F341297

General Info

Members Datasets Scaffolds Average Seq Length
228 166 456 252

Family's Representative Sequence

Representative Sequence 3300046476|Ga0495662_0012960|Ga0495662_0012960_1001_1855
Length 284
Sequence MTDLLGTGTDLTSVVGEQPDPVLFATVSGAHLYGFPSRDSDVDLRGVHLLPTADLVGLREPEETRSRMWWESGVEMDLVTHDLRKFVRLMLRRNGYVLEQLLSPLVVHTGDEHRELISLAPGVLTRHHAHHYRGFATTQWRLFEKSGELKPLLYTFRVLLTGVHLMRSGEVQADLPTLAGQIESPAYLPDLIAAKAEREHGAADVPRARVAEDVERLHRLLDDAQDASALPDAPSAYDALHAFVVRVRLDGVRGGQDGVRGPAGFPGPVXXREGLPASGGVPER

Samples

Sample ID Description Type Environment
1 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
15 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
29 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
30 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
31 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
32 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
33 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
34 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
35 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
36 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
37 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
38 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
39 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
40 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
41 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
42 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
43 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
44 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
45 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
46 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
49 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
50 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
51 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
52 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
53 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
54 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
55 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
56 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
57 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
58 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
59 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
60 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
61 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
62 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
63 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
64 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
65 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
66 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
67 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
68 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
69 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
72 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
73 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
76 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
77 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
78 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
83 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
84 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
85 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
86 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
98 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
99 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
105 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
121 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
122 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
123 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
124 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
125 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
126 2643221548 Streptomyces sp. Root55 Isolate Unclassified
127 2643221578 Streptomyces sp. Root63 Isolate Unclassified
128 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
129 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
130 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
131 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
132 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
133 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
134 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
135 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
136 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
137 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
138 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
139 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
140 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
141 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
142 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
143 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
144 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
145 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
146 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
147 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
148 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
149 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
150 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
151 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
152 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
153 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
154 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
155 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
156 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
157 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
158 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
159 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
160 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
161 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
162 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
163 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
164 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
165 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
166 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.14
Metatranscriptomes 0
Isolates 18.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 1.32
Rhizoplane 1.75
Rhizosphere 79.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495662_0012960 3300046476 Bacteria 4061
2 Ga0070682_100154758 3300005337 Bacteria 1577
3 Ga0070659_100005246 3300005366 Bacteria 9295
4 Ga0070667_100313548 3300005367 Bacteria 1414
5 Ga0070710_10000027 3300005437 Bacteria 73211
6 Ga0070679_100001206 3300005530 Bacteria 22749
7 Ga0070679_100380764 3300005530 Bacteria 1358
8 Ga0068853_100801106 3300005539 Bacteria 902
9 Ga0068855_100683194 3300005563 Bacteria 1100
10 Ga0081455_10033245 3300005937 Bacteria 4637
11 Ga0081540_1015521 3300005983 Bacteria 4820
12 Ga0070715_10119296 3300006163 Bacteria 1255
13 Ga0105251_10036782 3300009011 Bacteria 2406
14 Ga0105250_10150237 3300009092 Bacteria 969
15 Ga0105248_10237424 3300009177 Bacteria 2052
16 Ga0105248_10271477 3300009177 Bacteria 1910
17 Ga0105246_10015054 3300011119 Bacteria 4875
18 Ga0163163_10038381 3300014325 Bacteria 4668
19 Ga0163163_10856121 3300014325 Bacteria 972
20 Ga0209233_1011958 3300025261 Bacteria 2537
21 Ga0207426_1004691 3300025302 Bacteria 6552
22 Ga0207713_1035486 3300025735 Bacteria 2152
23 Ga0207692_10001177 3300025898 Bacteria 9682
24 Ga0207647_10009943 3300025904 Bacteria 6738
25 Ga0207652_10001837 3300025921 Bacteria 18409
26 Ga0207652_10146860 3300025921 Bacteria 2111
27 Ga0207690_10010983 3300025932 Bacteria 5400
28 Ga0207711_10166065 3300025941 Bacteria 2001
29 Ga0207667_10477514 3300025949 Bacteria 1266
30 Ga0207639_10594777 3300026041 Bacteria 1020
31 Ga0207639_10674356 3300026041 Bacteria 958
32 Ga0207641_10233796 3300026088 Bacteria 1709
33 Ga0307515_10000544 3300028794 Bacteria 88859
34 Ga0307511_10000584 3300030521 Bacteria 39032
35 Ga0307511_10083805 3300030521 Bacteria 2218
36 Ga0307512_10001375 3300030522 Bacteria 34556
37 Ga0307512_10069359 3300030522 Bacteria 2636
38 Ga0316177_1122198 3300030731 Bacteria 1223
39 Ga0314311_1071149 3300030733 Bacteria 8759
40 Ga0307509_10040125 3300031507 Bacteria 5093
41 Ga0307508_10014111 3300031616 Bacteria 7289
42 Ga0307510_10031922 3300033180 Bacteria 5941
43 Ga0307510_10059356 3300033180 Bacteria 3951
44 Ga0395901_0020137 3300038443 Bacteria 6827
45 Ga0439439_0003721 3300041406 Bacteria 3385
46 Ga0451853_0533830 3300041512 Bacteria 4048
47 Ga0451853_2515918 3300041512 Bacteria 1308
48 Ga0439457_000036 3300042014 Bacteria 28398
49 Ga0450894_000736 3300042131 Bacteria 5395
50 Ga0450906_014403 3300042145 Bacteria 1447
51 Ga0466972_0008488 3300044658 Bacteria 5153
52 Ga0466972_0037188 3300044658 Bacteria 2380
53 Ga0466965_0052701 3300044683 Bacteria 2021
54 Ga0466965_0128295 3300044683 Bacteria 1313
55 Ga0466963_0447664 3300044694 Bacteria 911
56 Ga0466957_0119213 3300044842 Bacteria 1681
57 Ga0466960_0013372 3300044901 Bacteria 3485
58 Ga0466967_0060878 3300045976 Bacteria 3348
59 Ga0495603_0002198 3300046455 Bacteria 11484
60 Ga0495603_0003977 3300046455 Bacteria 8804
61 Ga0495603_0058884 3300046455 Bacteria 2270
62 Ga0495590_0084398 3300046457 Bacteria 1120
63 Ga0495629_0001740 3300046459 Bacteria 17065
64 Ga0495629_0005592 3300046459 Bacteria 9384
65 Ga0495629_0010156 3300046459 Bacteria 6863
66 Ga0495629_0025600 3300046459 Bacteria 4192
67 Ga0495629_0067594 3300046459 Bacteria 2494
68 Ga0495629_0067723 3300046459 Bacteria 2491
69 Ga0495629_0137082 3300046459 Bacteria 1703
70 Ga0495651_0018017 3300046462 Bacteria 5468
71 Ga0495651_0038125 3300046462 Bacteria 3742
72 Ga0495605_0007596 3300046474 Bacteria 6147
73 Ga0495639_0011394 3300046475 Bacteria 3834
74 Ga0495662_0005040 3300046476 Bacteria 6620
75 Ga0495662_0006466 3300046476 Bacteria 5851
76 Ga0495662_0106570 3300046476 Bacteria 1372
77 Ga0495664_0126443 3300046477 Bacteria 1546
78 Ga0495594_0003027 3300046499 Bacteria 8710
79 Ga0495594_0012155 3300046499 Bacteria 4483
80 Ga0495594_0014807 3300046499 Bacteria 4092
81 Ga0495594_0031903 3300046499 Bacteria 2858
82 Ga0495596_0030642 3300046500 Bacteria 2152
83 Ga0495607_0047361 3300046501 Bacteria 2519
84 Ga0495583_0085285 3300046506 Bacteria 1367
85 Ga0495606_0006425 3300046507 Bacteria 10844
86 Ga0495608_0079504 3300046511 Bacteria 2132
87 Ga0495616_0009613 3300046513 Bacteria 5641
88 Ga0495618_0040614 3300046514 Bacteria 2929
89 Ga0495618_0232137 3300046514 Bacteria 1161
90 Ga0495620_0028253 3300046515 Bacteria 2611
91 Ga0495628_0018233 3300046516 Bacteria 5819
92 Ga0495628_0073672 3300046516 Bacteria 2660
93 Ga0495631_0025033 3300046518 Bacteria 2751
94 Ga0495643_0042915 3300046522 Bacteria 2462
95 Ga0495666_0008711 3300046526 Bacteria 5081
96 Ga0495652_0010007 3300046529 Bacteria 8595
97 Ga0495652_0050913 3300046529 Bacteria 3539
98 Ga0495654_0033886 3300046530 Bacteria 2581
99 Ga0495640_0050545 3300046533 Bacteria 2863
100 Ga0495587_0006754 3300046536 Bacteria 7471
101 Ga0495609_0086173 3300046538 Bacteria 1369
102 Ga0495597_0020674 3300046542 Bacteria 3063
103 Ga0495645_0043495 3300046543 Bacteria 3276
104 Ga0495645_0261295 3300046543 Bacteria 1146
105 Ga0495622_0010679 3300046557 Bacteria 4236
106 Ga0495622_0019418 3300046557 Bacteria 3164
107 Ga0495633_0027352 3300046558 Bacteria 2788
108 Ga0495656_0032985 3300046615 Bacteria 2111
109 Ga0495668_0012167 3300046616 Bacteria 5114
110 Ga0495634_0001367 3300046642 Bacteria 22125
111 Ga0495625_0006079 3300046660 Bacteria 10831
112 Ga0495625_0021785 3300046660 Bacteria 4923
113 Ga0495635_0002384 3300046663 Bacteria 12796
114 Ga0495635_0020280 3300046663 Bacteria 4631
115 Ga0495661_0016492 3300046665 Bacteria 4895
116 Ga0495588_0287907 3300046674 Bacteria 865
117 Ga0495657_0008917 3300046675 Bacteria 7637
118 Ga0495657_0012100 3300046675 Bacteria 6420
119 Ga0495657_0013710 3300046675 Bacteria 5970
120 Ga0495657_0039823 3300046675 Bacteria 3227
121 Ga0495613_0000902 3300046689 Bacteria 22826
122 Ga0495613_0004703 3300046689 Bacteria 10243
123 Ga0495613_0061882 3300046689 Bacteria 2740
124 Ga0495624_0072957 3300046690 Bacteria 2134
125 Ga0495624_0187293 3300046690 Bacteria 1259
126 Ga0495671_0008163 3300046692 Bacteria 5907
127 Ga0495671_0111917 3300046692 Bacteria 1333
128 Ga0495589_0019311 3300046794 Bacteria 3496
129 Ga0495589_0022940 3300046794 Bacteria 3181
130 Ga0495589_0082634 3300046794 Bacteria 1562
131 Ga0495600_0014050 3300046809 Bacteria 5042
132 Ga0495581_0002415 3300047315 Bacteria 10549
133 Ga0495581_0043577 3300047315 Bacteria 2595
134 Ga0495581_0331316 3300047315 Bacteria 889
135 Ga0495604_0000467 3300047317 Bacteria 35655
136 Ga0495604_0049703 3300047317 Bacteria 3256
137 Ga0495636_0002199 3300047318 Bacteria 7483
138 Ga0495636_0013349 3300047318 Bacteria 3260
139 Ga0495674_0142380 3300047319 Bacteria 2015
140 Ga0495676_0001932 3300047321 Bacteria 18181
141 Ga0495676_0006825 3300047321 Bacteria 10495
142 Ga0495676_0019228 3300047321 Bacteria 6009
143 Ga0495676_0036682 3300047321 Bacteria 4090
144 Ga0495676_0142667 3300047321 Bacteria 1714
145 Ga0495687_087829 3300047443 Bacteria 1198
146 Ga0495675_0010206 3300047444 Bacteria 5860
147 Ga0495675_0252195 3300047444 Bacteria 1059
148 Ga0495677_0010204 3300047445 Bacteria 3454
149 Ga0495673_0137302 3300047469 Bacteria 956
150 Ga0495681_0019835 3300047470 Bacteria 3659
151 Ga0495681_0037626 3300047470 Bacteria 2381
152 Ga0495684_0126731 3300047471 Bacteria 1920
153 Ga0495686_0032550 3300047472 Bacteria 3374
154 Ga0495686_0180978 3300047472 Bacteria 1221
155 Ga0495593_0003049 3300047673 Bacteria 10095
156 Ga0495593_0046559 3300047673 Bacteria 2310
157 Ga0495593_0070157 3300047673 Bacteria 1821
158 Ga0495602_0025014 3300048088 Bacteria 5785
159 Ga0495614_0009822 3300048089 Bacteria 4227
160 Ga0495614_0010150 3300048089 Bacteria 4155
161 Ga0495614_0018691 3300048089 Bacteria 3001
162 Ga0495614_0059760 3300048089 Bacteria 1637
163 Ga0495626_0058540 3300048091 Bacteria 1760
164 Ga0496104_0446957 3300048907 Bacteria 1204
165 Ga0496105_0053046 3300048908 Bacteria 3349
166 Ga0496112_0092512 3300048915 Bacteria 2994
167 Ga0496113_0088675 3300048916 Bacteria 2380
168 Ga0495682_0024153 3300049460 Bacteria 2268
169 Ga0501034_0006556 3300049571 Bacteria 12502
170 Ga0501036_0118401 3300049572 Bacteria 2237
171 Ga0501038_0003349 3300049574 Bacteria 14946
172 Ga0501039_0281293 3300049575 Bacteria 1308
173 Ga0501046_0134120 3300049580 Bacteria 1877
174 Ga0501047_0013690 3300049581 Bacteria 7700
175 Ga0501047_0065933 3300049581 Bacteria 3490
176 Ga0501080_0116940 3300049742 Bacteria 2471
177 Ga0501035_0032311 3300049822 Bacteria 4762
178 Ga0501035_0069351 3300049822 Bacteria 3126
179 Ga0501044_0014601 3300049823 Bacteria 8469
180 Ga0501044_0058652 3300049823 Bacteria 3946
181 Ga0500583_0017645 3300053092 Bacteria 2882
182 Ga0500640_010176 3300053095 Bacteria 3791
183 Ga0500560_001443 3300053107 Bacteria 4135
184 Ga0466962_0064920 3300061719 Bacteria 1743
185 Ga0466962_0125989 3300061719 Bacteria 1237
186 2554259283 2554235005 Bacteria 6457341
187 2616695970 2616644814 Bacteria 11555299
188 2643759887 2643221548 Bacteria 8053412
189 2643904776 2643221578 Bacteria 9213798
190 2643944139 2643221587 Bacteria 7586415
191 2644405958 2643221673 Bacteria 9196637
192 2644430987 2643221677 Bacteria 7584031
193 2644460417 2643221682 Bacteria 6743283
194 2784587014 2784132148 Bacteria 8627943
195 2785345403 2784746763 Bacteria 9783172
196 2795796027 2795385472 Bacteria 6627535
197 2808918732 2808606375 Bacteria 9466072
198 2855674991 2855670206 Bacteria 7120389
199 2855679951 2855676851 Bacteria 7063653
200 2858849461 2858848962 Bacteria 6963058
201 2858891067 2858888857 Bacteria 7060307
202 2858895682 2858895516 Bacteria 7378898
203 2862390918 2862382967 Bacteria 10317375
204 2869053454 2869048445 Bacteria 6875584
205 2869066326 2869061728 Bacteria 7112407
206 2869074221 2869068681 Bacteria 7205615
207 2875392964 2875391855 Bacteria 7600475
208 2880501548 2880495981 Bacteria 7340502
209 2895437527 2895427314 Bacteria 13147766
210 2912759146 2912757875 Bacteria 7940295
211 2918502830 2918501144 Bacteria 8668083
212 2947231526 2947224130 Bacteria 9938529
213 2954010737 2954002825 Bacteria 9173742
214 2966604093 2966598605 Bacteria 7676064
215 2990065364 2990059506 Bacteria 9321252
216 3006399675 3006393351 Bacteria 6615579
217 3006487804 3006486233 Bacteria 8157040
218 3006495327 3006493962 Bacteria 8825450
219 8008561645 8008558824 Bacteria 10610750
220 8008580466 8008574985 Bacteria 7815457
221 8023624639 8023623736 Bacteria 8593882
222 8025416463 8025413630 Bacteria 7014048
223 8025536962 8025530807 Bacteria 8495698
224 8048412013 8048406513 Bacteria 8936924
225 8054167195 8054160619 Bacteria 7783213
226 8056450916 8056447290 Bacteria 7680491
227 8056671617 8056667051 Bacteria 6953971
228 8056835396 8056829672 Bacteria 9045328
229 Ga0495662_0012960
230 Ga0070682_100154758
231 Ga0070659_100005246
232 Ga0070667_100313548
233 Ga0070710_10000027
234 Ga0070679_100001206
235 Ga0070679_100380764
236 Ga0068853_100801106
237 Ga0068855_100683194
238 Ga0081455_10033245
239 Ga0081540_1015521
240 Ga0070715_10119296
241 Ga0105251_10036782
242 Ga0105250_10150237
243 Ga0105248_10237424
244 Ga0105248_10271477
245 Ga0105246_10015054
246 Ga0163163_10038381
247 Ga0163163_10856121
248 Ga0209233_1011958
249 Ga0207426_1004691
250 Ga0207713_1035486
251 Ga0207692_10001177
252 Ga0207647_10009943
253 Ga0207652_10001837
254 Ga0207652_10146860
255 Ga0207690_10010983
256 Ga0207711_10166065
257 Ga0207667_10477514
258 Ga0207639_10594777
259 Ga0207639_10674356
260 Ga0207641_10233796
261 Ga0307515_10000544
262 Ga0307511_10000584
263 Ga0307511_10083805
264 Ga0307512_10001375
265 Ga0307512_10069359
266 Ga0316177_1122198
267 Ga0314311_1071149
268 Ga0307509_10040125
269 Ga0307508_10014111
270 Ga0307510_10031922
271 Ga0307510_10059356
272 Ga0395901_0020137
273 Ga0439439_0003721
274 Ga0451853_0533830
275 Ga0451853_2515918
276 Ga0439457_000036
277 Ga0450894_000736
278 Ga0450906_014403
279 Ga0466972_0008488
280 Ga0466972_0037188
281 Ga0466965_0052701
282 Ga0466965_0128295
283 Ga0466963_0447664
284 Ga0466957_0119213
285 Ga0466960_0013372
286 Ga0466967_0060878
287 Ga0495603_0002198
288 Ga0495603_0003977
289 Ga0495603_0058884
290 Ga0495590_0084398
291 Ga0495629_0001740
292 Ga0495629_0005592
293 Ga0495629_0010156
294 Ga0495629_0025600
295 Ga0495629_0067594
296 Ga0495629_0067723
297 Ga0495629_0137082
298 Ga0495651_0018017
299 Ga0495651_0038125
300 Ga0495605_0007596
301 Ga0495639_0011394
302 Ga0495662_0005040
303 Ga0495662_0006466
304 Ga0495662_0106570
305 Ga0495664_0126443
306 Ga0495594_0003027
307 Ga0495594_0012155
308 Ga0495594_0014807
309 Ga0495594_0031903
310 Ga0495596_0030642
311 Ga0495607_0047361
312 Ga0495583_0085285
313 Ga0495606_0006425
314 Ga0495608_0079504
315 Ga0495616_0009613
316 Ga0495618_0040614
317 Ga0495618_0232137
318 Ga0495620_0028253
319 Ga0495628_0018233
320 Ga0495628_0073672
321 Ga0495631_0025033
322 Ga0495643_0042915
323 Ga0495666_0008711
324 Ga0495652_0010007
325 Ga0495652_0050913
326 Ga0495654_0033886
327 Ga0495640_0050545
328 Ga0495587_0006754
329 Ga0495609_0086173
330 Ga0495597_0020674
331 Ga0495645_0043495
332 Ga0495645_0261295
333 Ga0495622_0010679
334 Ga0495622_0019418
335 Ga0495633_0027352
336 Ga0495656_0032985
337 Ga0495668_0012167
338 Ga0495634_0001367
339 Ga0495625_0006079
340 Ga0495625_0021785
341 Ga0495635_0002384
342 Ga0495635_0020280
343 Ga0495661_0016492
344 Ga0495588_0287907
345 Ga0495657_0008917
346 Ga0495657_0012100
347 Ga0495657_0013710
348 Ga0495657_0039823
349 Ga0495613_0000902
350 Ga0495613_0004703
351 Ga0495613_0061882
352 Ga0495624_0072957
353 Ga0495624_0187293
354 Ga0495671_0008163
355 Ga0495671_0111917
356 Ga0495589_0019311
357 Ga0495589_0022940
358 Ga0495589_0082634
359 Ga0495600_0014050
360 Ga0495581_0002415
361 Ga0495581_0043577
362 Ga0495581_0331316
363 Ga0495604_0000467
364 Ga0495604_0049703
365 Ga0495636_0002199
366 Ga0495636_0013349
367 Ga0495674_0142380
368 Ga0495676_0001932
369 Ga0495676_0006825
370 Ga0495676_0019228
371 Ga0495676_0036682
372 Ga0495676_0142667
373 Ga0495687_087829
374 Ga0495675_0010206
375 Ga0495675_0252195
376 Ga0495677_0010204
377 Ga0495673_0137302
378 Ga0495681_0019835
379 Ga0495681_0037626
380 Ga0495684_0126731
381 Ga0495686_0032550
382 Ga0495686_0180978
383 Ga0495593_0003049
384 Ga0495593_0046559
385 Ga0495593_0070157
386 Ga0495602_0025014
387 Ga0495614_0009822
388 Ga0495614_0010150
389 Ga0495614_0018691
390 Ga0495614_0059760
391 Ga0495626_0058540
392 Ga0496104_0446957
393 Ga0496105_0053046
394 Ga0496112_0092512
395 Ga0496113_0088675
396 Ga0495682_0024153
397 Ga0501034_0006556
398 Ga0501036_0118401
399 Ga0501038_0003349
400 Ga0501039_0281293
401 Ga0501046_0134120
402 Ga0501047_0013690
403 Ga0501047_0065933
404 Ga0501080_0116940
405 Ga0501035_0032311
406 Ga0501035_0069351
407 Ga0501044_0014601
408 Ga0501044_0058652
409 Ga0500583_0017645
410 Ga0500640_010176
411 Ga0500560_001443
412 Ga0466962_0064920
413 Ga0466962_0125989
414 2554259283
415 2616695970
416 2643759887
417 2643904776
418 2643944139
419 2644405958
420 2644430987
421 2644460417
422 2784587014
423 2785345403
424 2795796027
425 2808918732
426 2855674991
427 2855679951
428 2858849461
429 2858891067
430 2858895682
431 2862390918
432 2869053454
433 2869066326
434 2869074221
435 2875392964
436 2880501548
437 2895437527
438 2912759146
439 2918502830
440 2947231526
441 2954010737
442 2966604093
443 2990065364
444 3006399675
445 3006487804
446 3006495327
447 8008561645
448 8008580466
449 8023624639
450 8025416463
451 8025536962
452 8048412013
453 8054167195
454 8056450916
455 8056671617
456 8056835396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10127

RlaP

RNA repair pathway DNA polymerase beta family

7

246

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ek0-assembly1.cif.gz_A gppnhp-bound ypt51 at 1.48 a resolution 0.6279 66 84
3tw8-assembly2.cif.gz_D gef domain of dennd 1b in complex with rab gtpase rab35 0.616 66 84
6l6o-assembly1.cif.gz_A crystal structure of stabilized rab5a gtpase domain from leishmania donovani 0.585 62 91
7jjo-assembly1.cif.gz_A structural basis of the activation of heterotrimeric gs-protein by isoproterenol-bound beta1-adrenergic receptor 0.5801 40 83
2bcg-assembly1.cif.gz_Y structure of doubly prenylated ypt1:gdi complex 0.5784 63 86
ID Description Score Start End Superfamily
4ebkB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7666 11 93 3.30.460.10
1knyB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7092 10 122 3.30.460.10
3c18C01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7049 9 122 3.30.460.10
af_Q57606_1_96_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.679 10 50 3.30.460.10
3c18C01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6782 9 122 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A365ZCN3-F1-model_v4 Nucleotidyltransferase 0.9784 13 251 GO:0016740
AF-A0A841G474-F1-model_v4 Nucleotidyltransferase 0.9769 13 250
AF-A0A7H8MGZ0-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.9757 13 251 GO:0016740
AF-A0A841CT71-F1-model_v4 Nucleotidyltransferase 0.9755 13 250
AF-A0A7W7C3Z4-F1-model_v4 Putative nucleotidyltransferase 0.9743 5 249 GO:0016740

Map