F341234

General Info

Members Datasets Scaffolds Average Seq Length
228 193 456 282

Family's Representative Sequence

Representative Sequence 3300042011|Ga0439454_006784|Ga0439454_006784_384_1325
Length 313
Sequence MSSVLYDTPGPRAKRRNVLLSIVFTILLALLLWWVWRTMDDKNQLEWDLWEPFTTSEAWTTYLLPGLGDTLKAAAISMVIALPLGAVFGIARLSEHAWVRGVAGAVVEFFRSIPVLLLMLFANELYVRSSLNISSEERPLYAVVTGLVLYNASVLAEIVRAGILSLPRGQTEAAYAVGLRKGQTMTNILLPQAVTAMLPAIVSQLVVIVKDTALGGVMLGFTELLNARQTLAANYANVIPSFIVVAIIYIIVNFILTSFASWLEQRLRRSKKSTGAVLGEDTEINPAAVGGTFGTGGEGGGPSGFTFTDKPPR

Samples

Sample ID Description Type Environment
1 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
33 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
44 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
50 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
62 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
63 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
64 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
65 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
66 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
67 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
68 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
69 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
70 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
71 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
72 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
73 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
81 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
132 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
167 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
168 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
169 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
170 2643221714 Streptomyces sp. Root264 Isolate Unclassified
171 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
172 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
173 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
174 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
175 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
176 2867428634 Streptomyces sp. RP5T Isolate Unclassified
177 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
178 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
179 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
180 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
181 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
182 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
183 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
184 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
185 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
186 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
187 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
188 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
189 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
190 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
191 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
192 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
193 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.84
Metatranscriptomes 1.32
Isolates 11.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0.44
Rhizoplane 1.75
Rhizosphere 85.09
Stem 0
Stem Tuber 0.44
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439454_006784 3300042011 Bacteria 1420
2 rootH1_10152329 3300003316 Bacteria 3645
3 rootH2_10068034 3300003320 Bacteria 1447
4 rootH1_10026351 3300003323 Bacteria 2975
5 Ga0070658_10178893 3300005327 Bacteria 1784
6 Ga0070683_100003291 3300005329 Bacteria 13062
7 Ga0070683_100076787 3300005329 Bacteria 3123
8 Ga0070680_100121540 3300005336 Bacteria 2180
9 Ga0070661_100032429 3300005344 Bacteria 3782
10 Ga0070659_100066201 3300005366 Bacteria 2863
11 Ga0070700_100000041 3300005441 Bacteria 103180
12 Ga0070662_100111434 3300005457 Bacteria 2085
13 Ga0070681_10190644 3300005458 Bacteria 1969
14 Ga0070679_100154592 3300005530 Bacteria 2269
15 Ga0070684_100007855 3300005535 Bacteria 8321
16 Ga0070684_100057391 3300005535 Bacteria 3399
17 Ga0068853_100088610 3300005539 Bacteria 2717
18 Ga0068857_100284214 3300005577 Unclassified 1522
19 Ga0068856_100038889 3300005614 Bacteria 4671
20 Ga0068861_100053973 3300005719 Bacteria 3060
21 Ga0081455_10040958 3300005937 Bacteria 4081
22 Ga0081538_10000298 3300005981 Bacteria 57143
23 Ga0081538_10003838 3300005981 Bacteria 14039
24 Ga0081538_10014936 3300005981 Bacteria 6046
25 Ga0081538_10017132 3300005981 Bacteria 5513
26 Ga0081538_10046772 3300005981 Bacteria 2663
27 Ga0081540_1009856 3300005983 Bacteria 6531
28 Ga0075370_10048721 3300006353 Bacteria 2401
29 Ga0075429_100020317 3300006880 Bacteria 5760
30 Ga0114129_10044104 3300009147 Bacteria 6273
31 Ga0105237_10006849 3300009545 Bacteria 12557
32 Ga0105238_10008381 3300009551 Bacteria 10340
33 Ga0157369_10006196 3300013105 Bacteria 13878
34 Ga0157372_10090579 3300013307 Bacteria 3477
35 Ga0157372_10093093 3300013307 Bacteria 3429
36 Ga0182008_10001725 3300014497 Bacteria 14345
37 Ga0206356_11846325 3300020070 Bacteria 1350
38 Ga0206353_11663480 3300020082 Bacteria 2755
39 Ga0209758_1001388 3300025297 Bacteria 28805
40 Ga0207657_10105097 3300025919 Bacteria 2338
41 Ga0207652_10022633 3300025921 Bacteria 5201
42 Ga0207694_10004289 3300025924 Bacteria 11156
43 Ga0207690_10029253 3300025932 Bacteria 3501
44 Ga0207706_10040140 3300025933 Bacteria 4148
45 Ga0207661_10015694 3300025944 Bacteria 5580
46 Ga0207661_10061252 3300025944 Bacteria 3039
47 Ga0207661_10063831 3300025944 Bacteria 2984
48 Ga0207679_10151636 3300025945 Bacteria 1887
49 Ga0207708_10000036 3300026075 Bacteria 138158
50 Ga0207674_10024887 3300026116 Bacteria 6389
51 Ga0207675_100004678 3300026118 Bacteria 13178
52 Ga0209282_1076395 3300027666 Bacteria 1804
53 Ga0307517_10005035 3300028786 Bacteria 20096
54 Ga0307515_10153715 3300028794 Bacteria 2389
55 Ga0307512_10002707 3300030522 Bacteria 21759
56 Ga0307508_10005719 3300031616 Bacteria 11769
57 Ga0307405_10002187 3300031731 Bacteria 8543
58 Ga0307413_10081322 3300031824 Bacteria 2077
59 Ga0307410_10373413 3300031852 Bacteria 1145
60 Ga0307406_10013647 3300031901 Bacteria 4657
61 Ga0307406_10019561 3300031901 Bacteria 3976
62 Ga0307407_10039335 3300031903 Bacteria 2629
63 Ga0307412_10007144 3300031911 Bacteria 6339
64 Ga0307409_100001233 3300031995 Bacteria 12330
65 Ga0307409_100148463 3300031995 Bacteria 2031
66 Ga0307416_100008632 3300032002 Bacteria 6596
67 Ga0307415_100000116 3300032126 Bacteria 34044
68 Ga0307415_100055343 3300032126 Bacteria 2714
69 Ga0307415_100108249 3300032126 Bacteria 2056
70 Ga0307415_100141946 3300032126 Bacteria 1836
71 Ga0395900_0010716 3300037418 Bacteria 9377
72 Ga0395900_0134321 3300037418 Bacteria 2534
73 Ga0395898_0109705 3300037466 Bacteria 2645
74 Ga0395898_0235689 3300037466 Unclassified 1745
75 Ga0395905_0022511 3300037471 Bacteria 5961
76 Ga0395901_0073982 3300038443 Bacteria 3554
77 Ga0395901_0548050 3300038443 Bacteria 1172
78 Ga0451802_2039696 3300041460 Bacteria 945
79 Ga0451853_1100859 3300041512 Bacteria 1112
80 Ga0439448_0006293 3300042005 Bacteria 3410
81 Ga0439449_0001391 3300042007 Bacteria 9459
82 Ga0439449_0079726 3300042007 Bacteria 1207
83 Ga0439450_021273 3300042008 Bacteria 1391
84 Ga0439451_010837 3300042009 Bacteria 1838
85 Ga0439454_006847 3300042011 Bacteria 1415
86 Ga0450915_000444 3300042119 Bacteria 1490
87 Ga0450888_004785 3300042126 Bacteria 1425
88 Ga0450900_004151 3300042136 Bacteria 1652
89 Ga0450903_001162 3300042138 Bacteria 4957
90 Ga0439458_0020679 3300042157 Bacteria 1520
91 Ga0439444_0037172 3300042437 Bacteria 941
92 Ga0439464_0007101 3300042439 Bacteria 2927
93 Ga0466969_0001845 3300044656 Bacteria 11327
94 Ga0466969_0018165 3300044656 Bacteria 3667
95 Ga0466972_0063026 3300044658 Bacteria 1776
96 Ga0466972_0077843 3300044658 Bacteria 1579
97 Ga0466966_0002016 3300044684 Bacteria 13177
98 Ga0466966_0064902 3300044684 Bacteria 2297
99 Ga0466963_0181265 3300044694 Bacteria 1470
100 Ga0466970_0003267 3300044765 Bacteria 7881
101 Ga0466970_0005581 3300044765 Bacteria 6254
102 Ga0466959_0001419 3300045049 Bacteria 14665
103 Ga0495617_063502 3300046452 Bacteria 1219
104 Ga0495627_024938 3300046453 Bacteria 1944
105 Ga0495592_0040062 3300046454 Bacteria 3516
106 Ga0495603_0200725 3300046455 Bacteria 1152
107 Ga0495629_0011439 3300046459 Bacteria 6447
108 Ga0495641_0115732 3300046461 Bacteria 1196
109 Ga0495605_0009125 3300046474 Bacteria 5578
110 Ga0495594_0018356 3300046499 Bacteria 3703
111 Ga0495607_0088464 3300046501 Bacteria 1683
112 Ga0495583_0090113 3300046506 Bacteria 1321
113 Ga0495606_0144631 3300046507 Bacteria 1401
114 Ga0495616_0033274 3300046513 Bacteria 2687
115 Ga0495620_0021360 3300046515 Bacteria 3144
116 Ga0495620_0051554 3300046515 Bacteria 1750
117 Ga0495628_0244465 3300046516 Bacteria 1341
118 Ga0495631_0093207 3300046518 Bacteria 1297
119 Ga0495643_0004965 3300046522 Bacteria 9134
120 Ga0495652_0025736 3300046529 Bacteria 5201
121 Ga0495654_0126642 3300046530 Bacteria 1150
122 Ga0495640_0069816 3300046533 Bacteria 2362
123 Ga0495609_0035537 3300046538 Bacteria 2255
124 Ga0495645_0029143 3300046543 Bacteria 4013
125 Ga0495622_0010887 3300046557 Bacteria 4195
126 Ga0495633_0133742 3300046558 Bacteria 1147
127 Ga0495625_0028280 3300046660 Bacteria 4206
128 Ga0495661_0140667 3300046665 Bacteria 1313
129 Ga0495588_0138192 3300046674 Bacteria 1286
130 Ga0495657_0183742 3300046675 Bacteria 1281
131 Ga0495646_0205482 3300046680 Bacteria 1071
132 Ga0495613_0008044 3300046689 Bacteria 7841
133 Ga0495613_0022381 3300046689 Bacteria 4709
134 Ga0495670_0082528 3300046691 Bacteria 1639
135 Ga0495660_0054862 3300046810 Bacteria 2158
136 Ga0495604_0015346 3300047317 Bacteria 6113
137 Ga0495636_0018682 3300047318 Bacteria 2782
138 Ga0495636_0066136 3300047318 Bacteria 1536
139 Ga0495680_0008687 3300047322 Bacteria 9212
140 Ga0495683_0045079 3300047323 Bacteria 2216
141 Ga0495687_025753 3300047443 Bacteria 2774
142 Ga0495687_085532 3300047443 Bacteria 1222
143 Ga0495675_0099425 3300047444 Bacteria 1822
144 Ga0495675_0221844 3300047444 Bacteria 1143
145 Ga0495677_0053261 3300047445 Bacteria 1492
146 Ga0495685_012667 3300047447 Bacteria 2856
147 Ga0495681_0043952 3300047470 Bacteria 2151
148 Ga0495614_0030641 3300048089 Bacteria 2315
149 Ga0495626_0008028 3300048091 Bacteria 5827
150 Ga0496104_0100927 3300048907 Bacteria 2763
151 Ga0496114_0097546 3300048917 Bacteria 2504
152 Ga0496115_0096074 3300048918 Bacteria 2426
153 Ga0496117_0094419 3300048920 Bacteria 1914
154 Ga0496118_0012520 3300048921 Bacteria 8132
155 Ga0496118_0194258 3300048921 Bacteria 1210
156 Ga0496119_0148370 3300048922 Bacteria 1259
157 Ga0496122_0000353 3300048925 Bacteria 99072
158 Ga0496123_0000372 3300048926 Bacteria 84144
159 Ga0496124_0003163 3300048927 Bacteria 20365
160 Ga0495678_054827 3300049459 Bacteria 1524
161 Ga0501323_000268 3300049539 Bacteria 3524
162 Ga0501031_0009237 3300049568 Bacteria 6409
163 Ga0501031_0031262 3300049568 Bacteria 3472
164 Ga0501033_0005240 3300049570 Bacteria 10293
165 Ga0501033_0039580 3300049570 Bacteria 3521
166 Ga0501033_0096771 3300049570 Bacteria 2157
167 Ga0501036_0001879 3300049572 Bacteria 16289
168 Ga0501037_0022647 3300049573 Bacteria 4646
169 Ga0501038_0005435 3300049574 Bacteria 11840
170 Ga0501039_0000963 3300049575 Bacteria 20969
171 Ga0501040_0000088 3300049576 Bacteria 45722
172 Ga0501041_0001165 3300049577 Bacteria 14389
173 Ga0501042_0000179 3300049578 Bacteria 29295
174 Ga0501046_0006067 3300049580 Bacteria 10749
175 Ga0501047_0146598 3300049581 Bacteria 2237
176 Ga0501048_0000107 3300049582 Bacteria 46510
177 Ga0501068_0016070 3300049584 Bacteria 4312
178 Ga0501070_0310268 3300049586 Bacteria 1284
179 Ga0501072_0001376 3300049588 Bacteria 18268
180 Ga0501074_0014641 3300049590 Bacteria 5705
181 Ga0501075_0037064 3300049591 Bacteria 3641
182 Ga0501076_0000244 3300049592 Bacteria 33318
183 Ga0501077_0002488 3300049593 Bacteria 11036
184 Ga0501257_055377 3300049686 Bacteria 995
185 Ga0501079_0000828 3300049741 Bacteria 21016
186 Ga0501080_0072110 3300049742 Bacteria 3213
187 Ga0501081_0022396 3300049743 Bacteria 4227
188 Ga0501035_0028261 3300049822 Bacteria 5120
189 Ga0501035_0061870 3300049822 Bacteria 3331
190 Ga0501035_0062420 3300049822 Bacteria 3316
191 Ga0501044_0081051 3300049823 Bacteria 3286
192 Ga0501045_0002267 3300049824 Bacteria 13056
193 nmdc:mga03n38_71167_c1 3300050490 Bacteria 1610
194 nmdc:mga07m45_253021_c1 3300050496 Bacteria 1025
195 Ga0500644_0101844 3300053088 Bacteria 1092
196 Ga0500573_0115653 3300053140 Bacteria 1497
197 Ga0501084_0011175 3300054114 Bacteria 7437
198 Ga0501084_0217565 3300054114 Bacteria 1612
199 Ga0590071_003437 3300059421 Bacteria 3891
200 Ga0501082_0000108 3300060353 Bacteria 64464
201 Ga0530510_0017059 3300061734 Bacteria 5142
202 2554255887 2554235005 Bacteria 6457341
203 2585307803 2582581313 Bacteria 10042643
204 2616699340 2616644814 Bacteria 11555299
205 2644626410 2643221714 Bacteria 9015452
206 2785371958 2784746768 Bacteria 10036182
207 2786673064 2786546132 Bacteria 10419719
208 2795797585 2795385472 Bacteria 6627535
209 2804848300 2802429296 Bacteria 7227771
210 2852641618 2852635781 Bacteria 8251373
211 2867434478 2867428634 Bacteria 9590268
212 2877678624 2877676314 Bacteria 9512378
213 2884763541 2884763398 Bacteria 4091164
214 2912729787 2912723979 Bacteria 8557534
215 2946078125 2946072368 Bacteria 8999607
216 2954010684 2954002825 Bacteria 9173742
217 2954383585 2954380949 Bacteria 10050426
218 2954679378 2954673503 Bacteria 9685905
219 2954684777 2954682443 Bacteria 9862841
220 2954713882 2954711539 Bacteria 10867210
221 2954723850 2954721474 Bacteria 10456478
222 2954737985 2954731030 Bacteria 10243860
223 2954742750 2954740390 Bacteria 10229294
224 2954756845 2954749733 Bacteria 10366972
225 2954761712 2954759201 Bacteria 9358192
226 3006426158 3006425503 Bacteria 6491253
227 8025419698 8025413630 Bacteria 7014048
228 8055069871 8055066027 Bacteria 9479577
229 Ga0439454_006784
230 rootH1_10152329
231 rootH2_10068034
232 rootH1_10026351
233 Ga0070658_10178893
234 Ga0070683_100003291
235 Ga0070683_100076787
236 Ga0070680_100121540
237 Ga0070661_100032429
238 Ga0070659_100066201
239 Ga0070700_100000041
240 Ga0070662_100111434
241 Ga0070681_10190644
242 Ga0070679_100154592
243 Ga0070684_100007855
244 Ga0070684_100057391
245 Ga0068853_100088610
246 Ga0068857_100284214
247 Ga0068856_100038889
248 Ga0068861_100053973
249 Ga0081455_10040958
250 Ga0081538_10000298
251 Ga0081538_10003838
252 Ga0081538_10014936
253 Ga0081538_10017132
254 Ga0081538_10046772
255 Ga0081540_1009856
256 Ga0075370_10048721
257 Ga0075429_100020317
258 Ga0114129_10044104
259 Ga0105237_10006849
260 Ga0105238_10008381
261 Ga0157369_10006196
262 Ga0157372_10090579
263 Ga0157372_10093093
264 Ga0182008_10001725
265 Ga0206356_11846325
266 Ga0206353_11663480
267 Ga0209758_1001388
268 Ga0207657_10105097
269 Ga0207652_10022633
270 Ga0207694_10004289
271 Ga0207690_10029253
272 Ga0207706_10040140
273 Ga0207661_10015694
274 Ga0207661_10061252
275 Ga0207661_10063831
276 Ga0207679_10151636
277 Ga0207708_10000036
278 Ga0207674_10024887
279 Ga0207675_100004678
280 Ga0209282_1076395
281 Ga0307517_10005035
282 Ga0307515_10153715
283 Ga0307512_10002707
284 Ga0307508_10005719
285 Ga0307405_10002187
286 Ga0307413_10081322
287 Ga0307410_10373413
288 Ga0307406_10013647
289 Ga0307406_10019561
290 Ga0307407_10039335
291 Ga0307412_10007144
292 Ga0307409_100001233
293 Ga0307409_100148463
294 Ga0307416_100008632
295 Ga0307415_100000116
296 Ga0307415_100055343
297 Ga0307415_100108249
298 Ga0307415_100141946
299 Ga0395900_0010716
300 Ga0395900_0134321
301 Ga0395898_0109705
302 Ga0395898_0235689
303 Ga0395905_0022511
304 Ga0395901_0073982
305 Ga0395901_0548050
306 Ga0451802_2039696
307 Ga0451853_1100859
308 Ga0439448_0006293
309 Ga0439449_0001391
310 Ga0439449_0079726
311 Ga0439450_021273
312 Ga0439451_010837
313 Ga0439454_006847
314 Ga0450915_000444
315 Ga0450888_004785
316 Ga0450900_004151
317 Ga0450903_001162
318 Ga0439458_0020679
319 Ga0439444_0037172
320 Ga0439464_0007101
321 Ga0466969_0001845
322 Ga0466969_0018165
323 Ga0466972_0063026
324 Ga0466972_0077843
325 Ga0466966_0002016
326 Ga0466966_0064902
327 Ga0466963_0181265
328 Ga0466970_0003267
329 Ga0466970_0005581
330 Ga0466959_0001419
331 Ga0495617_063502
332 Ga0495627_024938
333 Ga0495592_0040062
334 Ga0495603_0200725
335 Ga0495629_0011439
336 Ga0495641_0115732
337 Ga0495605_0009125
338 Ga0495594_0018356
339 Ga0495607_0088464
340 Ga0495583_0090113
341 Ga0495606_0144631
342 Ga0495616_0033274
343 Ga0495620_0021360
344 Ga0495620_0051554
345 Ga0495628_0244465
346 Ga0495631_0093207
347 Ga0495643_0004965
348 Ga0495652_0025736
349 Ga0495654_0126642
350 Ga0495640_0069816
351 Ga0495609_0035537
352 Ga0495645_0029143
353 Ga0495622_0010887
354 Ga0495633_0133742
355 Ga0495625_0028280
356 Ga0495661_0140667
357 Ga0495588_0138192
358 Ga0495657_0183742
359 Ga0495646_0205482
360 Ga0495613_0008044
361 Ga0495613_0022381
362 Ga0495670_0082528
363 Ga0495660_0054862
364 Ga0495604_0015346
365 Ga0495636_0018682
366 Ga0495636_0066136
367 Ga0495680_0008687
368 Ga0495683_0045079
369 Ga0495687_025753
370 Ga0495687_085532
371 Ga0495675_0099425
372 Ga0495675_0221844
373 Ga0495677_0053261
374 Ga0495685_012667
375 Ga0495681_0043952
376 Ga0495614_0030641
377 Ga0495626_0008028
378 Ga0496104_0100927
379 Ga0496114_0097546
380 Ga0496115_0096074
381 Ga0496117_0094419
382 Ga0496118_0012520
383 Ga0496118_0194258
384 Ga0496119_0148370
385 Ga0496122_0000353
386 Ga0496123_0000372
387 Ga0496124_0003163
388 Ga0495678_054827
389 Ga0501323_000268
390 Ga0501031_0009237
391 Ga0501031_0031262
392 Ga0501033_0005240
393 Ga0501033_0039580
394 Ga0501033_0096771
395 Ga0501036_0001879
396 Ga0501037_0022647
397 Ga0501038_0005435
398 Ga0501039_0000963
399 Ga0501040_0000088
400 Ga0501041_0001165
401 Ga0501042_0000179
402 Ga0501046_0006067
403 Ga0501047_0146598
404 Ga0501048_0000107
405 Ga0501068_0016070
406 Ga0501070_0310268
407 Ga0501072_0001376
408 Ga0501074_0014641
409 Ga0501075_0037064
410 Ga0501076_0000244
411 Ga0501077_0002488
412 Ga0501257_055377
413 Ga0501079_0000828
414 Ga0501080_0072110
415 Ga0501081_0022396
416 Ga0501035_0028261
417 Ga0501035_0061870
418 Ga0501035_0062420
419 Ga0501044_0081051
420 Ga0501045_0002267
421 nmdc:mga03n38_71167_c1
422 nmdc:mga07m45_253021_c1
423 Ga0500644_0101844
424 Ga0500573_0115653
425 Ga0501084_0011175
426 Ga0501084_0217565
427 Ga0590071_003437
428 Ga0501082_0000108
429 Ga0530510_0017059
430 2554255887
431 2585307803
432 2616699340
433 2644626410
434 2785371958
435 2786673064
436 2795797585
437 2804848300
438 2852641618
439 2867434478
440 2877678624
441 2884763541
442 2912729787
443 2946078125
444 2954010684
445 2954383585
446 2954679378
447 2954684777
448 2954713882
449 2954723850
450 2954737985
451 2954742750
452 2954756845
453 2954761712
454 3006426158
455 8025419698
456 8055069871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

81

269

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.9189 64 266
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8539 64 266
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7747 59 267
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7703 55 267
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7666 64 267
ID Description Score Start End Superfamily
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9436 64 271 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.935 50 268 1.10.3720.10
af_Q2FX86_270_484_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9258 57 269 1.10.3720.10
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9184 64 267 1.10.3720.10
af_P0AER5_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9178 54 267 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1I2IGY4-F1-model_v4 Amino acid ABC transporter membrane protein, PAAT family 0.9594 67 269 GO:0006865
GO:0022857
GO:0043190
AF-A0A4P7JIP5-F1-model_v4 Amino acid ABC transporter permease 0.9546 64 267 GO:0006865
GO:0022857
GO:0043190
AF-A0A6M1LHM4-F1-model_v4 Amino acid ABC transporter permease 0.9511 64 270 GO:0006865
GO:0022857
GO:0043190
AF-A0A2H5ZJ30-F1-model_v4 L-cystine transport system permease protein YecS 0.9502 64 270 GO:0006865
GO:0022857
GO:0043190
AF-A0A268IGI7-F1-model_v4 deleted 0.9486 64 270

Map