F341215

General Info

Members Datasets Scaffolds Average Seq Length
228 131 183 303

Family's Representative Sequence

Representative Sequence 3300041411|Ga0439466_0099932|Ga0439466_0099932_12_857
Length 281
Sequence LAHPAVIAVVGPTGSGKSDLAVNLALALDGEVINADAMQFYRGMDIGTAKITTAERRGVPHHLLDTLDVTEEASVSDFQQQARAVIADLQARGKRAILAGGSGLYVRRLEAEYAGHGPGPLLARLRDVDPVSAGRVSDARRIIRALEVHQLTGRPFSSFMPRREYFQPAIQIGLAVDRDQLRARLAQRVHTMVDRGLLEEVRRLDQAGLRRGKTAPRALGYAQFLKVLDGGTTVEQAAEETIVATRQFARRQLTWFRADPRISWLDWQDPELDTKAIALCR

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
3 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
4 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
5 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
6 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
7 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
8 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
9 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
10 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
11 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
12 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
13 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
14 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
15 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
16 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
17 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
18 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
19 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
20 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
21 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
22 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
23 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
24 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
25 2920879853 Kocuria salina CV6 Isolate Unclassified
26 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
27 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
28 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
29 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
30 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
31 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
32 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
33 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
34 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
35 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
36 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
37 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
38 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
39 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
40 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
41 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
80 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
81 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
82 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
83 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
84 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
85 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
88 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
89 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
90 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
91 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
92 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
93 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
94 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
107 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
128 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
130 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
131 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.82
Metatranscriptomes 0.44
Isolates 19.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 10.53
Rhizosphere 81.14
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002334 3300000549 Bacteria 2657
2 Ga0070675_100126010 3300005354 Bacteria 2179
3 Ga0070671_100039124 3300005355 Bacteria 3936
4 Ga0075432_10000069 3300006058 Bacteria 20468
5 Ga0105251_10110176 3300009011 Bacteria 1255
6 Ga0105244_10002542 3300009036 Bacteria 13703
7 Ga0105244_10010742 3300009036 Bacteria 5532
8 Ga0105244_10054884 3300009036 Bacteria 2020
9 Ga0105243_10017027 3300009148 Bacteria 5496
10 Ga0105249_10527357 3300009553 Bacteria 1229
11 Ga0105246_10003528 3300011119 Bacteria 9474
12 Ga0105246_10010443 3300011119 Bacteria 5746
13 Ga0157373_10120858 3300013100 Bacteria 1841
14 Ga0157371_10218866 3300013102 Bacteria 1367
15 Ga0157369_10079895 3300013105 Bacteria 3502
16 Ga0157369_10263072 3300013105 Bacteria 1799
17 Ga0163162_10064995 3300013306 Bacteria 3694
18 Ga0209148_1002150 3300025254 Bacteria 7326
19 Ga0209148_1002988 3300025254 Bacteria 5074
20 Ga0209129_1000079 3300025258 Bacteria 187308
21 Ga0209025_1001784 3300025294 Bacteria 25600
22 Ga0207655_1005368 3300025728 Bacteria 8733
23 Ga0207645_10021850 3300025907 Bacteria 4168
24 Ga0207709_10160138 3300025935 Bacteria 1569
25 Ga0207683_10002757 3300026121 Bacteria 15344
26 Ga0207428_10071038 3300027907 Bacteria 2735
27 Ga0307408_100007689 3300031548 Bacteria 7130
28 Ga0307408_100087888 3300031548 Bacteria 2340
29 Ga0307408_100131414 3300031548 Bacteria 1953
30 Ga0307408_100243774 3300031548 Bacteria 1478
31 Ga0307405_10010284 3300031731 Bacteria 4836
32 Ga0307405_10052107 3300031731 Bacteria 2543
33 Ga0307405_10070547 3300031731 Bacteria 2245
34 Ga0307405_10089444 3300031731 Bacteria 2034
35 Ga0307413_10002934 3300031824 Bacteria 7049
36 Ga0307413_10006114 3300031824 Bacteria 5461
37 Ga0307413_10022775 3300031824 Bacteria 3383
38 Ga0307413_10056064 3300031824 Bacteria 2402
39 Ga0307413_10160582 3300031824 Bacteria 1578
40 Ga0307413_10201133 3300031824 Bacteria 1439
41 Ga0307410_10010661 3300031852 Bacteria 5219
42 Ga0307410_10015680 3300031852 Bacteria 4502
43 Ga0307410_10098701 3300031852 Bacteria 2089
44 Ga0307410_10135589 3300031852 Bacteria 1814
45 Ga0307410_10184580 3300031852 Bacteria 1582
46 Ga0307410_10209043 3300031852 Bacteria 1494
47 Ga0307410_10330277 3300031852 Bacteria 1212
48 Ga0307406_10010027 3300031901 Bacteria 5331
49 Ga0307406_10178014 3300031901 Bacteria 1546
50 Ga0307407_10016333 3300031903 Bacteria 3694
51 Ga0307407_10039211 3300031903 Bacteria 2632
52 Ga0307407_10083485 3300031903 Bacteria 1938
53 Ga0307407_10192313 3300031903 Bacteria 1361
54 Ga0307407_10273795 3300031903 Bacteria 1166
55 Ga0307412_10005280 3300031911 Bacteria 7250
56 Ga0307412_10008443 3300031911 Bacteria 5879
57 Ga0307412_10008454 3300031911 Bacteria 5876
58 Ga0307412_10047783 3300031911 Bacteria 2812
59 Ga0307412_10131157 3300031911 Bacteria 1820
60 Ga0307412_10135384 3300031911 Bacteria 1796
61 Ga0307412_10155168 3300031911 Bacteria 1694
62 Ga0307412_10169407 3300031911 Bacteria 1631
63 Ga0307412_10317643 3300031911 Bacteria 1238
64 Ga0307409_100015447 3300031995 Bacteria 5013
65 Ga0307409_100032820 3300031995 Bacteria 3770
66 Ga0307409_100066143 3300031995 Bacteria 2848
67 Ga0307409_100325873 3300031995 Bacteria 1439
68 Ga0307409_100383071 3300031995 Bacteria 1337
69 Ga0307416_100026479 3300032002 Bacteria 4274
70 Ga0307416_100106544 3300032002 Bacteria 2457
71 Ga0307416_100166870 3300032002 Bacteria 2043
72 Ga0307416_100276549 3300032002 Bacteria 1652
73 Ga0307416_100670119 3300032002 Bacteria 1124
74 Ga0307414_10042539 3300032004 Bacteria 3088
75 Ga0307414_10214073 3300032004 Bacteria 1577
76 Ga0307411_10105551 3300032005 Bacteria 2003
77 Ga0307415_100005432 3300032126 Bacteria 6768
78 Ga0307415_100031414 3300032126 Bacteria 3421
79 Ga0395899_0003176 3300037312 Bacteria 13038
80 Ga0395899_0025362 3300037312 Bacteria 4475
81 Ga0395899_0036524 3300037312 Bacteria 3685
82 Ga0395899_0103342 3300037312 Bacteria 2055
83 Ga0395900_0011925 3300037418 Bacteria 8886
84 Ga0395900_0038535 3300037418 Bacteria 4927
85 Ga0395900_0186400 3300037418 Bacteria 2106
86 Ga0395900_0239641 3300037418 Bacteria 1820
87 Ga0395900_0312112 3300037418 Bacteria 1555
88 Ga0395900_0442097 3300037418 Bacteria 1258
89 Ga0395898_0003138 3300037466 Bacteria 18662
90 Ga0395898_0022765 3300037466 Bacteria 6341
91 Ga0395898_0032153 3300037466 Bacteria 5236
92 Ga0395898_0035103 3300037466 Bacteria 4990
93 Ga0395898_0446159 3300037466 Bacteria 1232
94 Ga0395905_0230299 3300037471 Bacteria 1733
95 Ga0395901_0013282 3300038443 Bacteria 8364
96 Ga0395901_0033844 3300038443 Bacteria 5277
97 Ga0395901_0039533 3300038443 Bacteria 4881
98 Ga0395901_0124128 3300038443 Bacteria 2713
99 Ga0395901_0131402 3300038443 Bacteria 2631
100 Ga0395901_0193548 3300038443 Bacteria 2132
101 Ga0395901_0230034 3300038443 Bacteria 1936
102 Ga0439436_0002670 3300041404 Bacteria 5375
103 Ga0439436_0008023 3300041404 Bacteria 3242
104 Ga0439436_0008844 3300041404 Bacteria 3091
105 Ga0439436_0012112 3300041404 Bacteria 2618
106 Ga0439438_001758 3300041405 Bacteria 9529
107 Ga0439439_0000073 3300041406 Bacteria 12878
108 Ga0439466_0005002 3300041411 Bacteria 5088
109 Ga0439466_0099932 3300041411 Bacteria 905
110 Ga0439433_0000259 3300041999 Bacteria 8935
111 Ga0439433_0001507 3300041999 Bacteria 4810
112 Ga0439433_0017478 3300041999 Bacteria 1593
113 Ga0439442_000065 3300042002 Bacteria 24630
114 Ga0439442_000190 3300042002 Bacteria 15597
115 Ga0439442_000319 3300042002 Bacteria 11528
116 Ga0439442_000873 3300042002 Bacteria 6199
117 Ga0439432_001377 3300042006 Bacteria 9209
118 Ga0439449_0000773 3300042007 Bacteria 12312
119 Ga0439449_0002646 3300042007 Bacteria 6971
120 Ga0439449_0015434 3300042007 Bacteria 2870
121 Ga0439452_004688 3300042010 Bacteria 4532
122 Ga0439457_002084 3300042014 Bacteria 5846
123 Ga0450906_017121 3300042145 Bacteria 1309
124 Ga0450907_002487 3300042146 Bacteria 3504
125 Ga0450907_003228 3300042146 Bacteria 2937
126 Ga0450907_011605 3300042146 Bacteria 1463
127 Ga0450908_000212 3300042184 Bacteria 11654
128 Ga0450909_000208 3300042185 Bacteria 6816
129 Ga0439434_0000627 3300042435 Bacteria 10180
130 Ga0450918_000512 3300042531 Bacteria 8316
131 Ga0495580_0011482 3300046472 Bacteria 6853
132 Ga0495580_0070874 3300046472 Bacteria 2435
133 Ga0495582_0024423 3300046473 Bacteria 3307
134 Ga0495642_0007214 3300046528 Bacteria 4266
135 Ga0495586_0001726 3300046535 Bacteria 11931
136 Ga0495667_0001418 3300046559 Bacteria 15766
137 Ga0495656_0009714 3300046615 Bacteria 3470
138 Ga0495668_0239846 3300046616 Bacteria 993
139 Ga0495588_0000718 3300046674 Bacteria 15197
140 Ga0495588_0019274 3300046674 Bacteria 3340
141 Ga0495670_0087967 3300046691 Bacteria 1588
142 Ga0495600_0030677 3300046809 Bacteria 3482
143 Ga0495581_0003888 3300047315 Bacteria 8590
144 Ga0495581_0022792 3300047315 Bacteria 3626
145 Ga0495636_0023938 3300047318 Bacteria 2475
146 Ga0495677_0057291 3300047445 Bacteria 1440
147 Ga0496101_0048504 3300048904 Bacteria 3052
148 Ga0496101_0058389 3300048904 Bacteria 2793
149 Ga0496102_0069695 3300048905 Bacteria 3228
150 Ga0496102_0072613 3300048905 Bacteria 3162
151 Ga0496102_0165229 3300048905 Bacteria 2082
152 Ga0496102_0228419 3300048905 Bacteria 1755
153 Ga0496103_0071282 3300048906 Bacteria 2174
154 Ga0496103_0122478 3300048906 Bacteria 1657
155 Ga0496104_0163378 3300048907 Bacteria 2135
156 Ga0496106_0021960 3300048909 Bacteria 4742
157 Ga0496107_0009118 3300048910 Bacteria 6879
158 Ga0496107_0122556 3300048910 Bacteria 1915
159 Ga0496107_0300201 3300048910 Bacteria 1195
160 Ga0496109_0139866 3300048912 Bacteria 2263
161 Ga0496109_0194431 3300048912 Bacteria 1906
162 Ga0496109_0459409 3300048912 Bacteria 1202
163 Ga0496110_0033487 3300048913 Bacteria 4444
164 Ga0496111_0034940 3300048914 Bacteria 3591
165 Ga0496111_0081952 3300048914 Bacteria 2355
166 Ga0496112_0217406 3300048915 Bacteria 1867
167 Ga0496113_0134395 3300048916 Bacteria 1943
168 Ga0496113_0220163 3300048916 Bacteria 1512
169 Ga0496114_0033829 3300048917 Bacteria 4214
170 Ga0496114_0153313 3300048917 Bacteria 1999
171 Ga0501032_0003126 3300049569 Bacteria 12754
172 Ga0501034_0000015 3300049571 Bacteria 296163
173 Ga0501037_0071064 3300049573 Bacteria 2532
174 Ga0501037_0074062 3300049573 Bacteria 2475
175 Ga0501038_0045484 3300049574 Bacteria 3811
176 Ga0501038_0048402 3300049574 Bacteria 3679
177 Ga0501038_0420670 3300049574 Bacteria 1031
178 Ga0501039_0028637 3300049575 Bacteria 4288
179 Ga0501043_0008672 3300049579 Bacteria 8004
180 Ga0501043_0040398 3300049579 Bacteria 3666
181 Ga0501070_0044339 3300049586 Bacteria 3702
182 Ga0495655_0000836 3300053083 Bacteria 4818
183 Ga0587128_006457 3300059630 Bacteria 1443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0239846 Ga0495668_0239846_18_851 270
2 3300048906 Ga0496103_0122478 Ga0496103_0122478_638_1453 271
3 3300048910 Ga0496107_0300201 Ga0496107_0300201_114_929 271
4 3300041411 Ga0439466_0099932 Ga0439466_0099932_12_857 276
5 3300031824 Ga0307413_10201133 Ga0307413_102011332 278
6 3300031995 Ga0307409_100325873 Ga0307409_1003258732 279
7 3300031911 Ga0307412_10317643 Ga0307412_103176432 282
8 3300047315 Ga0495581_0022792 Ga0495581_0022792_2169_3119 285
9 3300009036 Ga0105244_10002542 Ga0105244_100025423 287
10 3300042007 Ga0439449_0002646 Ga0439449_0002646_5656_6528 290
11 3300009036 Ga0105244_10010742 Ga0105244_100107423 292
12 3300009148 Ga0105243_10017027 Ga0105243_100170272 292
13 3300011119 Ga0105246_10003528 Ga0105246_100035287 292
14 3300011119 Ga0105246_10010443 Ga0105246_100104435 292
15 3300025254 Ga0209148_1002150 Ga0209148_10021503 292
16 3300025258 Ga0209129_1000079 Ga0209129_100007949 292
17 3300025294 Ga0209025_1001784 Ga0209025_10017844 292
18 3300025728 Ga0207655_1005368 Ga0207655_100536810 292
19 3300025935 Ga0207709_10160138 Ga0207709_101601382 292
20 3300031548 Ga0307408_100087888 Ga0307408_1000878881 292
21 3300031911 Ga0307412_10047783 Ga0307412_100477832 292
22 3300037418 Ga0395900_0011925 Ga0395900_0011925_4986_5891 292
23 3300037471 Ga0395905_0230299 Ga0395905_0230299_502_1407 292
24 3300038443 Ga0395901_0039533 Ga0395901_0039533_2628_3533 292
25 3300049573 Ga0501037_0071064 Ga0501037_0071064_26_904 292
26 iso_pu_bacteria 2844849076 2844852267 292
27 iso_pu_bacteria 2919034639 2919036114 292
28 iso_pu_bacteria 2919059106 2919060831 292
29 iso_pu_bacteria 2939647034 2939647909 292
30 3300006058 Ga0075432_10000069 Ga0075432_1000006916 293
31 3300013100 Ga0157373_10120858 Ga0157373_101208582 293
32 3300013105 Ga0157369_10079895 Ga0157369_100798951 293
33 3300013105 Ga0157369_10263072 Ga0157369_102630722 293
34 3300027907 Ga0207428_10071038 Ga0207428_100710382 293
35 3300031548 Ga0307408_100007689 Ga0307408_1000076899 293
36 3300031548 Ga0307408_100131414 Ga0307408_1001314142 293
37 3300031548 Ga0307408_100243774 Ga0307408_1002437741 293
38 3300031731 Ga0307405_10010284 Ga0307405_100102844 293
39 3300031731 Ga0307405_10052107 Ga0307405_100521072 293
40 3300031731 Ga0307405_10070547 Ga0307405_100705472 293
41 3300031731 Ga0307405_10089444 Ga0307405_100894442 293
42 3300031824 Ga0307413_10002934 Ga0307413_100029343 293
43 3300031824 Ga0307413_10006114 Ga0307413_100061144 293
44 3300031824 Ga0307413_10022775 Ga0307413_100227754 293
45 3300031824 Ga0307413_10056064 Ga0307413_100560643 293
46 3300031824 Ga0307413_10160582 Ga0307413_101605822 293
47 3300031852 Ga0307410_10010661 Ga0307410_100106612 293
48 3300031852 Ga0307410_10015680 Ga0307410_100156804 293
49 3300031852 Ga0307410_10098701 Ga0307410_100987012 293
50 3300031852 Ga0307410_10135589 Ga0307410_101355892 293
51 3300031852 Ga0307410_10184580 Ga0307410_101845802 293
52 3300031901 Ga0307406_10010027 Ga0307406_100100274 293
53 3300031903 Ga0307407_10016333 Ga0307407_100163334 293
54 3300031903 Ga0307407_10039211 Ga0307407_100392112 293
55 3300031903 Ga0307407_10083485 Ga0307407_100834852 293
56 3300031903 Ga0307407_10192313 Ga0307407_101923132 293
57 3300031903 Ga0307407_10273795 Ga0307407_102737952 293
58 3300031911 Ga0307412_10005280 Ga0307412_100052802 293
59 3300031911 Ga0307412_10008443 Ga0307412_100084433 293
60 3300031911 Ga0307412_10008454 Ga0307412_100084543 293
61 3300031911 Ga0307412_10131157 Ga0307412_101311572 293
62 3300031911 Ga0307412_10135384 Ga0307412_101353841 293
63 3300031911 Ga0307412_10155168 Ga0307412_101551682 293
64 3300031911 Ga0307412_10169407 Ga0307412_101694072 293
65 3300031995 Ga0307409_100032820 Ga0307409_1000328203 293
66 3300031995 Ga0307409_100066143 Ga0307409_1000661432 293
67 3300031995 Ga0307409_100383071 Ga0307409_1003830712 293
68 3300032002 Ga0307416_100026479 Ga0307416_1000264792 293
69 3300032002 Ga0307416_100106544 Ga0307416_1001065441 293
70 3300032002 Ga0307416_100166870 Ga0307416_1001668702 293
71 3300032002 Ga0307416_100276549 Ga0307416_1002765492 293
72 3300032002 Ga0307416_100670119 Ga0307416_1006701192 293
73 3300032004 Ga0307414_10042539 Ga0307414_100425392 293
74 3300032004 Ga0307414_10214073 Ga0307414_102140732 293
75 3300032005 Ga0307411_10105551 Ga0307411_101055512 293
76 3300032126 Ga0307415_100005432 Ga0307415_1000054325 293
77 3300032126 Ga0307415_100031414 Ga0307415_1000314144 293
78 3300037312 Ga0395899_0025362 Ga0395899_0025362_1218_2117 293
79 3300037312 Ga0395899_0036524 Ga0395899_0036524_858_1739 293
80 3300037418 Ga0395900_0239641 Ga0395900_0239641_434_1333 293
81 3300037466 Ga0395898_0022765 Ga0395898_0022765_1961_2842 293
82 3300038443 Ga0395901_0124128 Ga0395901_0124128_1711_2610 293
83 3300038443 Ga0395901_0193548 Ga0395901_0193548_411_1292 293
84 3300041404 Ga0439436_0002670 Ga0439436_0002670_1638_2519 293
85 3300041404 Ga0439436_0008023 Ga0439436_0008023_1214_2110 293
86 3300041404 Ga0439436_0008844 Ga0439436_0008844_2002_2898 293
87 3300041404 Ga0439436_0012112 Ga0439436_0012112_1300_2211 293
88 3300041405 Ga0439438_001758 Ga0439438_001758_3781_4695 293
89 3300041406 Ga0439439_0000073 Ga0439439_0000073_8172_9086 293
90 3300041411 Ga0439466_0005002 Ga0439466_0005002_3005_3919 293
91 3300041999 Ga0439433_0000259 Ga0439433_0000259_4894_5775 293
92 3300041999 Ga0439433_0001507 Ga0439433_0001507_3188_4150 293
93 3300041999 Ga0439433_0017478 Ga0439433_0017478_362_1264 293
94 3300042002 Ga0439442_000065 Ga0439442_000065_8388_9284 293
95 3300042002 Ga0439442_000190 Ga0439442_000190_475_1371 293
96 3300042002 Ga0439442_000319 Ga0439442_000319_10537_11418 293
97 3300042002 Ga0439442_000873 Ga0439442_000873_217_1179 293
98 3300042006 Ga0439432_001377 Ga0439432_001377_3441_4355 293
99 3300042007 Ga0439449_0000773 Ga0439449_0000773_11053_12015 293
100 3300042007 Ga0439449_0015434 Ga0439449_0015434_352_1266 293
101 3300042010 Ga0439452_004688 Ga0439452_004688_95_1009 293
102 3300042014 Ga0439457_002084 Ga0439457_002084_1772_2686 293
103 3300042145 Ga0450906_017121 Ga0450906_017121_353_1249 293
104 3300042146 Ga0450907_002487 Ga0450907_002487_42_938 293
105 3300042146 Ga0450907_003228 Ga0450907_003228_532_1446 293
106 3300042146 Ga0450907_011605 Ga0450907_011605_370_1266 293
107 3300042184 Ga0450908_000212 Ga0450908_000212_5448_6362 293
108 3300042185 Ga0450909_000208 Ga0450909_000208_2278_3192 293
109 3300042435 Ga0439434_0000627 Ga0439434_0000627_1122_2036 293
110 3300042531 Ga0450918_000512 Ga0450918_000512_5018_5932 293
111 3300048905 Ga0496102_0165229 Ga0496102_0165229_143_1042 293
112 3300049569 Ga0501032_0003126 Ga0501032_0003126_11256_12152 293
113 3300049573 Ga0501037_0074062 Ga0501037_0074062_227_1126 293
114 3300049574 Ga0501038_0045484 Ga0501038_0045484_1379_2278 293
115 3300049574 Ga0501038_0048402 Ga0501038_0048402_1102_1998 293
116 3300049575 Ga0501039_0028637 Ga0501039_0028637_1801_2697 293
117 3300049579 Ga0501043_0040398 Ga0501043_0040398_1595_2494 293
118 3300049586 Ga0501070_0044339 Ga0501070_0044339_1558_2454 293
119 3300059630 Ga0587128_006457 Ga0587128_006457_79_975 293
120 iso_pu_bacteria 2554235227 2555230608 293
121 iso_pu_bacteria 2690315906 2691513465 293
122 iso_pu_bacteria 2808606357 2808830715 293
123 iso_pu_bacteria 2808606360 2808851903 293
124 iso_pu_bacteria 2808606366 2808879782 293
125 iso_pu_bacteria 2808606370 2808894970 293
126 iso_pu_bacteria 2808606371 2808895923 293
127 iso_pu_bacteria 2893684298 2893684882 293
128 iso_pu_bacteria 2905926851 2905927656 293
129 iso_pu_bacteria 2905926851 2905929213 293
130 iso_pu_bacteria 2919391150 2919392394 293
131 iso_pu_bacteria 2939598168 2939600028 293
132 iso_pu_bacteria 2945916053 2945919600 293
133 iso_pu_bacteria 2945920336 2945924489 293
134 iso_pu_bacteria 2945941187 2945943778 293
135 iso_pu_bacteria 2945956166 2945958033 293
136 iso_pu_bacteria 2946037020 2946039743 293
137 iso_pu_bacteria 2946059875 2946063325 293
138 iso_pu_bacteria 2953998280 2954000968 293
139 iso_pu_bacteria 2974302888 2974303248 293
140 iso_pu_bacteria 8054107350 8054109968 293
141 3300031852 Ga0307410_10209043 Ga0307410_102090432 294
142 3300031995 Ga0307409_100015447 Ga0307409_1000154474 294
143 3300053083 Ga0495655_0000836 Ga0495655_0000836_3824_4756 294
144 iso_pu_bacteria 2537561592 2537898585 294
145 3300046559 Ga0495667_0001418 Ga0495667_0001418_4412_5362 295
146 3300049571 Ga0501034_0000015 Ga0501034_0000015_44071_44994 295
147 3300049574 Ga0501038_0420670 Ga0501038_0420670_75_998 295
148 3300049579 Ga0501043_0008672 Ga0501043_0008672_3406_4329 295
149 3300025254 Ga0209148_1002988 Ga0209148_10029882 296
150 3300037312 Ga0395899_0103342 Ga0395899_0103342_602_1522 296
151 3300037418 Ga0395900_0038535 Ga0395900_0038535_3767_4687 296
152 3300037418 Ga0395900_0186400 Ga0395900_0186400_739_1659 296
153 3300037418 Ga0395900_0442097 Ga0395900_0442097_161_1081 296
154 3300037466 Ga0395898_0003138 Ga0395898_0003138_5860_6780 296
155 3300037466 Ga0395898_0032153 Ga0395898_0032153_386_1306 296
156 3300037466 Ga0395898_0446159 Ga0395898_0446159_222_1142 296
157 3300038443 Ga0395901_0013282 Ga0395901_0013282_1623_2543 296
158 3300038443 Ga0395901_0033844 Ga0395901_0033844_1610_2530 296
159 3300038443 Ga0395901_0131402 Ga0395901_0131402_1517_2437 296
160 3300038443 Ga0395901_0230034 Ga0395901_0230034_899_1819 296
161 iso_pu_bacteria 2808606700 2810363483 296
162 iso_pu_bacteria 2904776348 2904780319 296
163 iso_pu_bacteria 2905926851 2905930246 296
164 iso_pu_bacteria 2920879853 2920883703 296
165 iso_pu_bacteria 2946024296 2946025258 296
166 iso_pu_bacteria 8004025490 8004026122 296
167 3300046472 Ga0495580_0011482 Ga0495580_0011482_3576_4517 297
168 3300046472 Ga0495580_0070874 Ga0495580_0070874_1430_2371 297
169 3300048915 Ga0496112_0217406 Ga0496112_0217406_725_1624 297
170 iso_pu_bacteria 2654587600 2655032016 297
171 iso_pu_bacteria 2775506735 2775658889 297
172 iso_pu_bacteria 2811994871 2812321728 297
173 iso_pu_bacteria 2904497146 2904499663 297
174 iso_pu_bacteria 2910809715 2910814765 297
175 iso_pu_bacteria 2919538618 2919538671 297
176 iso_pu_bacteria 2932426870 2932431062 297
177 iso_pu_bacteria 2939674588 2939678509 297
178 iso_pu_bacteria 2946003308 2946004033 297
179 3300031852 Ga0307410_10330277 Ga0307410_103302772 298
180 iso_pu_bacteria 2857740372 2857743761 298
181 iso_pu_bacteria 2933418574 2933419143 299
182 iso_pu_bacteria 8004021418 8004022903 299
183 3300005354 Ga0070675_100126010 Ga0070675_1001260102 301
184 3300005355 Ga0070671_100039124 Ga0070671_1000391243 301
185 3300009011 Ga0105251_10110176 Ga0105251_101101761 301
186 3300009036 Ga0105244_10054884 Ga0105244_100548842 301
187 3300009553 Ga0105249_10527357 Ga0105249_105273571 301
188 3300013102 Ga0157371_10218866 Ga0157371_102188662 301
189 3300013306 Ga0163162_10064995 Ga0163162_100649953 301
190 3300025907 Ga0207645_10021850 Ga0207645_100218503 301
191 3300026121 Ga0207683_10002757 Ga0207683_100027575 301
192 3300031901 Ga0307406_10178014 Ga0307406_101780142 301
193 3300037312 Ga0395899_0003176 Ga0395899_0003176_9737_10696 301
194 3300037418 Ga0395900_0312112 Ga0395900_0312112_407_1366 301
195 3300037466 Ga0395898_0035103 Ga0395898_0035103_2610_3569 301
196 3300046473 Ga0495582_0024423 Ga0495582_0024423_1232_2218 301
197 3300046535 Ga0495586_0001726 Ga0495586_0001726_8476_9462 301
198 3300046615 Ga0495656_0009714 Ga0495656_0009714_35_940 301
199 3300046674 Ga0495588_0000718 Ga0495588_0000718_9136_10122 301
200 3300046809 Ga0495600_0030677 Ga0495600_0030677_647_1633 301
201 3300047315 Ga0495581_0003888 Ga0495581_0003888_1154_2140 301
202 3300047318 Ga0495636_0023938 Ga0495636_0023938_881_1786 301
203 3300048904 Ga0496101_0048504 Ga0496101_0048504_112_1017 301
204 3300048904 Ga0496101_0058389 Ga0496101_0058389_876_1781 301
205 3300048905 Ga0496102_0069695 Ga0496102_0069695_194_1213 301
206 3300048905 Ga0496102_0072613 Ga0496102_0072613_53_1060 301
207 3300048905 Ga0496102_0228419 Ga0496102_0228419_199_1104 301
208 3300048906 Ga0496103_0071282 Ga0496103_0071282_659_1741 301
209 3300048907 Ga0496104_0163378 Ga0496104_0163378_795_1877 301
210 3300048909 Ga0496106_0021960 Ga0496106_0021960_1628_2635 301
211 3300048910 Ga0496107_0009118 Ga0496107_0009118_895_1902 301
212 3300048910 Ga0496107_0122556 Ga0496107_0122556_809_1714 301
213 3300048912 Ga0496109_0139866 Ga0496109_0139866_520_1455 301
214 3300048912 Ga0496109_0194431 Ga0496109_0194431_612_1619 301
215 3300048912 Ga0496109_0459409 Ga0496109_0459409_135_1040 301
216 3300048913 Ga0496110_0033487 Ga0496110_0033487_2553_3458 301
217 3300048914 Ga0496111_0034940 Ga0496111_0034940_1115_2020 301
218 3300048914 Ga0496111_0081952 Ga0496111_0081952_1297_2304 301
219 3300048916 Ga0496113_0134395 Ga0496113_0134395_731_1738 301
220 3300048916 Ga0496113_0220163 Ga0496113_0220163_68_1138 301
221 3300048917 Ga0496114_0033829 Ga0496114_0033829_2320_3327 301
222 3300048917 Ga0496114_0153313 Ga0496114_0153313_283_1365 301
223 iso_pu_bacteria 2919051321 2919053212 301
224 3300000549 LJQas_1002334 LJQas_10023343 302
225 3300046528 Ga0495642_0007214 Ga0495642_0007214_1918_2847 302
226 3300046674 Ga0495588_0019274 Ga0495588_0019274_198_1115 302
227 3300046691 Ga0495670_0087967 Ga0495670_0087967_251_1168 302
228 3300047445 Ga0495677_0057291 Ga0495677_0057291_431_1360 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01715

IPPT

IPP transferase

39

259

0.95

PF01745

IPT

Isopentenyl transferase

4

114

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.9247 2 295
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.9207 2 295
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.9196 1 295
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.8948 2 295
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.8866 2 295
ID Description Score Start End Superfamily
3exaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9758 2 104 3.40.50.300
3d3qB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9693 2 104 3.40.50.300
3crrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9574 2 104 3.40.50.300
af_P9WJW1_115_180_1.10.20.140 Mainly Alpha;Orthogonal Bundle;Histone, subunit A; 0.9494 109 170 1.10.20.140
3a8tA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.943 2 105 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1X0QW13-F1-model_v4 IPPT-domain-containing protein 0.9879 1 104 GO:0005524
GO:0005739
GO:0006400
GO:0052381
AF-A0A7J5DR35-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.9815 1 298 GO:0005524
GO:0006400
GO:0052381
AF-A0A7J8YA77-F1-model_v4 Isopentenyltransferase 0.9814 1 104 GO:0005739
GO:0006400
GO:0009691
GO:0052381
AF-A0A496JYQ4-F1-model_v4 deleted 0.9798 1 97
AF-A0A7W1F6L5-F1-model_v4 AAA family ATPase 0.9792 2 100 GO:0005524
GO:0006400
GO:0052381

Feature Viewer

pLDDT pTM Quality
92.52 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map