F341195

General Info

Members Datasets Scaffolds Average Seq Length
228 133 223 345

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_079838|Ga0400483_079838_343_1512
Length 389
Sequence MEKIDARKLTIEAQQLVRNQVIRLRKAGKTYDEISEIVGIHRGTACRLFKSYERGGKAAVKIKKRGRAEGSCRTLEPDQEKELKKAITDKTPDQLKFPFALWTRKAVQQLVKQLFSIEMPIRTVGEYLKRWGFTPQKPLRRAYEQNPKLVQKWLDEQYPAITAKAKKEEAEIHWGDETGLCSDSQHGRSYAPKGKTPAIRLSAKKERINLISSITNQGKVRFMIYKKTMNAQVFIKFCRRLIKDSDRKIYLILDNLRVHHSHVVKDWVQQHKDKIELFFLPSYSPELNPDEYLNCDLKAGVHSGAPARSKDQLTKKAVSHLRKLQKTPKRVAKYFKHPKIAYAAQFTCFVAGLISIESSTFSKSRLFYEFNTELFVPFYRTLSRRTTIF

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
65 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
69 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
70 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
72 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
73 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
89 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
90 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
91 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
92 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
93 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
94 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
95 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
96 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
103 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
104 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
130 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
131 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
132 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
133 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 1.75
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.07
Nodule 0
Rhizoplane 6.14
Rhizosphere 69.3
Stem 0
Stem Tuber 0
Unclassified 21.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10028162 3300003659 Bacteria 1207
2 JGI25405J52794_10026186 3300003911 Bacteria 1197
3 Ga0070690_100256858 3300005330 Bacteria 1238
4 Ga0070670_100397929 3300005331 Bacteria 1216
5 Ga0070666_10265441 3300005335 Bacteria 1218
6 Ga0070673_100251048 3300005364 Bacteria 1542
7 Ga0070713_100084195 3300005436 Bacteria 2720
8 Ga0070708_100194914 3300005445 Unclassified 1895
9 Ga0070663_100279501 3300005455 Bacteria 1330
10 Ga0070678_100354267 3300005456 Bacteria 1263
11 Ga0070681_10252204 3300005458 Bacteria 1677
12 Ga0070706_100511063 3300005467 Bacteria 1117
13 Ga0070707_100333642 3300005468 Bacteria 1473
14 Ga0070698_100306658 3300005471 Bacteria 1518
15 Ga0070699_100388873 3300005518 Bacteria 1260
16 Ga0070679_100249677 3300005530 Bacteria 1731
17 Ga0070697_100424436 3300005536 Bacteria 1156
18 Ga0070665_100230815 3300005548 Bacteria 1851
19 Ga0070665_100292959 3300005548 Unclassified 1630
20 Ga0070664_100433614 3300005564 Bacteria 1205
21 Ga0068857_100413248 3300005577 Bacteria 1257
22 Ga0081455_10165312 3300005937 Bacteria 1691
23 Ga0081540_1080372 3300005983 Bacteria 1470
24 Ga0070717_10366923 3300006028 Bacteria 1289
25 Ga0070717_10383854 3300006028 Unclassified 1260
26 Ga0070715_10134642 3300006163 Bacteria 1193
27 Ga0075434_100476729 3300006871 Bacteria 1269
28 Ga0099794_10127549 3300007265 Unclassified 1283
29 Ga0105240_10537822 3300009093 Bacteria 1294
30 Ga0114129_10531778 3300009147 Bacteria 1531
31 Ga0105248_10110800 3300009177 Bacteria 3095
32 Ga0105248_10323444 3300009177 Bacteria 1737
33 Ga0105238_10347030 3300009551 Unclassified 1473
34 Ga0105238_10395639 3300009551 Bacteria 1374
35 Ga0105239_10487980 3300010375 Unclassified 1400
36 Ga0157369_10139490 3300013105 Bacteria 2566
37 Ga0157378_10417592 3300013297 Bacteria 1325
38 Ga0206351_10673200 3300020077 Bacteria 1508
39 Ga0154015_1696301 3300020610 Bacteria 1624
40 Ga0213873_10007991 3300021358 Bacteria 2142
41 Ga0213872_10000495 3300021361 Bacteria 31494
42 Ga0213874_10019426 3300021377 Bacteria 1849
43 Ga0213874_10033371 3300021377 Bacteria 1500
44 Ga0213876_10183522 3300021384 Unclassified 1113
45 Ga0213875_10112458 3300021388 Bacteria 1272
46 Ga0213871_10033597 3300021441 Bacteria 1349
47 Ga0224712_10057249 3300022467 Bacteria 1540
48 Ga0207697_10098774 3300025315 Bacteria 1243
49 Ga0207647_10109554 3300025904 Bacteria 1633
50 Ga0207699_10199941 3300025906 Bacteria 1353
51 Ga0207684_10109155 3300025910 Bacteria 2368
52 Ga0207649_10216281 3300025920 Bacteria 1362
53 Ga0207652_10136867 3300025921 Bacteria 2188
54 Ga0207646_10396705 3300025922 Bacteria 1246
55 Ga0207681_10328696 3300025923 Unclassified 1218
56 Ga0207694_10287960 3300025924 Unclassified 1350
57 Ga0207650_10278311 3300025925 Unclassified 1362
58 Ga0207687_10326056 3300025927 Bacteria 1244
59 Ga0207670_10175544 3300025936 Bacteria 1610
60 Ga0207711_10300266 3300025941 Unclassified 1481
61 Ga0207679_10279660 3300025945 Bacteria 1431
62 Ga0207712_10343604 3300025961 Unclassified 1238
63 Ga0207678_10147634 3300026067 Bacteria 2007
64 Ga0207678_10311117 3300026067 Unclassified 1354
65 Ga0207674_10585721 3300026116 Unclassified 1078
66 Ga0207683_10088892 3300026121 Bacteria 2749
67 Ga0207683_10246372 3300026121 Unclassified 1630
68 Ga0209588_1076640 3300027671 Unclassified 1080
69 Ga0268266_10175946 3300028379 Bacteria 1945
70 Ga0268266_10432682 3300028379 Unclassified 1248
71 Ga0265316_10314988 3300031344 Bacteria 1137
72 Ga0316575_10043287 3300031665 Unclassified 1784
73 Ga0316575_10088120 3300031665 Bacteria 1255
74 Ga0316579_10026116 3300031691 Bacteria 2642
75 Ga0316579_10103465 3300031691 Bacteria 1364
76 Ga0316579_10106542 3300031691 Unclassified 1344
77 Ga0316579_10116115 3300031691 Bacteria 1285
78 Ga0316579_10119338 3300031691 Unclassified 1267
79 Ga0316579_10119568 3300031691 Bacteria 1265
80 Ga0316576_10099227 3300031727 Bacteria 2175
81 Ga0316576_10169262 3300031727 Unclassified 1649
82 Ga0316576_10196975 3300031727 Bacteria 1518
83 Ga0316576_10254107 3300031727 Bacteria 1319
84 Ga0316576_10270634 3300031727 Bacteria 1273
85 Ga0316576_10292814 3300031727 Bacteria 1217
86 Ga0316576_10310990 3300031727 Unclassified 1176
87 Ga0316578_10039662 3300031728 Plasmid 2720
88 Ga0316578_10057035 3300031728 Bacteria 2294
89 Ga0316578_10212404 3300031728 Bacteria 1164
90 Ga0316577_10151249 3300031733 Bacteria 1308
91 Ga0316577_10204269 3300031733 Bacteria 1117
92 Ga0316580_10061551 3300032139 Bacteria 1152
93 Ga0316588_1030828 3300033528 Unclassified 1258
94 Ga0373949_0033109 3300035090 Unclassified 1240
95 Ga0373932_0052834 3300035112 Bacteria 1211
96 Ga0373936_0088045 3300035113 Bacteria 1299
97 Ga0373936_0095660 3300035113 Bacteria 1249
98 Ga0373945_0024076 3300035116 Unclassified 2107
99 Ga0373943_0140287 3300035170 Unclassified 1301
100 Ga0373943_0189926 3300035170 Unclassified 1133
101 Ga0373946_0026781 3300035171 Unclassified 2277
102 Ga0316574_0058052 3300035398 Bacteria 2424
103 Ga0316574_0122098 3300035398 Unclassified 1673
104 Ga0316574_0154441 3300035398 Bacteria 1479
105 Ga0316574_0216032 3300035398 Bacteria 1229
106 Ga0373935_0200562 3300035692 Unclassified 1378
107 Ga0373935_0249122 3300035692 Bacteria 1242
108 Ga0373927_0173863 3300035695 Unclassified 1412
109 Ga0373927_0192726 3300035695 Bacteria 1337
110 Ga0373927_0226140 3300035695 Bacteria 1229
111 Ga0373933_0208269 3300035724 Bacteria 1252
112 Ga0373947_0176870 3300035725 Bacteria 1387
113 Ga0373947_0186580 3300035725 Bacteria 1352
114 Ga0373947_0222389 3300035725 Unclassified 1241
115 Ga0373937_0349176 3300036401 Bacteria 1401
116 Ga0316582_0185421 3300036647 Bacteria 1416
117 Ga0316582_0188278 3300036647 Bacteria 1405
118 Ga0316582_0191191 3300036647 Unclassified 1394
119 Ga0316582_0226800 3300036647 Unclassified 1278
120 Ga0316582_0227437 3300036647 Bacteria 1276
121 Ga0316582_0230020 3300036647 Bacteria 1269
122 Ga0316582_0230880 3300036647 Bacteria 1266
123 Ga0316582_0289542 3300036647 Unclassified 1124
124 Ga0316584_0102363 3300036712 Bacteria 2145
125 Ga0316584_0112896 3300036712 Bacteria 2033
126 Ga0316584_0198418 3300036712 Bacteria 1481
127 Ga0316584_0209535 3300036712 Bacteria 1435
128 Ga0316584_0212491 3300036712 Bacteria 1423
129 Ga0316584_0223736 3300036712 Bacteria 1381
130 Ga0316584_0226014 3300036712 Unclassified 1373
131 Ga0316584_0276390 3300036712 Bacteria 1221
132 Ga0316584_0336095 3300036712 Unclassified 1087
133 Ga0373925_0272179 3300037068 Unclassified 1362
134 Ga0395900_0343173 3300037418 Unclassified 1468
135 Ga0436364_0152271 3300037853 Bacteria 2339
136 Ga0436364_0583257 3300037853 Bacteria 1224
137 Ga0436364_0782511 3300037853 Bacteria 1973
138 Ga0400484_23356 3300038725 Bacteria 4547
139 Ga0400484_32071 3300038725 Bacteria 1264
140 Ga0400490_12282 3300038726 Bacteria 1123
141 Ga0400490_12469 3300038726 Unclassified 1430
142 Ga0400490_59200 3300038726 Unclassified 1271
143 Ga0400491_15340 3300038727 Bacteria 1654
144 Ga0400491_15872 3300038727 Bacteria 1226
145 Ga0400491_21703 3300038727 Bacteria 4379
146 Ga0400485_04528 3300038735 Bacteria 9299
147 Ga0400485_08051 3300038735 Bacteria 1295
148 Ga0400485_19927 3300038735 Bacteria 2848
149 Ga0400488_20137 3300038741 Unclassified 1387
150 Ga0400488_24281 3300038741 Bacteria 1172
151 Ga0400488_30929 3300038741 Bacteria 1430
152 Ga0400488_36568 3300038741 Bacteria 4118
153 Ga0400486_00908 3300038742 Bacteria 1613
154 Ga0400486_04649 3300038742 Bacteria 1975
155 Ga0400486_07034 3300038742 Bacteria 1346
156 Ga0400486_12871 3300038742 Bacteria 4571
157 Ga0400486_26065 3300038742 Bacteria 1487
158 Ga0400486_30504 3300038742 Bacteria 5073
159 Ga0400483_028568 3300039062 Bacteria 2602
160 Ga0400483_079838 3300039062 Bacteria 3035
161 Ga0400483_123692 3300039062 Bacteria 1257
162 Ga0400483_143347 3300039062 Bacteria 1805
163 Ga0400483_159519 3300039062 Bacteria 1756
164 Ga0400483_276032 3300039062 Bacteria 3149
165 Ga0400489_52173 3300039093 Bacteria 5920
166 Ga0400489_70377 3300039093 Bacteria 1281
167 Ga0400489_71393 3300039093 Bacteria 5669
168 Ga0400489_80358 3300039093 Bacteria 1167
169 Ga0400487_07790 3300039110 Bacteria 1525
170 Ga0400487_12262 3300039110 Bacteria 1091
171 Ga0400487_24941 3300039110 Bacteria 1580
172 Ga0400487_40610 3300039110 Unclassified 1390
173 Ga0400487_59329 3300039110 Unclassified 1573
174 Ga0400487_66044 3300039110 Bacteria 1264
175 Ga0436365_0539272 3300039437 Bacteria 3720
176 Ga0436360_0154299 3300039438 Bacteria 1296
177 Ga0436360_0264444 3300039438 Bacteria 2684
178 Ga0436360_0333868 3300039438 Unclassified 1162
179 Ga0436360_1325616 3300039438 Bacteria 1709
180 Ga0436361_0881322 3300039447 Bacteria 5565
181 Ga0436363_0443126 3300039450 Unclassified 1044
182 Ga0436363_0500396 3300039450 Unclassified 1844
183 Ga0436362_0353868 3300039453 Bacteria 1555
184 Ga0436362_0363903 3300039453 Unclassified 1744
185 Ga0439438_039807 3300041405 Bacteria 1223
186 Ga0439447_033606 3300041407 Bacteria 1278
187 Ga0439452_016245 3300042010 Bacteria 2025
188 Ga0466968_0066970 3300044735 Bacteria 1556
189 Ga0466959_0225253 3300045049 Bacteria 1299
190 Ga0495629_0200944 3300046459 Bacteria 1378
191 Ga0495629_0239657 3300046459 Unclassified 1249
192 Ga0495641_0088288 3300046461 Unclassified 1387
193 Ga0495582_0091863 3300046473 Unclassified 1693
194 Ga0495594_0119626 3300046499 Bacteria 1488
195 Ga0495618_0268205 3300046514 Bacteria 1067
196 Ga0495640_0196554 3300046533 Unclassified 1280
197 Ga0495624_0159928 3300046690 Unclassified 1376
198 Ga0496102_0161808 3300048905 Unclassified 2105
199 Ga0496102_0388798 3300048905 Bacteria 1312
200 Ga0496104_0320763 3300048907 Unclassified 1462
201 Ga0496106_0262036 3300048909 Bacteria 1383
202 Ga0496106_0322064 3300048909 Unclassified 1241
203 Ga0496106_0435366 3300048909 Bacteria 1054
204 Ga0496107_0157475 3300048910 Bacteria 1682
205 Ga0496109_0332919 3300048912 Bacteria 1433
206 Ga0496109_0502117 3300048912 Bacteria 1145
207 Ga0496112_0530714 3300048915 Unclassified 1111
208 Ga0496113_0305180 3300048916 Bacteria 1275
209 Ga0496114_0361570 3300048917 Bacteria 1284
210 Ga0496114_0408775 3300048917 Bacteria 1202
211 Ga0496115_0193094 3300048918 Unclassified 1682
212 Ga0496117_0123070 3300048920 Unclassified 1589
213 Ga0496118_0164110 3300048921 Unclassified 1368
214 nmdc:mga0n895_450890_c1 3300050512 Bacteria 1299
215 Ga0495612_0079888 3300053078 Unclassified 1373
216 Ga0500635_0076233 3300053080 Unclassified 1198
217 Ga0495619_0276088 3300053085 Unclassified 1164
218 Ga0500594_0054755 3300053118 Bacteria 1133
219 Ga0500603_038949 3300053150 Unclassified 1260
220 Ga0500637_0167118 3300053178 Bacteria 1266
221 Ga0500637_0208647 3300053178 Bacteria 1109
222 Ga0500637_0211022 3300053178 Unclassified 1101
223 Ga0500576_115668 3300053725 Bacteria 1066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046473 Ga0495582_0091863 Ga0495582_0091863_305_1243 310
2 3300021361 Ga0213872_10000495 Ga0213872_100004953 314
3 3300038742 Ga0400486_12871 Ga0400486_12871_3456_4406 314
4 3300039062 Ga0400483_123692 Ga0400483_123692_118_1143 316
5 3300039450 Ga0436363_0443126 Ga0436363_0443126_27_992 317
6 3300053178 Ga0500637_0208647 Ga0500637_0208647_19_1044 319
7 3300031727 Ga0316576_10196975 Ga0316576_101969751 320
8 3300038735 Ga0400485_08051 Ga0400485_08051_143_1177 322
9 3300038742 Ga0400486_07034 Ga0400486_07034_144_1178 322
10 3300039438 Ga0436360_0333868 Ga0436360_0333868_62_1054 322
11 3300031691 Ga0316579_10026116 Ga0316579_100261162 325
12 3300009147 Ga0114129_10531778 Ga0114129_105317782 326
13 3300035724 Ga0373933_0208269 Ga0373933_0208269_41_1102 327
14 3300036401 Ga0373937_0349176 Ga0373937_0349176_225_1286 327
15 3300048909 Ga0496106_0435366 Ga0496106_0435366_13_1020 327
16 3300039438 Ga0436360_1325616 Ga0436360_1325616_475_1482 332
17 3300031344 Ga0265316_10314988 Ga0265316_103149881 333
18 3300005436 Ga0070713_100084195 Ga0070713_1000841951 335
19 3300005445 Ga0070708_100194914 Ga0070708_1001949142 335
20 3300005458 Ga0070681_10252204 Ga0070681_102522042 335
21 3300005467 Ga0070706_100511063 Ga0070706_1005110631 335
22 3300005468 Ga0070707_100333642 Ga0070707_1003336422 335
23 3300005471 Ga0070698_100306658 Ga0070698_1003066581 335
24 3300005518 Ga0070699_100388873 Ga0070699_1003888731 335
25 3300005530 Ga0070679_100249677 Ga0070679_1002496771 335
26 3300005536 Ga0070697_100424436 Ga0070697_1004244361 335
27 3300005577 Ga0068857_100413248 Ga0068857_1004132482 335
28 3300006028 Ga0070717_10366923 Ga0070717_103669232 335
29 3300007265 Ga0099794_10127549 Ga0099794_101275491 335
30 3300009093 Ga0105240_10537822 Ga0105240_105378221 335
31 3300013105 Ga0157369_10139490 Ga0157369_101394902 335
32 3300020077 Ga0206351_10673200 Ga0206351_106732001 335
33 3300020610 Ga0154015_1696301 Ga0154015_16963012 335
34 3300022467 Ga0224712_10057249 Ga0224712_100572491 335
35 3300025904 Ga0207647_10109554 Ga0207647_101095542 335
36 3300025910 Ga0207684_10109155 Ga0207684_101091552 335
37 3300025921 Ga0207652_10136867 Ga0207652_101368672 335
38 3300025922 Ga0207646_10396705 Ga0207646_103967051 335
39 3300026067 Ga0207678_10147634 Ga0207678_101476342 335
40 3300026116 Ga0207674_10585721 Ga0207674_105857211 335
41 3300027671 Ga0209588_1076640 Ga0209588_10766401 335
42 3300037853 Ga0436364_0782511 Ga0436364_0782511_419_1438 335
43 3300044735 Ga0466968_0066970 Ga0466968_0066970_372_1391 335
44 3300031691 Ga0316579_10103465 Ga0316579_101034652 337
45 3300038727 Ga0400491_21703 Ga0400491_21703_119_1144 338
46 3300046459 Ga0495629_0200944 Ga0495629_0200944_66_1091 338
47 3300046461 Ga0495641_0088288 Ga0495641_0088288_233_1258 338
48 3300046499 Ga0495594_0119626 Ga0495594_0119626_49_1074 338
49 3300046514 Ga0495618_0268205 Ga0495618_0268205_12_1037 338
50 3300053080 Ga0500635_0076233 Ga0500635_0076233_52_1077 338
51 3300053150 Ga0500603_038949 Ga0500603_038949_178_1203 338
52 3300053178 Ga0500637_0167118 Ga0500637_0167118_93_1118 338
53 3300053178 Ga0500637_0211022 Ga0500637_0211022_13_1038 338
54 iso_pu_bacteria 640427133 640486508 338
55 iso_pu_bacteria 640427133 640486656 338
56 iso_pu_bacteria 640427133 640488822 338
57 iso_pu_bacteria 640427133 640489046 338
58 iso_pu_bacteria 640427133 640489371 338
59 3300010375 Ga0105239_10487980 Ga0105239_104879801 339
60 3300025924 Ga0207694_10287960 Ga0207694_102879601 339
61 3300035090 Ga0373949_0033109 Ga0373949_0033109_136_1164 339
62 3300036647 Ga0316582_0191191 Ga0316582_0191191_251_1285 341
63 3300037853 Ga0436364_0152271 Ga0436364_0152271_1181_2218 341
64 3300021377 Ga0213874_10033371 Ga0213874_100333711 342
65 3300031665 Ga0316575_10043287 Ga0316575_100432871 342
66 3300031665 Ga0316575_10088120 Ga0316575_100881201 342
67 3300031691 Ga0316579_10106542 Ga0316579_101065422 342
68 3300031691 Ga0316579_10116115 Ga0316579_101161151 342
69 3300031691 Ga0316579_10119338 Ga0316579_101193381 342
70 3300031691 Ga0316579_10119568 Ga0316579_101195681 342
71 3300031727 Ga0316576_10099227 Ga0316576_100992272 342
72 3300031727 Ga0316576_10254107 Ga0316576_102541072 342
73 3300031727 Ga0316576_10270634 Ga0316576_102706341 342
74 3300031727 Ga0316576_10292814 Ga0316576_102928142 342
75 3300031727 Ga0316576_10310990 Ga0316576_103109901 342
76 3300031728 Ga0316578_10039662 Ga0316578_100396623 342
77 3300031728 Ga0316578_10057035 Ga0316578_100570352 342
78 3300031728 Ga0316578_10212404 Ga0316578_102124041 342
79 3300031733 Ga0316577_10204269 Ga0316577_102042691 342
80 3300032139 Ga0316580_10061551 Ga0316580_100615511 342
81 3300033528 Ga0316588_1030828 Ga0316588_10308281 342
82 3300035398 Ga0316574_0058052 Ga0316574_0058052_1245_2291 342
83 3300035398 Ga0316574_0154441 Ga0316574_0154441_70_1104 342
84 3300035398 Ga0316574_0216032 Ga0316574_0216032_94_1128 342
85 3300036647 Ga0316582_0185421 Ga0316582_0185421_105_1139 342
86 3300036647 Ga0316582_0188278 Ga0316582_0188278_284_1318 342
87 3300036647 Ga0316582_0226800 Ga0316582_0226800_199_1233 342
88 3300036647 Ga0316582_0227437 Ga0316582_0227437_101_1135 342
89 3300036647 Ga0316582_0230020 Ga0316582_0230020_202_1236 342
90 3300036647 Ga0316582_0289542 Ga0316582_0289542_22_1056 342
91 3300036712 Ga0316584_0102363 Ga0316584_0102363_357_1391 342
92 3300036712 Ga0316584_0112896 Ga0316584_0112896_893_1939 342
93 3300036712 Ga0316584_0198418 Ga0316584_0198418_309_1343 342
94 3300036712 Ga0316584_0209535 Ga0316584_0209535_98_1132 342
95 3300036712 Ga0316584_0212491 Ga0316584_0212491_235_1269 342
96 3300036712 Ga0316584_0226014 Ga0316584_0226014_162_1196 342
97 3300036712 Ga0316584_0276390 Ga0316584_0276390_74_1108 342
98 3300036712 Ga0316584_0336095 Ga0316584_0336095_16_1050 342
99 3300037418 Ga0395900_0343173 Ga0395900_0343173_53_1090 342
100 3300038725 Ga0400484_23356 Ga0400484_23356_428_1462 342
101 3300038725 Ga0400484_32071 Ga0400484_32071_114_1148 342
102 3300038726 Ga0400490_12282 Ga0400490_12282_59_1093 342
103 3300038726 Ga0400490_12469 Ga0400490_12469_208_1242 342
104 3300038726 Ga0400490_59200 Ga0400490_59200_210_1244 342
105 3300038727 Ga0400491_15340 Ga0400491_15340_325_1359 342
106 3300038727 Ga0400491_15872 Ga0400491_15872_92_1126 342
107 3300038735 Ga0400485_04528 Ga0400485_04528_8100_9134 342
108 3300038735 Ga0400485_19927 Ga0400485_19927_1670_2704 342
109 3300038741 Ga0400488_20137 Ga0400488_20137_318_1352 342
110 3300038741 Ga0400488_24281 Ga0400488_24281_29_1063 342
111 3300038741 Ga0400488_30929 Ga0400488_30929_309_1343 342
112 3300038741 Ga0400488_36568 Ga0400488_36568_2969_4003 342
113 3300038742 Ga0400486_00908 Ga0400486_00908_418_1452 342
114 3300038742 Ga0400486_04649 Ga0400486_04649_50_1084 342
115 3300038742 Ga0400486_26065 Ga0400486_26065_271_1305 342
116 3300038742 Ga0400486_30504 Ga0400486_30504_3011_4045 342
117 3300039062 Ga0400483_028568 Ga0400483_028568_1438_2472 342
118 3300039062 Ga0400483_143347 Ga0400483_143347_532_1566 342
119 3300039062 Ga0400483_159519 Ga0400483_159519_62_1096 342
120 3300039062 Ga0400483_276032 Ga0400483_276032_1871_2905 342
121 3300039093 Ga0400489_52173 Ga0400489_52173_3960_4994 342
122 3300039093 Ga0400489_70377 Ga0400489_70377_93_1127 342
123 3300039093 Ga0400489_71393 Ga0400489_71393_3556_4590 342
124 3300039093 Ga0400489_80358 Ga0400489_80358_65_1099 342
125 3300039110 Ga0400487_07790 Ga0400487_07790_172_1206 342
126 3300039110 Ga0400487_12262 Ga0400487_12262_17_1051 342
127 3300039110 Ga0400487_24941 Ga0400487_24941_104_1138 342
128 3300039110 Ga0400487_40610 Ga0400487_40610_167_1201 342
129 3300039110 Ga0400487_59329 Ga0400487_59329_158_1192 342
130 3300039110 Ga0400487_66044 Ga0400487_66044_122_1156 342
131 3300041405 Ga0439438_039807 Ga0439438_039807_54_1091 342
132 3300041407 Ga0439447_033606 Ga0439447_033606_98_1135 342
133 3300042010 Ga0439452_016245 Ga0439452_016245_811_1848 342
134 3300053725 Ga0500576_115668 Ga0500576_115668_20_1054 342
135 3300005331 Ga0070670_100397929 Ga0070670_1003979291 343
136 3300005335 Ga0070666_10265441 Ga0070666_102654411 343
137 3300005364 Ga0070673_100251048 Ga0070673_1002510481 343
138 3300005456 Ga0070678_100354267 Ga0070678_1003542671 343
139 3300005548 Ga0070665_100230815 Ga0070665_1002308152 343
140 3300005564 Ga0070664_100433614 Ga0070664_1004336141 343
141 3300009177 Ga0105248_10323444 Ga0105248_103234442 343
142 3300009551 Ga0105238_10395639 Ga0105238_103956391 343
143 3300025315 Ga0207697_10098774 Ga0207697_100987741 343
144 3300025923 Ga0207681_10328696 Ga0207681_103286961 343
145 3300025927 Ga0207687_10326056 Ga0207687_103260561 343
146 3300025945 Ga0207679_10279660 Ga0207679_102796602 343
147 3300026121 Ga0207683_10088892 Ga0207683_100888922 343
148 3300028379 Ga0268266_10175946 Ga0268266_101759462 343
149 3300031727 Ga0316576_10169262 Ga0316576_101692621 343
150 3300031733 Ga0316577_10151249 Ga0316577_101512492 343
151 3300035398 Ga0316574_0122098 Ga0316574_0122098_54_1091 343
152 3300036647 Ga0316582_0230880 Ga0316582_0230880_117_1148 343
153 3300036712 Ga0316584_0223736 Ga0316584_0223736_64_1104 343
154 3300039062 Ga0400483_079838 Ga0400483_079838_343_1512 343
155 3300045049 Ga0466959_0225253 Ga0466959_0225253_170_1216 343
156 3300048910 Ga0496107_0157475 Ga0496107_0157475_528_1586 343
157 3300005330 Ga0070690_100256858 Ga0070690_1002568581 344
158 3300005455 Ga0070663_100279501 Ga0070663_1002795011 344
159 3300005548 Ga0070665_100292959 Ga0070665_1002929592 344
160 3300006028 Ga0070717_10383854 Ga0070717_103838541 344
161 3300006163 Ga0070715_10134642 Ga0070715_101346421 344
162 3300006871 Ga0075434_100476729 Ga0075434_1004767291 344
163 3300009177 Ga0105248_10110800 Ga0105248_101108002 344
164 3300009551 Ga0105238_10347030 Ga0105238_103470301 344
165 3300013297 Ga0157378_10417592 Ga0157378_104175922 344
166 3300021358 Ga0213873_10007991 Ga0213873_100079912 344
167 3300021377 Ga0213874_10019426 Ga0213874_100194261 344
168 3300021384 Ga0213876_10183522 Ga0213876_101835221 344
169 3300021388 Ga0213875_10112458 Ga0213875_101124581 344
170 3300021441 Ga0213871_10033597 Ga0213871_100335971 344
171 3300025906 Ga0207699_10199941 Ga0207699_101999412 344
172 3300025920 Ga0207649_10216281 Ga0207649_102162811 344
173 3300025925 Ga0207650_10278311 Ga0207650_102783111 344
174 3300025936 Ga0207670_10175544 Ga0207670_101755442 344
175 3300025941 Ga0207711_10300266 Ga0207711_103002662 344
176 3300025961 Ga0207712_10343604 Ga0207712_103436041 344
177 3300026067 Ga0207678_10311117 Ga0207678_103111171 344
178 3300026121 Ga0207683_10246372 Ga0207683_102463721 344
179 3300028379 Ga0268266_10432682 Ga0268266_104326821 344
180 3300035112 Ga0373932_0052834 Ga0373932_0052834_95_1156 344
181 3300035113 Ga0373936_0088045 Ga0373936_0088045_10_1056 344
182 3300035113 Ga0373936_0095660 Ga0373936_0095660_86_1132 344
183 3300035116 Ga0373945_0024076 Ga0373945_0024076_148_1194 344
184 3300035170 Ga0373943_0140287 Ga0373943_0140287_128_1174 344
185 3300035170 Ga0373943_0189926 Ga0373943_0189926_28_1089 344
186 3300035171 Ga0373946_0026781 Ga0373946_0026781_990_2036 344
187 3300035692 Ga0373935_0200562 Ga0373935_0200562_180_1226 344
188 3300035692 Ga0373935_0249122 Ga0373935_0249122_85_1131 344
189 3300035695 Ga0373927_0173863 Ga0373927_0173863_245_1306 344
190 3300035695 Ga0373927_0192726 Ga0373927_0192726_166_1212 344
191 3300035695 Ga0373927_0226140 Ga0373927_0226140_138_1184 344
192 3300035725 Ga0373947_0176870 Ga0373947_0176870_316_1377 344
193 3300035725 Ga0373947_0186580 Ga0373947_0186580_58_1104 344
194 3300035725 Ga0373947_0222389 Ga0373947_0222389_80_1126 344
195 3300037068 Ga0373925_0272179 Ga0373925_0272179_141_1187 344
196 3300037853 Ga0436364_0583257 Ga0436364_0583257_56_1117 344
197 3300039437 Ga0436365_0539272 Ga0436365_0539272_121_1182 344
198 3300039438 Ga0436360_0154299 Ga0436360_0154299_118_1179 344
199 3300039438 Ga0436360_0264444 Ga0436360_0264444_262_1323 344
200 3300039447 Ga0436361_0881322 Ga0436361_0881322_4245_5306 344
201 3300039450 Ga0436363_0500396 Ga0436363_0500396_563_1624 344
202 3300039453 Ga0436362_0353868 Ga0436362_0353868_155_1216 344
203 3300039453 Ga0436362_0363903 Ga0436362_0363903_414_1475 344
204 3300046459 Ga0495629_0239657 Ga0495629_0239657_150_1211 344
205 3300046533 Ga0495640_0196554 Ga0495640_0196554_124_1170 344
206 3300046690 Ga0495624_0159928 Ga0495624_0159928_166_1212 344
207 3300048905 Ga0496102_0161808 Ga0496102_0161808_348_1409 344
208 3300048905 Ga0496102_0388798 Ga0496102_0388798_43_1104 344
209 3300048907 Ga0496104_0320763 Ga0496104_0320763_203_1264 344
210 3300048909 Ga0496106_0262036 Ga0496106_0262036_83_1144 344
211 3300048909 Ga0496106_0322064 Ga0496106_0322064_78_1139 344
212 3300048912 Ga0496109_0332919 Ga0496109_0332919_32_1093 344
213 3300048912 Ga0496109_0502117 Ga0496109_0502117_12_1073 344
214 3300048915 Ga0496112_0530714 Ga0496112_0530714_25_1086 344
215 3300048916 Ga0496113_0305180 Ga0496113_0305180_64_1125 344
216 3300048917 Ga0496114_0361570 Ga0496114_0361570_12_1073 344
217 3300048917 Ga0496114_0408775 Ga0496114_0408775_146_1192 344
218 3300048918 Ga0496115_0193094 Ga0496115_0193094_472_1518 344
219 3300048920 Ga0496117_0123070 Ga0496117_0123070_223_1284 344
220 3300048921 Ga0496118_0164110 Ga0496118_0164110_262_1323 344
221 3300050512 nmdc:mga0n895_450890_c1 nmdc:mga0n895_450890_c1_173_1234 344
222 3300053078 Ga0495612_0079888 Ga0495612_0079888_170_1216 344
223 3300053085 Ga0495619_0276088 Ga0495619_0276088_107_1153 344
224 3300003659 JGI25404J52841_10028162 JGI25404J52841_100281621 345
225 3300003911 JGI25405J52794_10026186 JGI25405J52794_100261861 345
226 3300005937 Ga0081455_10165312 Ga0081455_101653122 345
227 3300005983 Ga0081540_1080372 Ga0081540_10803722 345
228 3300053118 Ga0500594_0054755 Ga0500594_0054755_72_1109 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13358

DDE_3

DDE superfamily endonuclease

171

314

0.98

PF13592

HTH_33

Winged helix-turn helix

98

157

0.97

PF13384

HTH_23

Homeodomain-like domain

12

61

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bhy-assembly1.cif.gz_A dna-binding domain of deor in complex with the dna operator 0.8328 13 58
3vqd-assembly1.cif.gz_B hiv-1 in core domain in complex with 5-methyl-3-phenyl-1,2-oxazole-4-carboxylic acid 0.7907 171 322
3vq6-assembly1.cif.gz_A hiv-1 in core domain in complex with (1-methyl-5-phenyl-1h-pyrazol-4-yl)methanol 0.7654 171 323
6vka-assembly1.cif.gz_B hiv integrase core domain (in) in complex with dimer-spanning ligand 0.756 171 322
7l1p-assembly1.cif.gz_A hiv integrase core domain (in) in complex with dimer-spanning ligand 0.7422 171 322
ID Description Score Start End Superfamily
af_Q21972_79_144_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8794 10 57 1.10.10.10
af_P9WLC5_172_234_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.875 21 55 1.10.10.10
af_P23758_5_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8684 16 67 1.10.10.10
af_Q2G2N6_1_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8505 18 55 1.10.10.10
1zt9D00 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;TrpR-like 0.8147 12 61 1.10.1270.10
ID Description Score Start End GO Terms
AF-A0A6H1RB55-F1-model_v4 Transposase 0.9774 209 344 GO:0003676
AF-A0A4R4XY27-F1-model_v4 Transposase 0.9746 207 342 GO:0003676
AF-A0A6M5YYN3-F1-model_v4 Mobile element protein 0.9683 211 345 GO:0003676
AF-R9J500-F1-model_v4 Tc1-like transposase DDE domain-containing protein 0.9647 211 342 GO:0003676
AF-A0A6H1RB55-F1-model_v4 Transposase 0.9565 209 344 GO:0003676

Feature Viewer

pLDDT pTM Quality
88.35 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map