F341128

General Info

Members Datasets Scaffolds Average Seq Length
228 155 456 349

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10008139|Ga0307411_100081395
Length 380
Sequence MRFALIPGDGIGRDVVPEAVRVIRRVGDVFGRTFEIEQLPWGADYYLSTGITVPANGYAMLQDEFDAILVGALGDPRVPDGRHARDIVLGIRFELDLYVNYRPVVLFDARLCPLKGRAPADVDIAIFRENTEGVYVGVGGRVKPGTEDEIAIQEEVNTWKGVHRIVRYAFEWARAHGRARVCMTDKSNAMAQGHALWQRVFREVAPEFRDIQATHQYIDALVLQMVRDPAQFDVIVTNNLFGDIITDLGAALQGGLGMAASANVHPGRTSMFEPVHGSAPPLAGKNVANPMGAVLSAGLMLATLGFAEEADAIEHAVRNVVAAGIGTPDVGGTQGTTEVGDAIVRAILASRDGQVSPQAAGARGLGSGPEDSSAAAGGRE

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
149 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
155 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.09
Nodule 0
Rhizoplane 0.88
Rhizosphere 87.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10008139 3300032005 Bacteria 5409
2 Ga0065712_10137847 3300005290 Bacteria 1479
3 Ga0070680_100140117 3300005336 Bacteria 2028
4 Ga0068868_100011123 3300005338 Bacteria 6549
5 Ga0070669_100138878 3300005353 Bacteria 1871
6 Ga0070688_100066118 3300005365 Bacteria 2300
7 Ga0070667_100162394 3300005367 Bacteria 1968
8 Ga0070703_10001997 3300005406 Bacteria 5967
9 Ga0070713_100010672 3300005436 Bacteria 6650
10 Ga0070705_100025286 3300005440 Bacteria 3217
11 Ga0070705_100147042 3300005440 Bacteria 1558
12 Ga0070694_100054535 3300005444 Bacteria 2708
13 Ga0070708_100015773 3300005445 Bacteria 6245
14 Ga0070708_100041030 3300005445 Bacteria 4056
15 Ga0070708_100108506 3300005445 Bacteria 2550
16 Ga0070708_100209107 3300005445 Bacteria 1828
17 Ga0070681_10325460 3300005458 Bacteria 1447
18 Ga0068867_100054577 3300005459 Bacteria 2952
19 Ga0070706_100000005 3300005467 Bacteria 264211
20 Ga0070706_100153673 3300005467 Bacteria 2148
21 Ga0070707_100032723 3300005468 Bacteria 4955
22 Ga0070698_100000438 3300005471 Bacteria 44134
23 Ga0070698_100050064 3300005471 Bacteria 4261
24 Ga0070697_100024554 3300005536 Bacteria 4799
25 Ga0070697_100057422 3300005536 Bacteria 3166
26 Ga0070693_100066042 3300005547 Bacteria 2116
27 Ga0070704_100004427 3300005549 Bacteria 8114
28 Ga0068855_100286042 3300005563 Bacteria 1829
29 Ga0068856_100163015 3300005614 Bacteria 2241
30 Ga0068859_100097908 3300005617 Bacteria 2987
31 Ga0068863_100070165 3300005841 Bacteria 3313
32 Ga0068858_100235617 3300005842 Bacteria 1736
33 Ga0068860_100047275 3300005843 Bacteria 4102
34 Ga0068860_100188631 3300005843 Bacteria 1995
35 Ga0075365_10017526 3300006038 Bacteria 4383
36 Ga0075364_10002548 3300006051 Bacteria 10208
37 Ga0075364_10018121 3300006051 Bacteria 4405
38 Ga0075364_10135322 3300006051 Bacteria 1655
39 Ga0075364_10149233 3300006051 Bacteria 1575
40 Ga0070716_100035760 3300006173 Bacteria 2733
41 Ga0075362_10001216 3300006177 Bacteria 8094
42 Ga0075367_10001652 3300006178 Bacteria 9716
43 Ga0075367_10030977 3300006178 Bacteria 3070
44 Ga0075367_10093164 3300006178 Bacteria 1835
45 Ga0075366_10003530 3300006195 Bacteria 8262
46 Ga0075366_10063125 3300006195 Bacteria 2201
47 Ga0097621_100154836 3300006237 Bacteria 1967
48 Ga0075370_10006219 3300006353 Bacteria 5989
49 Ga0068871_100214750 3300006358 Bacteria 1665
50 Ga0068871_100280252 3300006358 Bacteria 1458
51 Ga0068871_100368957 3300006358 Bacteria 1273
52 Ga0068871_100378745 3300006358 Bacteria 1257
53 Ga0075428_100003096 3300006844 Bacteria 18151
54 Ga0075430_100007337 3300006846 Bacteria 9314
55 Ga0075433_10001211 3300006852 Bacteria 18816
56 Ga0075433_10002356 3300006852 Bacteria 14369
57 Ga0075433_10005074 3300006852 Bacteria 10323
58 Ga0075433_10097657 3300006852 Bacteria 2600
59 Ga0075434_100019252 3300006871 Bacteria 6603
60 Ga0075434_100054230 3300006871 Bacteria 3983
61 Ga0075434_100071844 3300006871 Bacteria 3452
62 Ga0075434_100118516 3300006871 Bacteria 2661
63 Ga0075434_100415350 3300006871 Bacteria 1366
64 Ga0075429_100246827 3300006880 Bacteria 1563
65 Ga0075436_100057147 3300006914 Bacteria 2695
66 Ga0075436_100079623 3300006914 Bacteria 2270
67 Ga0097620_100097905 3300006931 Bacteria 2987
68 Ga0097620_100207821 3300006931 Bacteria 2043
69 Ga0075435_100012029 3300007076 Bacteria 6393
70 Ga0075435_100086612 3300007076 Bacteria 2580
71 Ga0105240_10120011 3300009093 Bacteria 3167
72 Ga0111539_10001112 3300009094 Bacteria 35521
73 Ga0111539_10003913 3300009094 Bacteria 19583
74 Ga0111539_10004464 3300009094 Bacteria 18296
75 Ga0111539_10032736 3300009094 Bacteria 6313
76 Ga0111539_10062428 3300009094 Bacteria 4411
77 Ga0111539_10170339 3300009094 Bacteria 2544
78 Ga0111539_10395938 3300009094 Bacteria 1609
79 Ga0114129_10001613 3300009147 Bacteria 30618
80 Ga0114129_10003815 3300009147 Bacteria 21246
81 Ga0114129_10077294 3300009147 Bacteria 4630
82 Ga0114129_10198870 3300009147 Bacteria 2716
83 Ga0114129_10258921 3300009147 Bacteria 2333
84 Ga0114129_10267618 3300009147 Bacteria 2288
85 Ga0105241_10071613 3300009174 Bacteria 2691
86 Ga0105248_10006576 3300009177 Bacteria 12744
87 Ga0105237_10079675 3300009545 Bacteria 3265
88 Ga0157378_10303742 3300013297 Bacteria 1545
89 Ga0157375_10052433 3300013308 Bacteria 4010
90 Ga0163163_10000034 3300014325 Bacteria 161820
91 Ga0157380_10007657 3300014326 Bacteria 7680
92 Ga0157376_10248307 3300014969 Bacteria 1661
93 Ga0213876_10044404 3300021384 Bacteria 2349
94 Ga0207653_10001004 3300025885 Bacteria 9298
95 Ga0207710_10010988 3300025900 Bacteria 3814
96 Ga0207688_10100299 3300025901 Bacteria 1671
97 Ga0207707_10056833 3300025912 Bacteria 3405
98 Ga0207707_10078448 3300025912 Bacteria 2884
99 Ga0207695_10088833 3300025913 Bacteria 3109
100 Ga0207693_10054411 3300025915 Bacteria 3139
101 Ga0207660_10165701 3300025917 Bacteria 1708
102 Ga0207646_10028792 3300025922 Bacteria 5054
103 Ga0207687_10262032 3300025927 Bacteria 1378
104 Ga0207700_10025733 3300025928 Bacteria 4092
105 Ga0207664_10020836 3300025929 Bacteria 4865
106 Ga0207644_10176176 3300025931 Bacteria 1673
107 Ga0207670_10001129 3300025936 Bacteria 14054
108 Ga0207670_10119452 3300025936 Bacteria 1913
109 Ga0207670_10162145 3300025936 Bacteria 1670
110 Ga0207665_10004000 3300025939 Bacteria 9849
111 Ga0207711_10317294 3300025941 Bacteria 1440
112 Ga0207667_10283224 3300025949 Bacteria 1694
113 Ga0207668_10231515 3300025972 Bacteria 1490
114 Ga0207658_10119859 3300025986 Bacteria 2096
115 Ga0207677_10003804 3300026023 Bacteria 8018
116 Ga0207703_10308229 3300026035 Bacteria 1446
117 Ga0207641_10063310 3300026088 Bacteria 3159
118 Ga0207648_10090917 3300026089 Bacteria 2668
119 Ga0207428_10000145 3300027907 Bacteria 96603
120 Ga0207428_10016989 3300027907 Bacteria 6253
121 Ga0268265_10032078 3300028380 Bacteria 3801
122 Ga0268264_10026814 3300028381 Bacteria 4708
123 Ga0265319_1000409 3300028563 Bacteria 30987
124 Ga0265318_10000057 3300028577 Bacteria 112029
125 Ga0265318_10000720 3300028577 Bacteria 22212
126 Ga0265338_10078848 3300028800 Bacteria 2775
127 Ga0265330_10000039 3300031235 Bacteria 119986
128 Ga0265332_10000051 3300031238 Bacteria 111978
129 Ga0265328_10001829 3300031239 Bacteria 9695
130 Ga0265320_10000264 3300031240 Bacteria 43360
131 Ga0265320_10025106 3300031240 Bacteria 3139
132 Ga0265325_10001395 3300031241 Bacteria 17041
133 Ga0265329_10000024 3300031242 Bacteria 61461
134 Ga0265340_10000165 3300031247 Bacteria 33506
135 Ga0265339_10001007 3300031249 Bacteria 21432
136 Ga0265339_10043746 3300031249 Bacteria 2474
137 Ga0265331_10000291 3300031250 Bacteria 55131
138 Ga0265316_10000024 3300031344 Bacteria 172403
139 Ga0265316_10001465 3300031344 Bacteria 25280
140 Ga0307408_100203633 3300031548 Bacteria 1604
141 Ga0265313_10000017 3300031595 Bacteria 152910
142 Ga0265313_10000439 3300031595 Bacteria 44190
143 Ga0265314_10000059 3300031711 Bacteria 165850
144 Ga0265314_10048782 3300031711 Bacteria 2969
145 Ga0265342_10000022 3300031712 Bacteria 173053
146 Ga0265342_10016846 3300031712 Bacteria 4764
147 Ga0307405_10060640 3300031731 Bacteria 2388
148 Ga0307410_10010265 3300031852 Bacteria 5293
149 Ga0307406_10043494 3300031901 Bacteria 2809
150 Ga0307412_10024494 3300031911 Bacteria 3726
151 Ga0373934_0018853 3300035086 Bacteria 2643
152 Ga0373953_0016303 3300035117 Bacteria 2710
153 Ga0373956_0043715 3300035119 Bacteria 1995
154 Ga0373931_0088092 3300035691 Bacteria 1725
155 Ga0373933_0002080 3300035724 Bacteria 11489
156 Ga0373933_0222694 3300035724 Bacteria 1211
157 Ga0373937_0000037 3300036401 Bacteria 111413
158 Ga0373937_0007458 3300036401 Bacteria 9463
159 Ga0373937_0065928 3300036401 Bacteria 3334
160 Ga0436364_0006304 3300037853 Bacteria 5421
161 Ga0451795_0486340 3300041456 Bacteria 5523
162 Ga0466966_0128947 3300044684 Bacteria 1550
163 Ga0453684_0167155 3300044712 Bacteria 2596
164 Ga0451576_0330605 3300045051 Bacteria 1595
165 Ga0495592_0154871 3300046454 Bacteria 1582
166 Ga0495638_0060767 3300046460 Bacteria 2336
167 Ga0495645_0008255 3300046543 Bacteria 7263
168 Ga0495599_0079277 3300046678 Bacteria 2051
169 Ga0495613_0084839 3300046689 Bacteria 2299
170 Ga0495613_0189770 3300046689 Bacteria 1453
171 Ga0495672_0092538 3300047320 Bacteria 1657
172 Ga0495680_0058474 3300047322 Bacteria 2979
173 Ga0495684_0042871 3300047471 Bacteria 3465
174 Ga0496109_0259820 3300048912 Bacteria 1636
175 Ga0501034_0003843 3300049571 Bacteria 16927
176 Ga0501042_0171198 3300049578 Bacteria 1567
177 Ga0501070_0146738 3300049586 Bacteria 1947
178 Ga0501071_0056834 3300049587 Bacteria 2827
179 Ga0501072_0059465 3300049588 Bacteria 3013
180 Ga0501075_0021798 3300049591 Bacteria 4673
181 Ga0501076_0036944 3300049592 Bacteria 3829
182 Ga0501080_0259407 3300049742 Bacteria 1584
183 Ga0501081_0041181 3300049743 Bacteria 3163
184 Ga0501081_0098936 3300049743 Bacteria 2060
185 Ga0501044_0228771 3300049823 Bacteria 1808
186 Ga0501045_0113285 3300049824 Bacteria 2011
187 nmdc:mga03683_657_c1 3300050489 Bacteria 9924
188 nmdc:mga00v17_1584_c1 3300050491 Bacteria 11890
189 nmdc:mga00v17_41315_c1 3300050491 Bacteria 2769
190 nmdc:mga0yw44_76101_c1 3300050492 Bacteria 2094
191 nmdc:mga0k408_3797_c1 3300050493 Bacteria 8003
192 nmdc:mga06z11_17003_c1 3300050494 Bacteria 3291
193 nmdc:mga05p37_19570_c1 3300050507 Bacteria 8189
194 nmdc:mga05p37_40362_c1 3300050507 Bacteria 5731
195 nmdc:mga05p37_86803_c1 3300050507 Bacteria 3857
196 nmdc:mga09592_195455_c1 3300050508 Bacteria 1751
197 nmdc:mga09592_226194_c1 3300050508 Bacteria 1621
198 nmdc:mga09592_23090_c1 3300050508 Bacteria 5135
199 nmdc:mga09592_57325_c1 3300050508 Bacteria 3292
200 nmdc:mga0qj67_136366_c1 3300050509 Bacteria 1989
201 nmdc:mga06r32_110134_c1 3300050510 Bacteria 2708
202 nmdc:mga06r32_161177_c1 3300050510 Bacteria 2225
203 nmdc:mga08y16_1780_c1 3300050511 Bacteria 21816
204 nmdc:mga08y16_181534_c1 3300050511 Bacteria 2185
205 nmdc:mga08y16_224431_c1 3300050511 Bacteria 1944
206 nmdc:mga08y16_3640_c1 3300050511 Bacteria 16016
207 nmdc:mga08y16_467633_c1 3300050511 Bacteria 1284
208 nmdc:mga08y16_74266_c1 3300050511 Bacteria 3543
209 nmdc:mga0n895_222988_c1 3300050512 Bacteria 1914
210 nmdc:mga0n895_25754_c1 3300050512 Bacteria 5562
211 nmdc:mga0n895_34780_c1 3300050512 Bacteria 4853
212 nmdc:mga0n895_59489_c1 3300050512 Bacteria 3769
213 nmdc:mga0rr50_27967_c1 3300050513 Bacteria 3957
214 nmdc:mga0rr50_39641_c1 3300050513 Bacteria 3418
215 nmdc:mga08x19_43599_c1 3300050514 Bacteria 2862
216 nmdc:mga08x19_56316_c1 3300050514 Bacteria 2537
217 nmdc:mga0a205_1110_c1 3300050515 Bacteria 22302
218 nmdc:mga0a205_139_c1 3300050515 Bacteria 46008
219 nmdc:mga0a205_6400_c1 3300050515 Bacteria 10640
220 Ga0495601_0002523 3300053077 Bacteria 10417
221 Ga0500641_0002388 3300053096 Bacteria 6657
222 Ga0500555_000100 3300053103 Bacteria 40574
223 Ga0500568_0010253 3300053139 Bacteria 4398
224 Ga0500616_0000350 3300053153 Bacteria 65815
225 Ga0500645_000297 3300053730 Bacteria 35603
226 Ga0501084_0143118 3300054114 Bacteria 2014
227 Ga0530510_0278984 3300061734 Bacteria 1248
228 8054565765 8054563764 Bacteria 5592885
229 Ga0307411_10008139
230 Ga0065712_10137847
231 Ga0070680_100140117
232 Ga0068868_100011123
233 Ga0070669_100138878
234 Ga0070688_100066118
235 Ga0070667_100162394
236 Ga0070703_10001997
237 Ga0070713_100010672
238 Ga0070705_100025286
239 Ga0070705_100147042
240 Ga0070694_100054535
241 Ga0070708_100015773
242 Ga0070708_100041030
243 Ga0070708_100108506
244 Ga0070708_100209107
245 Ga0070681_10325460
246 Ga0068867_100054577
247 Ga0070706_100000005
248 Ga0070706_100153673
249 Ga0070707_100032723
250 Ga0070698_100000438
251 Ga0070698_100050064
252 Ga0070697_100024554
253 Ga0070697_100057422
254 Ga0070693_100066042
255 Ga0070704_100004427
256 Ga0068855_100286042
257 Ga0068856_100163015
258 Ga0068859_100097908
259 Ga0068863_100070165
260 Ga0068858_100235617
261 Ga0068860_100047275
262 Ga0068860_100188631
263 Ga0075365_10017526
264 Ga0075364_10002548
265 Ga0075364_10018121
266 Ga0075364_10135322
267 Ga0075364_10149233
268 Ga0070716_100035760
269 Ga0075362_10001216
270 Ga0075367_10001652
271 Ga0075367_10030977
272 Ga0075367_10093164
273 Ga0075366_10003530
274 Ga0075366_10063125
275 Ga0097621_100154836
276 Ga0075370_10006219
277 Ga0068871_100214750
278 Ga0068871_100280252
279 Ga0068871_100368957
280 Ga0068871_100378745
281 Ga0075428_100003096
282 Ga0075430_100007337
283 Ga0075433_10001211
284 Ga0075433_10002356
285 Ga0075433_10005074
286 Ga0075433_10097657
287 Ga0075434_100019252
288 Ga0075434_100054230
289 Ga0075434_100071844
290 Ga0075434_100118516
291 Ga0075434_100415350
292 Ga0075429_100246827
293 Ga0075436_100057147
294 Ga0075436_100079623
295 Ga0097620_100097905
296 Ga0097620_100207821
297 Ga0075435_100012029
298 Ga0075435_100086612
299 Ga0105240_10120011
300 Ga0111539_10001112
301 Ga0111539_10003913
302 Ga0111539_10004464
303 Ga0111539_10032736
304 Ga0111539_10062428
305 Ga0111539_10170339
306 Ga0111539_10395938
307 Ga0114129_10001613
308 Ga0114129_10003815
309 Ga0114129_10077294
310 Ga0114129_10198870
311 Ga0114129_10258921
312 Ga0114129_10267618
313 Ga0105241_10071613
314 Ga0105248_10006576
315 Ga0105237_10079675
316 Ga0157378_10303742
317 Ga0157375_10052433
318 Ga0163163_10000034
319 Ga0157380_10007657
320 Ga0157376_10248307
321 Ga0213876_10044404
322 Ga0207653_10001004
323 Ga0207710_10010988
324 Ga0207688_10100299
325 Ga0207707_10056833
326 Ga0207707_10078448
327 Ga0207695_10088833
328 Ga0207693_10054411
329 Ga0207660_10165701
330 Ga0207646_10028792
331 Ga0207687_10262032
332 Ga0207700_10025733
333 Ga0207664_10020836
334 Ga0207644_10176176
335 Ga0207670_10001129
336 Ga0207670_10119452
337 Ga0207670_10162145
338 Ga0207665_10004000
339 Ga0207711_10317294
340 Ga0207667_10283224
341 Ga0207668_10231515
342 Ga0207658_10119859
343 Ga0207677_10003804
344 Ga0207703_10308229
345 Ga0207641_10063310
346 Ga0207648_10090917
347 Ga0207428_10000145
348 Ga0207428_10016989
349 Ga0268265_10032078
350 Ga0268264_10026814
351 Ga0265319_1000409
352 Ga0265318_10000057
353 Ga0265318_10000720
354 Ga0265338_10078848
355 Ga0265330_10000039
356 Ga0265332_10000051
357 Ga0265328_10001829
358 Ga0265320_10000264
359 Ga0265320_10025106
360 Ga0265325_10001395
361 Ga0265329_10000024
362 Ga0265340_10000165
363 Ga0265339_10001007
364 Ga0265339_10043746
365 Ga0265331_10000291
366 Ga0265316_10000024
367 Ga0265316_10001465
368 Ga0307408_100203633
369 Ga0265313_10000017
370 Ga0265313_10000439
371 Ga0265314_10000059
372 Ga0265314_10048782
373 Ga0265342_10000022
374 Ga0265342_10016846
375 Ga0307405_10060640
376 Ga0307410_10010265
377 Ga0307406_10043494
378 Ga0307412_10024494
379 Ga0373934_0018853
380 Ga0373953_0016303
381 Ga0373956_0043715
382 Ga0373931_0088092
383 Ga0373933_0002080
384 Ga0373933_0222694
385 Ga0373937_0000037
386 Ga0373937_0007458
387 Ga0373937_0065928
388 Ga0436364_0006304
389 Ga0451795_0486340
390 Ga0466966_0128947
391 Ga0453684_0167155
392 Ga0451576_0330605
393 Ga0495592_0154871
394 Ga0495638_0060767
395 Ga0495645_0008255
396 Ga0495599_0079277
397 Ga0495613_0084839
398 Ga0495613_0189770
399 Ga0495672_0092538
400 Ga0495680_0058474
401 Ga0495684_0042871
402 Ga0496109_0259820
403 Ga0501034_0003843
404 Ga0501042_0171198
405 Ga0501070_0146738
406 Ga0501071_0056834
407 Ga0501072_0059465
408 Ga0501075_0021798
409 Ga0501076_0036944
410 Ga0501080_0259407
411 Ga0501081_0041181
412 Ga0501081_0098936
413 Ga0501044_0228771
414 Ga0501045_0113285
415 nmdc:mga03683_657_c1
416 nmdc:mga00v17_1584_c1
417 nmdc:mga00v17_41315_c1
418 nmdc:mga0yw44_76101_c1
419 nmdc:mga0k408_3797_c1
420 nmdc:mga06z11_17003_c1
421 nmdc:mga05p37_19570_c1
422 nmdc:mga05p37_40362_c1
423 nmdc:mga05p37_86803_c1
424 nmdc:mga09592_195455_c1
425 nmdc:mga09592_226194_c1
426 nmdc:mga09592_23090_c1
427 nmdc:mga09592_57325_c1
428 nmdc:mga0qj67_136366_c1
429 nmdc:mga06r32_110134_c1
430 nmdc:mga06r32_161177_c1
431 nmdc:mga08y16_1780_c1
432 nmdc:mga08y16_181534_c1
433 nmdc:mga08y16_224431_c1
434 nmdc:mga08y16_3640_c1
435 nmdc:mga08y16_467633_c1
436 nmdc:mga08y16_74266_c1
437 nmdc:mga0n895_222988_c1
438 nmdc:mga0n895_25754_c1
439 nmdc:mga0n895_34780_c1
440 nmdc:mga0n895_59489_c1
441 nmdc:mga0rr50_27967_c1
442 nmdc:mga0rr50_39641_c1
443 nmdc:mga08x19_43599_c1
444 nmdc:mga08x19_56316_c1
445 nmdc:mga0a205_1110_c1
446 nmdc:mga0a205_139_c1
447 nmdc:mga0a205_6400_c1
448 Ga0495601_0002523
449 Ga0500641_0002388
450 Ga0500555_000100
451 Ga0500568_0010253
452 Ga0500616_0000350
453 Ga0500645_000297
454 Ga0501084_0143118
455 Ga0530510_0278984
456 8054565765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

2

343

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fmx-assembly1.cif.gz_X crystal structure of tartrate dehydrogenase from pseudomonas putida complexed with nadh 0.9467 2 349
3fmx-assembly1.cif.gz_X crystal structure of tartrate dehydrogenase from pseudomonas putida complexed with nadh 0.9363 2 349
2g4o-assembly1.cif.gz_A anomalous substructure of 3-isopropylmalate dehydrogenase 0.931 2 346
6xxy-assembly1.cif.gz_B crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. 0.9297 2 346
6lky-assembly1.cif.gz_B crystal structure of isocitrate dehydrogenase from methylococcus capsulatus 0.9273 2 348
ID Description Score Start End Superfamily
af_P76251_1_360_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9545 1 347 3.40.718.10
af_P76251_1_360_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9413 1 347 3.40.718.10
af_A0A1D6Q461_5_211_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9341 150 347 3.40.718.10
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9312 2 349 3.40.718.10
af_Q9W172_55_391_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9196 1 346 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A2V8NH28-F1-model_v4 3-isopropylmalate dehydrogenase 0.9868 2 346 GO:0000287
GO:0016616
GO:0051287
AF-A0A2V8L9I2-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) 0.9861 237 348 GO:0000287
GO:0003862
GO:0051287
AF-A0A6A0HXN7-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) 0.9852 1 346 GO:0003862
AF-A0A7Y5FKJ9-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) 0.9845 1 346 GO:0003862
AF-A0A2W4J0P9-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) 0.9829 1 349 GO:0000287
GO:0003862
GO:0051287

Map