bacteria 836
29 Ga0081455_10033341 3300005937 Bacteria 4628
30 Ga0081455_10048858 3300005937 Bacteria 3651
31 Ga0081538_10000141 3300005981 Bacteria 74085
32 Ga0081538_10000457 3300005981 Bacteria 45671
33 Ga0081538_10002623 3300005981 Bacteria 17376
34 Ga0081538_10004261 3300005981 Bacteria 13256
35 Ga0081538_10005228 3300005981 Bacteria 11730
36 Ga0081538_10010482 3300005981 Bacteria 7602
37 Ga0081538_10011393 3300005981 Bacteria 7205
38 Ga0081538_10026831 3300005981 Bacteria 4015
39 Ga0081538_10028764 3300005981 Bacteria 3813
40 Ga0081538_10059164 3300005981 Bacteria 2215
41 Ga0081538_10102478 3300005981 Bacteria 1435
42 Ga0081538_10131591 3300005981 Bacteria 1174
43 Ga0081538_10145526 3300005981 Unclassified 1084
44 Ga0081538_10160982 3300005981 Unclassified 998
45 Ga0081538_10278936 3300005981 Bacteria 622
46 Ga0081540_1025984 3300005983 Bacteria 3354
47 Ga0081539_10005950 3300005985 Bacteria 12028
48 Ga0075365_10092134 3300006038 Bacteria 2066
49 Ga0075365_10108787 3300006038 Bacteria 1903
50 Ga0075365_10126117 3300006038 Bacteria 1769
51 Ga0075365_10478565 3300006038 Bacteria 880
52 Ga0075363_100189437 3300006048 Bacteria 1173
53 Ga0075363_100731049 3300006048 Bacteria 599
54 Ga0075364_10170372 3300006051 Bacteria 1472
55 Ga0075364_10812589 3300006051 Bacteria 637
56 Ga0075432_10383533 3300006058 Unclassified 603
57 Ga0070712_100023518 3300006175 Bacteria 4072
58 Ga0070712_100423386 3300006175 Bacteria 1104
59 Ga0075428_100123330 3300006844 Bacteria 2820
60 Ga0075428_100189364 3300006844 Bacteria 2225
61 Ga0075428_101902279 3300006844 Unclassified 618
62 Ga0075431_100266655 3300006847 Bacteria 1736
63 Ga0075434_101290441 3300006871 Bacteria 741
64 Ga0097620_100819874 3300006931 Bacteria 1017
65 Ga0111539_10194733 3300009094 Bacteria 2364
66 Ga0111539_11166965 3300009094 Bacteria 895
67 Ga0105245_10253549 3300009098 Bacteria 1710
68 Ga0105245_10751220 3300009098 Bacteria 1011
69 Ga0114129_10303723 3300009147 Bacteria 2126
70 Ga0114129_10398417 3300009147 Bacteria 1814
71 Ga0114129_11672317 3300009147 Bacteria 777
72 Ga0105243_12553592 3300009148 Unclassified 550
73 Ga0105241_10800120 3300009174 Bacteria 868
74 Ga0105249_10855257 3300009553 Bacteria 975
75 Ga0105239_11734071 3300010375 Bacteria 723
76 Ga0157372_11860046 3300013307 Bacteria 692
77 Ga0157372_12141727 3300013307 Bacteria 642
78 Ga0157375_10034706 3300013308 Bacteria 4808
79 Ga0157377_10125296 3300014745 Bacteria 1562
80 Ga0207692_10058806 3300025898 Bacteria 1982
81 Ga0207692_10330961 3300025898 Bacteria 934
82 Ga0207688_10363868 3300025901 Bacteria 893
83 Ga0207643_10183967 3300025908 Bacteria 1266
84 Ga0207693_10036658 3300025915 Bacteria 3866
85 Ga0207693_10146301 3300025915 Bacteria 1858
86 Ga0207663_10149724 3300025916 Bacteria 1636
87 Ga0207657_10278015 3300025919 Bacteria 1330
88 Ga0207687_10276112 3300025927 Bacteria 1345
89 Ga0207687_10940295 3300025927 Archaea 740
90 Ga0207706_10794341 3300025933 Bacteria 804
91 Ga0207669_11698798 3300025937 Unclassified 539
92 Ga0207661_10947901 3300025944 Bacteria 793
93 Ga0207679_10688977 3300025945 Bacteria 927
94 Ga0207712_11892154 3300025961 Bacteria 534
95 Ga0207668_11854851 3300025972 Bacteria 544
96 Ga0207677_11188226 3300026023 Unclassified 698
97 Ga0207703_10903091 3300026035 Bacteria 846
98 Ga0207678_10792025 3300026067 Bacteria 837
99 Ga0207708_10141626 3300026075 Bacteria 1887
100 Ga0207708_10341139 3300026075 Bacteria 1227
101 Ga0207675_100380807 3300026118 Bacteria 1387
102 Ga0207428_10288013 3300027907 Unclassified 1218
103 Ga0268265_10069322 3300028380 Bacteria 2738
104 Ga0268264_10086959 3300028381 Unclassified 2687
105 Ga0268264_10683672 3300028381 Bacteria 1018
106 Ga0307405_10080041 3300031731 Bacteria 2132
107 Ga0307413_10504311 3300031824 Bacteria 972
108 Ga0307413_11135585 3300031824 Bacteria 676
109 Ga0307406_10021282 3300031901 Bacteria 3834
110 Ga0307406_10437244 3300031901 Bacteria 1046
111 Ga0307406_10644840 3300031901 Bacteria 878
112 Ga0307406_11703649 3300031901 Bacteria 559
113 Ga0307407_10715957 3300031903 Archaea 755
114 Ga0307412_10203510 3300031911 Bacteria 1505
115 Ga0307409_100109702 3300031995 Bacteria 2311
116 Ga0307409_100313054 3300031995 Bacteria 1466
117 Ga0307409_100819646 3300031995 Bacteria 939
118 Ga0307416_100182769 3300032002 Bacteria 1967
119 Ga0307416_100267379 3300032002 Bacteria 1676
120 Ga0307416_100809286 3300032002 Bacteria 1033
121 Ga0307416_101079534 3300032002 Archaea 907
122 Ga0307416_101469334 3300032002 Bacteria 787
123 Ga0307416_101535742 3300032002 Bacteria 771
124 Ga0307414_11496146 3300032004 Unclassified 628
125 Ga0307411_11246723 3300032005 Unclassified 676
126 Ga0307415_100026684 3300032126 Bacteria 3648
127 Ga0307415_100042708 3300032126 Bacteria 3019
128 Ga0307415_100171720 3300032126 Bacteria 1691
129 Ga0307415_100180877 3300032126 Bacteria 1654
130 Ga0307415_100532893 3300032126 Bacteria 1033
131 Ga0307415_100999430 3300032126 Bacteria 777
132 Ga0307415_101655435 3300032126 Bacteria 616
133 Ga0395900_1348705 3300037418 Unclassified 627
134 Ga0395898_0069749 3300037466 Bacteria 3400
135 Ga0395898_0214457 3300037466 Bacteria 1836
136 Ga0395898_0228629 3300037466 Bacteria 1774
137 Ga0395905_0114847 3300037471 Bacteria 2530
138 Ga0395905_0249288 3300037471 Bacteria 1659
139 Ga0395905_0544314 3300037471 Bacteria 1062
140 Ga0395901_0098150 3300038443 Bacteria 3071
141 Ga0395901_0487380 3300038443 Bacteria 1257
142 Ga0395901_0708660 3300038443 Bacteria 1003
143 Ga0395901_0995998 3300038443 Bacteria 814
144 Ga0395901_1539518 3300038443 Unclassified 620
145 Ga0451853_2987067 3300041512 Unclassified 540
146 Ga0439448_0107301 3300042005 Bacteria 952
147 Ga0439448_0266787 3300042005 Unclassified 606
148 Ga0439450_118900 3300042008 Bacteria 680
149 Ga0439451_006703 3300042009 Bacteria 2355
150 Ga0439454_002648 3300042011 Bacteria 1914
151 Ga0439463_015788 3300042016 Bacteria 1867
152 Ga0439463_186339 3300042016 Unclassified 539
153 Ga0439464_0045801 3300042439 Bacteria 1256
154 Ga0439464_0137071 3300042439 Bacteria 760
155 Ga0439460_0121211 3300042461 Bacteria 856
156 Ga0439440_0203521 3300042993 Unclassified 588
157 Ga0495590_0171912 3300046457 Bacteria 790
158 Ga0495596_0125784 3300046500 Bacteria 995
159 Ga0495644_0061860 3300046523 Bacteria 1407
160 Ga0495663_0233985 3300046525 Bacteria 649
161 Ga0495663_0332797 3300046525 Unclassified 551
162 Ga0495656_0167918 3300046615 Bacteria 1071
163 Ga0495625_0088105 3300046660 Bacteria 2151
164 Ga0495659_0052166 3300046664 Bacteria 1492
165 Ga0495670_0470240 3300046691 Bacteria 682
166 Ga0495671_0243911 3300046692 Bacteria 868
167 Ga0495649_0602892 3300046694 Bacteria 542
168 Ga0495636_0521989 3300047318 Unclassified 576
169 Ga0496107_0757403 3300048910 Bacteria 712
170 Ga0496109_1702010 3300048912 Bacteria 564
171 Ga0496112_0887616 3300048915 Bacteria 814
172 Ga0496113_0177981 3300048916 Bacteria 1686
173 Ga0496115_1078537 3300048918 Unclassified 610
174 Ga0501036_0085212 3300049572 Bacteria 2671
175 Ga0501036_0945637 3300049572 Bacteria 706
176 Ga0501037_0157350 3300049573 Bacteria 1621
177 Ga0501037_0205593 3300049573 Bacteria 1390
178 Ga0501038_0885164 3300049574 Unclassified 660
179 Ga0501039_0682957 3300049575 Bacteria 803
180 Ga0501040_0052406 3300049576 Bacteria 2793
181 Ga0501040_0326819 3300049576 Bacteria 1097
182 Ga0501041_0055590 3300049577 Bacteria 2417
183 Ga0501041_0226533 3300049577 Bacteria 1173
184 Ga0501042_0138975 3300049578 Bacteria 1751
185 Ga0501042_0198101 3300049578 Bacteria 1448
186 Ga0501042_0382528 3300049578 Bacteria 1019
187 Ga0501043_0602616 3300049579 Bacteria 811
188 Ga0501046_0300474 3300049580 Bacteria 1172
189 Ga0501048_0050561 3300049582 Bacteria 2960
190 Ga0501071_0056127 3300049587 Bacteria 2844
191 Ga0501071_0280749 3300049587 Bacteria 1260
192 Ga0501072_0009011 3300049588 Bacteria 7586
193 Ga0501072_0091328 3300049588 Bacteria 2418
194 Ga0501072_0103484 3300049588 Bacteria 2263
195 Ga0501072_0156306 3300049588 Bacteria 1818
196 Ga0501075_0036080 3300049591 Bacteria 3689
197 Ga0501075_0141879 3300049591 Bacteria 1831
198 Ga0501076_0143329 3300049592 Bacteria 1942
199 Ga0501076_0290463 3300049592 Bacteria 1339
200 Ga0501076_0689124 3300049592 Bacteria 843
201 Ga0501077_0126008 3300049593 Bacteria 1623
202 Ga0501077_0131954 3300049593 Bacteria 1584
203 Ga0501209_272285 3300049656 Bacteria 531
204 Ga0501080_1371967 3300049742 Unclassified 604
205 Ga0501083_0588902 3300049744 Bacteria 724
206 Ga0501035_0447045 3300049822 Bacteria 1070
207 Ga0501035_1265150 3300049822 Bacteria 570
208 Ga0501045_0020154 3300049824 Bacteria 4761
209 Ga0501045_0094829 3300049824 Bacteria 2207
210 Ga0501045_0138230 3300049824 Bacteria 1812
211 nmdc:mga03n38_84126_c1 3300050490 Bacteria 1501
212 nmdc:mga00v17_48491_c1 3300050491 Bacteria 2574
213 nmdc:mga0yw44_104089_c1 3300050492 Bacteria 1811
214 nmdc:mga0yw44_1163981_c1 3300050492 Bacteria 520
215 nmdc:mga0yw44_85286_c1 3300050492 Bacteria 1987
216 nmdc:mga05p37_531637_c1 3300050507 Bacteria 1343
217 nmdc:mga0qj67_1182224_c1 3300050509 Bacteria 595
218 nmdc:mga06r32_422187_c1 3300050510 Bacteria 1315
219 nmdc:mga08y16_157072_c1 3300050511 Bacteria 2364
220 nmdc:mga08y16_883975_c1 3300050511 Bacteria 881
221 Ga0495655_0232655 3300053083 Bacteria 614
222 Ga0501084_0011881 3300054114 Bacteria 7209
223 Ga0501084_0108853 3300054114 Bacteria 2328
224 Ga0590071_047478 3300059421 Bacteria 1039
225 Ga0501082_0990325 3300060353 Unclassified 735
226 Ga0501082_1006797 3300060353 Bacteria 729
227 Ga0530510_0023386 3300061734 Bacteria 4403
228 Ga0530510_0366598 3300061734 Bacteria 1083
229 Ga0530510_0503317 3300061734 Bacteria 918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10011393 Ga0081538_100113939 119
2 3300006038 Ga0075365_10478565 Ga0075365_104785652 127
3 3300006175 Ga0070712_100423386 Ga0070712_1004233862 127
4 3300025898 Ga0207692_10330961 Ga0207692_103309612 127
5 3300025915 Ga0207693_10036658 Ga0207693_100366586 127
6 3300032126 Ga0307415_100999430 Ga0307415_1009994302 127
7 3300005535 Ga0070684_101080356 Ga0070684_1010803562 132
8 3300046691 Ga0495670_0470240 Ga0495670_0470240_254_652 132
9 3300046660 Ga0495625_0088105 Ga0495625_0088105_1013_1423 134
10 3300049588 Ga0501072_0091328 Ga0501072_0091328_259_684 134
11 3300049592 Ga0501076_0143329 Ga0501076_0143329_1378_1803 134
12 3300005329 Ga0070683_100569796 Ga0070683_1005697962 135
13 3300005329 Ga0070683_102442865 Ga0070683_1024428651 135
14 3300005614 Ga0068856_101311701 Ga0068856_1013117012 135
15 3300005840 Ga0068870_10917575 Ga0068870_109175751 135
16 3300005937 Ga0081455_10048858 Ga0081455_100488583 135
17 3300006038 Ga0075365_10126117 Ga0075365_101261172 135
18 3300006048 Ga0075363_100189437 Ga0075363_1001894373 135
19 3300006844 Ga0075428_100189364 Ga0075428_1001893642 135
20 3300006847 Ga0075431_100266655 Ga0075431_1002666552 135
21 3300009147 Ga0114129_10303723 Ga0114129_103037232 135
22 3300009147 Ga0114129_10398417 Ga0114129_103984171 135
23 3300025927 Ga0207687_10940295 Ga0207687_109402952 135
24 3300026023 Ga0207677_11188226 Ga0207677_111882261 135
25 3300031731 Ga0307405_10080041 Ga0307405_100800413 135
26 3300031824 Ga0307413_10504311 Ga0307413_105043112 135
27 3300031901 Ga0307406_10437244 Ga0307406_104372442 135
28 3300031901 Ga0307406_11703649 Ga0307406_117036492 135
29 3300031911 Ga0307412_10203510 Ga0307412_102035102 135
30 3300031995 Ga0307409_100819646 Ga0307409_1008196462 135
31 3300032002 Ga0307416_100182769 Ga0307416_1001827693 135
32 3300032002 Ga0307416_101535742 Ga0307416_1015357422 135
33 3300032005 Ga0307411_11246723 Ga0307411_112467231 135
34 3300032126 Ga0307415_100180877 Ga0307415_1001808772 135
35 3300037466 Ga0395898_0214457 Ga0395898_0214457_414_827 135
36 3300038443 Ga0395901_0098150 Ga0395901_0098150_1408_1821 135
37 3300042005 Ga0439448_0266787 Ga0439448_0266787_25_450 135
38 3300042016 Ga0439463_015788 Ga0439463_015788_1159_1572 135
39 3300042439 Ga0439464_0137071 Ga0439464_0137071_305_718 135
40 3300046500 Ga0495596_0125784 Ga0495596_0125784_29_466 135
41 3300046525 Ga0495663_0332797 Ga0495663_0332797_104_517 135
42 3300046694 Ga0495649_0602892 Ga0495649_0602892_37_450 135
43 3300049573 Ga0501037_0205593 Ga0501037_0205593_839_1276 135
44 3300049576 Ga0501040_0326819 Ga0501040_0326819_382_819 135
45 3300049578 Ga0501042_0198101 Ga0501042_0198101_321_758 135
46 3300049582 Ga0501048_0050561 Ga0501048_0050561_2200_2637 135
47 3300049587 Ga0501071_0056127 Ga0501071_0056127_257_694 135
48 3300049588 Ga0501072_0103484 Ga0501072_0103484_639_1076 135
49 3300049591 Ga0501075_0036080 Ga0501075_0036080_518_955 135
50 3300049593 Ga0501077_0126008 Ga0501077_0126008_281_718 135
51 3300049656 Ga0501209_272285 Ga0501209_272285_38_475 135
52 3300049822 Ga0501035_1265150 Ga0501035_1265150_39_476 135
53 3300049824 Ga0501045_0020154 Ga0501045_0020154_3174_3611 135
54 3300050490 nmdc:mga03n38_84126_c1 nmdc:mga03n38_84126_c1_1062_1469 135
55 3300050507 nmdc:mga05p37_531637_c1 nmdc:mga05p37_531637_c1_157_570 135
56 3300050510 nmdc:mga06r32_422187_c1 nmdc:mga06r32_422187_c1_137_550 135
57 3300053083 Ga0495655_0232655 Ga0495655_0232655_173_586 135
58 3300061734 Ga0530510_0023386 Ga0530510_0023386_1128_1565 135
59 3300061734 Ga0530510_0503317 Ga0530510_0503317_470_901 135
60 3300005843 Ga0068860_100101567 Ga0068860_1001015672 136
61 3300005981 Ga0081538_10131591 Ga0081538_101315911 136
62 3300006051 Ga0075364_10170372 Ga0075364_101703721 136
63 3300006051 Ga0075364_10812589 Ga0075364_108125891 136
64 3300028381 Ga0268264_10086959 Ga0268264_100869592 136
65 3300031995 Ga0307409_100313054 Ga0307409_1003130541 136
66 3300032002 Ga0307416_100267379 Ga0307416_1002673792 136
67 3300032126 Ga0307415_100026684 Ga0307415_1000266843 136
68 3300032126 Ga0307415_101655435 Ga0307415_1016554352 136
69 3300038443 Ga0395901_1539518 Ga0395901_1539518_38_454 136
70 3300049572 Ga0501036_0945637 Ga0501036_0945637_64_474 136
71 3300049573 Ga0501037_0157350 Ga0501037_0157350_1062_1472 136
72 3300049575 Ga0501039_0682957 Ga0501039_0682957_175_585 136
73 3300049577 Ga0501041_0226533 Ga0501041_0226533_170_580 136
74 3300049578 Ga0501042_0138975 Ga0501042_0138975_145_555 136
75 3300049579 Ga0501043_0602616 Ga0501043_0602616_149_559 136
76 3300049580 Ga0501046_0300474 Ga0501046_0300474_154_564 136
77 3300049587 Ga0501071_0280749 Ga0501071_0280749_64_474 136
78 3300049588 Ga0501072_0156306 Ga0501072_0156306_991_1401 136
79 3300049591 Ga0501075_0141879 Ga0501075_0141879_1389_1799 136
80 3300049592 Ga0501076_0290463 Ga0501076_0290463_856_1266 136
81 3300049593 Ga0501077_0131954 Ga0501077_0131954_1013_1423 136
82 3300049744 Ga0501083_0588902 Ga0501083_0588902_277_687 136
83 3300049824 Ga0501045_0094829 Ga0501045_0094829_523_933 136
84 3300050491 nmdc:mga00v17_48491_c1 nmdc:mga00v17_48491_c1_1609_2028 136
85 3300054114 Ga0501084_0108853 Ga0501084_0108853_130_540 136
86 3300060353 Ga0501082_1006797 Ga0501082_1006797_280_690 136
87 3300061734 Ga0530510_0366598 Ga0530510_0366598_246_656 136
88 3300003373 JGI25407J50210_10002531 JGI25407J50210_100025315 137
89 3300003373 JGI25407J50210_10048995 JGI25407J50210_100489951 137
90 3300003373 JGI25407J50210_10051591 JGI25407J50210_100515911 137
91 3300005327 Ga0070658_10990492 Ga0070658_109904922 137
92 3300005347 Ga0070668_101744832 Ga0070668_1017448321 137
93 3300005981 Ga0081538_10004261 Ga0081538_100042612 137
94 3300005981 Ga0081538_10005228 Ga0081538_100052287 137
95 3300005981 Ga0081538_10102478 Ga0081538_101024782 137
96 3300005981 Ga0081538_10145526 Ga0081538_101455261 137
97 3300005981 Ga0081538_10160982 Ga0081538_101609821 137
98 3300006048 Ga0075363_100731049 Ga0075363_1007310492 137
99 3300013307 Ga0157372_12141727 Ga0157372_121417271 137
100 3300031901 Ga0307406_10021282 Ga0307406_100212825 137
101 3300046457 Ga0495590_0171912 Ga0495590_0171912_315_728 137
102 3300050509 nmdc:mga0qj67_1182224_c1 nmdc:mga0qj67_1182224_c1_30_449 137
103 3300005329 Ga0070683_100988205 Ga0070683_1009882052 138
104 3300005535 Ga0070684_100254661 Ga0070684_1002546612 138
105 3300005617 Ga0068859_100819882 Ga0068859_1008198821 138
106 3300005719 Ga0068861_100753890 Ga0068861_1007538902 138
107 3300005840 Ga0068870_10542599 Ga0068870_105425992 138
108 3300006038 Ga0075365_10092134 Ga0075365_100921342 138
109 3300006931 Ga0097620_100819874 Ga0097620_1008198742 138
110 3300009098 Ga0105245_10253549 Ga0105245_102535492 138
111 3300009174 Ga0105241_10800120 Ga0105241_108001201 138
112 3300009553 Ga0105249_10855257 Ga0105249_108552572 138
113 3300010375 Ga0105239_11734071 Ga0105239_117340712 138
114 3300013307 Ga0157372_11860046 Ga0157372_118600461 138
115 3300014745 Ga0157377_10125296 Ga0157377_101252962 138
116 3300025908 Ga0207643_10183967 Ga0207643_101839672 138
117 3300025919 Ga0207657_10278015 Ga0207657_102780152 138
118 3300025927 Ga0207687_10276112 Ga0207687_102761122 138
119 3300025944 Ga0207661_10947901 Ga0207661_109479012 138
120 3300025961 Ga0207712_11892154 Ga0207712_118921541 138
121 3300026067 Ga0207678_10792025 Ga0207678_107920252 138
122 3300026118 Ga0207675_100380807 Ga0207675_1003808073 138
123 3300028380 Ga0268265_10069322 Ga0268265_100693222 138
124 3300031824 Ga0307413_11135585 Ga0307413_111355851 138
125 3300032002 Ga0307416_100809286 Ga0307416_1008092861 138
126 3300032004 Ga0307414_11496146 Ga0307414_114961462 138
127 3300050492 nmdc:mga0yw44_104089_c1 nmdc:mga0yw44_104089_c1_527_943 138
128 3300005338 Ga0068868_101424234 Ga0068868_1014242341 139
129 3300005457 Ga0070662_101112965 Ga0070662_1011129652 139
130 3300005983 Ga0081540_1025984 Ga0081540_10259841 139
131 3300026075 Ga0207708_10341139 Ga0207708_103411392 139
132 3300003203 JGI25406J46586_10063962 JGI25406J46586_100639622 140
133 3300003373 JGI25407J50210_10014465 JGI25407J50210_100144653 140
134 3300005331 Ga0070670_101894763 Ga0070670_1018947631 140
135 3300005344 Ga0070661_101519748 Ga0070661_1015197481 140
136 3300005437 Ga0070710_10043621 Ga0070710_100436213 140
137 3300005439 Ga0070711_100182011 Ga0070711_1001820112 140
138 3300005457 Ga0070662_100621725 Ga0070662_1006217252 140
139 3300005518 Ga0070699_100239071 Ga0070699_1002390713 140
140 3300005544 Ga0070686_101234735 Ga0070686_1012347351 140
141 3300005843 Ga0068860_101044058 Ga0068860_1010440582 140
142 3300005937 Ga0081455_10033341 Ga0081455_100333417 140
143 3300005981 Ga0081538_10000141 Ga0081538_1000014150 140
144 3300005981 Ga0081538_10000457 Ga0081538_1000045750 140
145 3300005981 Ga0081538_10002623 Ga0081538_100026232 140
146 3300005981 Ga0081538_10010482 Ga0081538_100104821 140
147 3300005981 Ga0081538_10026831 Ga0081538_100268315 140
148 3300005981 Ga0081538_10028764 Ga0081538_100287643 140
149 3300005981 Ga0081538_10059164 Ga0081538_100591642 140
150 3300005981 Ga0081538_10278936 Ga0081538_102789361 140
151 3300005985 Ga0081539_10005950 Ga0081539_100059502 140
152 3300006038 Ga0075365_10108787 Ga0075365_101087873 140
153 3300006058 Ga0075432_10383533 Ga0075432_103835331 140
154 3300006175 Ga0070712_100023518 Ga0070712_1000235185 140
155 3300006844 Ga0075428_100123330 Ga0075428_1001233304 140
156 3300006844 Ga0075428_101902279 Ga0075428_1019022791 140
157 3300006871 Ga0075434_101290441 Ga0075434_1012904411 140
158 3300009094 Ga0111539_10194733 Ga0111539_101947333 140
159 3300009094 Ga0111539_11166965 Ga0111539_111669651 140
160 3300009098 Ga0105245_10751220 Ga0105245_107512202 140
161 3300009147 Ga0114129_11672317 Ga0114129_116723171 140
162 3300009148 Ga0105243_12553592 Ga0105243_125535921 140
163 3300013308 Ga0157375_10034706 Ga0157375_100347062 140
164 3300025898 Ga0207692_10058806 Ga0207692_100588063 140
165 3300025901 Ga0207688_10363868 Ga0207688_103638682 140
166 3300025915 Ga0207693_10146301 Ga0207693_101463012 140
167 3300025916 Ga0207663_10149724 Ga0207663_101497243 140
168 3300025933 Ga0207706_10794341 Ga0207706_107943411 140
169 3300025937 Ga0207669_11698798 Ga0207669_116987981 140
170 3300025945 Ga0207679_10688977 Ga0207679_106889771 140
171 3300025972 Ga0207668_11854851 Ga0207668_118548511 140
172 3300026035 Ga0207703_10903091 Ga0207703_109030911 140
173 3300026075 Ga0207708_10141626 Ga0207708_101416261 140
174 3300027907 Ga0207428_10288013 Ga0207428_102880134 140
175 3300028381 Ga0268264_10683672 Ga0268264_106836722 140
176 3300031901 Ga0307406_10644840 Ga0307406_106448401 140
177 3300031903 Ga0307407_10715957 Ga0307407_107159571 140
178 3300031995 Ga0307409_100109702 Ga0307409_1001097023 140
179 3300032002 Ga0307416_101079534 Ga0307416_1010795341 140
180 3300032002 Ga0307416_101469334 Ga0307416_1014693341 140
181 3300032126 Ga0307415_100042708 Ga0307415_1000427082 140
182 3300032126 Ga0307415_100171720 Ga0307415_1001717201 140
183 3300032126 Ga0307415_100532893 Ga0307415_1005328932 140
184 3300037418 Ga0395900_1348705 Ga0395900_1348705_58_507 140
185 3300037466 Ga0395898_0069749 Ga0395898_0069749_2067_2516 140
186 3300037466 Ga0395898_0228629 Ga0395898_0228629_238_687 140
187 3300037471 Ga0395905_0114847 Ga0395905_0114847_175_624 140
188 3300037471 Ga0395905_0249288 Ga0395905_0249288_264_713 140
189 3300037471 Ga0395905_0544314 Ga0395905_0544314_255_704 140
190 3300038443 Ga0395901_0487380 Ga0395901_0487380_676_1128 140
191 3300038443 Ga0395901_0708660 Ga0395901_0708660_24_473 140
192 3300038443 Ga0395901_0995998 Ga0395901_0995998_100_549 140
193 3300041512 Ga0451853_2987067 Ga0451853_2987067_49_498 140
194 3300042005 Ga0439448_0107301 Ga0439448_0107301_438_887 140
195 3300042008 Ga0439450_118900 Ga0439450_118900_192_641 140
196 3300042009 Ga0439451_006703 Ga0439451_006703_1159_1608 140
197 3300042011 Ga0439454_002648 Ga0439454_002648_623_1072 140
198 3300042016 Ga0439463_186339 Ga0439463_186339_67_516 140
199 3300042439 Ga0439464_0045801 Ga0439464_0045801_753_1202 140
200 3300042461 Ga0439460_0121211 Ga0439460_0121211_365_802 140
201 3300042993 Ga0439440_0203521 Ga0439440_0203521_34_483 140
202 3300046523 Ga0495644_0061860 Ga0495644_0061860_627_1076 140
203 3300046525 Ga0495663_0233985 Ga0495663_0233985_41_490 140
204 3300046615 Ga0495656_0167918 Ga0495656_0167918_508_957 140
205 3300046664 Ga0495659_0052166 Ga0495659_0052166_405_854 140
206 3300046692 Ga0495671_0243911 Ga0495671_0243911_381_830 140
207 3300047318 Ga0495636_0521989 Ga0495636_0521989_54_503 140
208 3300048910 Ga0496107_0757403 Ga0496107_0757403_56_505 140
209 3300048912 Ga0496109_1702010 Ga0496109_1702010_97_546 140
210 3300048915 Ga0496112_0887616 Ga0496112_0887616_175_624 140
211 3300048916 Ga0496113_0177981 Ga0496113_0177981_192_641 140
212 3300048918 Ga0496115_1078537 Ga0496115_1078537_10_456 140
213 3300049572 Ga0501036_0085212 Ga0501036_0085212_1641_2090 140
214 3300049574 Ga0501038_0885164 Ga0501038_0885164_45_482 140
215 3300049576 Ga0501040_0052406 Ga0501040_0052406_176_613 140
216 3300049577 Ga0501041_0055590 Ga0501041_0055590_1181_1630 140
217 3300049578 Ga0501042_0382528 Ga0501042_0382528_70_519 140
218 3300049588 Ga0501072_0009011 Ga0501072_0009011_6790_7239 140
219 3300049592 Ga0501076_0689124 Ga0501076_0689124_148_585 140
220 3300049742 Ga0501080_1371967 Ga0501080_1371967_41_490 140
221 3300049822 Ga0501035_0447045 Ga0501035_0447045_83_532 140
222 3300049824 Ga0501045_0138230 Ga0501045_0138230_598_1047 140
223 3300050492 nmdc:mga0yw44_1163981_c1 nmdc:mga0yw44_1163981_c1_30_479 140
224 3300050492 nmdc:mga0yw44_85286_c1 nmdc:mga0yw44_85286_c1_1236_1685 140
225 3300050511 nmdc:mga08y16_157072_c1 nmdc:mga08y16_157072_c1_1205_1654 140
226 3300050511 nmdc:mga08y16_883975_c1 nmdc:mga08y16_883975_c1_216_665 140
227 3300054114 Ga0501084_0011881 Ga0501084_0011881_6253_6690 140
228 3300059421 Ga0590071_047478 Ga0590071_047478_366_803 140
229 3300060353 Ga0501082_0990325 Ga0501082_0990325_112_549 140

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxo-assembly1.cif.gz_A crystal structure of a putative isomerase of the snoal-like family (atu_0744) from agrobacterium tumefaciens str. c58 at 2.70 a resolution 0.93 4 140
6x1i-assembly1.cif.gz_B two-component d3 assembly constructed by fusing symmetric oligomers to coiled coils 0.9159 2 140
3dxo-assembly1.cif.gz_A crystal structure of a putative isomerase of the snoal-like family (atu_0744) from agrobacterium tumefaciens str. c58 at 2.70 a resolution 0.9149 4 140
3gy9-assembly1.cif.gz_A crystal structure of putative acetyltransferase (yp_001815201.1) from exiguobacterium sp. 255-15 at 1.52 a resolution 0.8352 103 121
5tpj-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.8299 1 139
ID Description Score Start End Superfamily
3dxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9338 5 140 3.10.450.50
3dxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9183 5 140 3.10.450.50
af_O14354_136_231_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.8284 86 126 3.30.390.80
4h89A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.816 103 120 3.40.630.30
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8096 3 140 3.10.450.50
ID Description Score Start End GO Terms
AF-W9YVG7-F1-model_v4 SnoaL-like domain-containing protein 0.9875 6 140
AF-A0A1J7BF31-F1-model_v4 SnoaL-like domain-containing protein 0.9748 6 140
AF-A0A429BS59-F1-model_v4 SnoaL-like domain-containing protein 0.97 8 139
AF-A0A1S1QED2-F1-model_v4 SnoaL-like domain-containing protein 0.9656 8 138
AF-A0A327TV91-F1-model_v4 SnoaL-like protein 0.9628 6 140

Feature Viewer

pLDDT pTM Quality
93.96 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map