F341085

General Info

Members Datasets Scaffolds Average Seq Length
228 168 456 107

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10237171|Ga0265326_102371712
Length 119
Sequence VGKFDGWVWVGTVGVGEARRLCARDDLAPGTSRCFEVDGLRIALVRIGDDFYAIGDTCSHADFSLSEGDVWEDELEIECPKHGSTFSLTTGEPQTLPATQPVPVYELVVDADDVKVVVP

Samples

Sample ID Description Type Environment
1 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0
Rhizoplane 3.07
Rhizosphere 90.79
Stem 0
Stem Tuber 0
Unclassified 5.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265326_10237171 3300028558 Bacteria 526
2 Ga0070670_100284656 3300005331 Bacteria 1444
3 Ga0070682_100965568 3300005337 Bacteria 705
4 Ga0068868_100202012 3300005338 Bacteria 1657
5 Ga0068868_100220341 3300005338 Bacteria 1588
6 Ga0070669_101086596 3300005353 Bacteria 689
7 Ga0070669_101290642 3300005353 Bacteria 632
8 Ga0070675_101436115 3300005354 Bacteria 636
9 Ga0070674_101631914 3300005356 Bacteria 582
10 Ga0070688_100656090 3300005365 Bacteria 808
11 Ga0070667_100584727 3300005367 Bacteria 1028
12 Ga0070705_100576425 3300005440 Bacteria 867
13 Ga0070708_100959875 3300005445 Bacteria 802
14 Ga0070663_101702369 3300005455 Bacteria 564
15 Ga0070681_11072547 3300005458 Bacteria 726
16 Ga0070685_10853208 3300005466 Bacteria 675
17 Ga0070706_101931723 3300005467 Bacteria 535
18 Ga0070684_101373855 3300005535 Bacteria 665
19 Ga0068853_100916556 3300005539 Bacteria 842
20 Ga0070672_100889991 3300005543 Bacteria 786
21 Ga0070696_100538558 3300005546 Bacteria 934
22 Ga0070665_101962939 3300005548 Bacteria 591
23 Ga0068855_100830718 3300005563 Bacteria 980
24 Ga0070664_101151537 3300005564 Archaea 731
25 Ga0068854_101982699 3300005578 Bacteria 536
26 Ga0070702_100837643 3300005615 Bacteria 715
27 Ga0068861_100148147 3300005719 Bacteria 1923
28 Ga0068851_10219741 3300005834 Bacteria 1067
29 Ga0068870_10763438 3300005840 Bacteria 672
30 Ga0068863_101033292 3300005841 Bacteria 825
31 Ga0068863_102737599 3300005841 Bacteria 502
32 Ga0068862_101632108 3300005844 Bacteria 652
33 Ga0075365_10279865 3300006038 Bacteria 1174
34 Ga0075363_100047192 3300006048 Bacteria 2287
35 Ga0075363_100191772 3300006048 Unclassified 1166
36 Ga0075364_10332562 3300006051 Bacteria 1035
37 Ga0070716_101118707 3300006173 Bacteria 629
38 Ga0070712_101689820 3300006175 Unclassified 554
39 Ga0075367_10175069 3300006178 Bacteria 1337
40 Ga0097621_101799810 3300006237 Bacteria 584
41 Ga0075428_100135629 3300006844 Bacteria 2676
42 Ga0075428_100780943 3300006844 Bacteria 1016
43 Ga0075430_100045002 3300006846 Bacteria 3730
44 Ga0075431_100111419 3300006847 Bacteria 2824
45 Ga0075431_100206257 3300006847 Bacteria 2009
46 Ga0075429_100231913 3300006880 Bacteria 1617
47 Ga0075429_100607162 3300006880 Bacteria 959
48 Ga0114129_10198389 3300009147 Bacteria 2720
49 Ga0114129_11870045 3300009147 Unclassified 729
50 Ga0105243_10278593 3300009148 Bacteria 1505
51 Ga0105242_12418853 3300009176 Bacteria 573
52 Ga0105248_11192050 3300009177 Bacteria 861
53 Ga0105249_10504915 3300009553 Bacteria 1255
54 Ga0157374_11144099 3300013296 Bacteria 799
55 Ga0163162_10891317 3300013306 Bacteria 1003
56 Ga0157375_10159824 3300013308 Bacteria 2394
57 Ga0157375_10850976 3300013308 Bacteria 1058
58 Ga0163163_10559873 3300014325 Bacteria 1206
59 Ga0157380_12162010 3300014326 Bacteria 620
60 Ga0157376_10716151 3300014969 Bacteria 1007
61 Ga0157376_11070416 3300014969 Bacteria 831
62 Ga0163161_10349720 3300017792 Bacteria 1175
63 Ga0207680_10627937 3300025903 Bacteria 769
64 Ga0207643_10578419 3300025908 Bacteria 722
65 Ga0207693_10540411 3300025915 Bacteria 909
66 Ga0207657_11020549 3300025919 Bacteria 634
67 Ga0207649_10979111 3300025920 Unclassified 665
68 Ga0207646_11580745 3300025922 Bacteria 566
69 Ga0207681_11376166 3300025923 Bacteria 592
70 Ga0207694_11318729 3300025924 Unclassified 610
71 Ga0207650_10102238 3300025925 Bacteria 2208
72 Ga0207669_10196344 3300025937 Bacteria 1461
73 Ga0207669_11915135 3300025937 Bacteria 507
74 Ga0207704_11200353 3300025938 Bacteria 647
75 Ga0207704_11394039 3300025938 Bacteria 600
76 Ga0207691_10241184 3300025940 Bacteria 1563
77 Ga0207691_10874095 3300025940 Unclassified 753
78 Ga0207651_11622792 3300025960 Unclassified 583
79 Ga0207651_11712376 3300025960 Bacteria 566
80 Ga0207668_10722890 3300025972 Bacteria 877
81 Ga0207658_10631450 3300025986 Bacteria 964
82 Ga0207703_11301759 3300026035 Bacteria 699
83 Ga0207678_11418233 3300026067 Bacteria 614
84 Ga0207708_10184655 3300026075 Bacteria 1657
85 Ga0207641_11206589 3300026088 Bacteria 756
86 Ga0207648_10335932 3300026089 Bacteria 1360
87 Ga0207675_100450813 3300026118 Bacteria 1275
88 Ga0207675_101103605 3300026118 Bacteria 813
89 Ga0268266_12169526 3300028379 Bacteria 528
90 Ga0268265_10298214 3300028380 Bacteria 1450
91 Ga0265338_10001282 3300028800 Bacteria 41239
92 Ga0265338_10173439 3300028800 Unclassified 1651
93 Ga0265338_10201032 3300028800 Bacteria 1503
94 Ga0265338_10566082 3300028800 Bacteria 794
95 Ga0265762_1118510 3300030760 Bacteria 603
96 Ga0265325_10001453 3300031241 Bacteria 16645
97 Ga0265340_10122028 3300031247 Bacteria 1199
98 Ga0265340_10188798 3300031247 Bacteria 930
99 Ga0265340_10319064 3300031247 Bacteria 688
100 Ga0265339_10022129 3300031249 Bacteria 3686
101 Ga0265339_10104854 3300031249 Bacteria 1468
102 Ga0265327_10000524 3300031251 Bacteria 66279
103 Ga0265327_10003431 3300031251 Bacteria 15137
104 Ga0265316_10056463 3300031344 Bacteria 3066
105 Ga0265313_10000591 3300031595 Bacteria 37635
106 Ga0265313_10263384 3300031595 Bacteria 700
107 Ga0265313_10347965 3300031595 Bacteria 588
108 Ga0316575_10248824 3300031665 Bacteria 745
109 Ga0265314_10063972 3300031711 Bacteria 2493
110 Ga0265314_10637663 3300031711 Bacteria 545
111 Ga0265342_10164888 3300031712 Bacteria 1223
112 Ga0316576_10091391 3300031727 Bacteria 2268
113 Ga0316578_10339963 3300031728 Bacteria 894
114 Ga0316578_10415304 3300031728 Bacteria 797
115 Ga0307410_10990120 3300031852 Bacteria 724
116 Ga0307409_100477696 3300031995 Bacteria 1209
117 Ga0316574_0033328 3300035398 Bacteria 3135
118 Ga0316574_0060924 3300035398 Bacteria 2369
119 Ga0316574_0099350 3300035398 Bacteria 1862
120 Ga0373933_0647630 3300035724 Bacteria 694
121 Ga0373947_0256131 3300035725 Bacteria 1158
122 Ga0373947_0958600 3300035725 Bacteria 584
123 Ga0373937_1642906 3300036401 Unclassified 590
124 Ga0310112_019802 3300036458 Bacteria 947
125 Ga0395901_0450036 3300038443 Bacteria 1317
126 Ga0436365_0056817 3300039437 Bacteria 589
127 Ga0436363_0508287 3300039450 Bacteria 643
128 Ga0451802_0049353 3300041460 Bacteria 753
129 Ga0451853_3943528 3300041512 Bacteria 735
130 Ga0466966_0209146 3300044684 Bacteria 1179
131 Ga0466961_0049476 3300044693 Bacteria 2687
132 Ga0466959_0115231 3300045049 Bacteria 1915
133 Ga0495592_0142565 3300046454 Bacteria 1665
134 Ga0495592_0239343 3300046454 Bacteria 1205
135 Ga0495603_0227500 3300046455 Bacteria 1076
136 Ga0495603_0576913 3300046455 Bacteria 644
137 Ga0495629_0270253 3300046459 Bacteria 1168
138 Ga0495641_0144176 3300046461 Bacteria 1064
139 Ga0495651_0158704 3300046462 Bacteria 1623
140 Ga0495653_0006990 3300046463 Bacteria 9263
141 Ga0495653_0330935 3300046463 Bacteria 984
142 Ga0495582_0078664 3300046473 Bacteria 1830
143 Ga0495582_0247463 3300046473 Bacteria 1022
144 Ga0495639_0333334 3300046475 Bacteria 760
145 Ga0495664_0225284 3300046477 Bacteria 1135
146 Ga0495608_0096970 3300046511 Bacteria 1904
147 Ga0495608_0102156 3300046511 Bacteria 1848
148 Ga0495618_0328041 3300046514 Bacteria 947
149 Ga0495618_0782430 3300046514 Unclassified 557
150 Ga0495628_0011552 3300046516 Bacteria 7466
151 Ga0495628_0043701 3300046516 Bacteria 3567
152 Ga0495628_0430236 3300046516 Bacteria 961
153 Ga0495630_0118058 3300046517 Bacteria 2011
154 Ga0495630_0281033 3300046517 Bacteria 1272
155 Ga0495630_0282796 3300046517 Bacteria 1267
156 Ga0495630_0817136 3300046517 Bacteria 711
157 Ga0495665_0062875 3300046531 Bacteria 1960
158 Ga0495640_0044799 3300046533 Bacteria 3074
159 Ga0495640_0238801 3300046533 Bacteria 1141
160 Ga0495640_0251056 3300046533 Bacteria 1108
161 Ga0495586_0070644 3300046535 Bacteria 1907
162 Ga0495586_0346958 3300046535 Bacteria 852
163 Ga0495586_0639348 3300046535 Bacteria 615
164 Ga0495621_0458095 3300046539 Bacteria 547
165 Ga0495645_0042683 3300046543 Bacteria 3307
166 Ga0495622_0073417 3300046557 Bacteria 1578
167 Ga0495667_0038857 3300046559 Bacteria 3168
168 Ga0495667_0194737 3300046559 Bacteria 1298
169 Ga0495656_0286768 3300046615 Bacteria 841
170 Ga0495668_0555536 3300046616 Bacteria 634
171 Ga0495634_0042602 3300046642 Bacteria 3079
172 Ga0495657_0144854 3300046675 Bacteria 1479
173 Ga0495657_0166840 3300046675 Bacteria 1359
174 Ga0495599_0137014 3300046678 Bacteria 1519
175 Ga0495647_0193292 3300046681 Bacteria 890
176 Ga0495658_0023845 3300046683 Bacteria 3252
177 Ga0495658_0047035 3300046683 Bacteria 2428
178 Ga0495613_0405419 3300046689 Bacteria 929
179 Ga0495624_0933956 3300046690 Bacteria 510
180 Ga0495670_0055541 3300046691 Bacteria 1986
181 Ga0495600_0768648 3300046809 Unclassified 576
182 Ga0495636_0065665 3300047318 Bacteria 1542
183 Ga0495674_0069369 3300047319 Bacteria 3048
184 Ga0495674_0392817 3300047319 Bacteria 1121
185 Ga0495672_0007217 3300047320 Bacteria 8391
186 Ga0495676_0143719 3300047321 Bacteria 1707
187 Ga0495676_0456694 3300047321 Bacteria 842
188 Ga0495680_0093342 3300047322 Bacteria 2253
189 Ga0495680_0180984 3300047322 Bacteria 1521
190 Ga0495675_0408003 3300047444 Bacteria 791
191 Ga0495684_0030605 3300047471 Bacteria 4132
192 Ga0495684_0726633 3300047471 Bacteria 656
193 Ga0495602_0126746 3300048088 Bacteria 2044
194 Ga0496100_0481236 3300048903 Bacteria 955
195 Ga0496104_0408209 3300048907 Bacteria 1271
196 Ga0496108_0006464 3300048911 Bacteria 9503
197 Ga0496109_0071210 3300048912 Bacteria 3191
198 Ga0496111_0278801 3300048914 Bacteria 1240
199 Ga0496114_0012427 3300048917 Bacteria 6815
200 Ga0501039_0846045 3300049575 Bacteria 713
201 Ga0501072_0221241 3300049588 Bacteria 1509
202 Ga0501072_1285462 3300049588 Bacteria 567
203 Ga0501075_0648925 3300049591 Bacteria 805
204 Ga0501080_0445345 3300049742 Bacteria 1162
205 Ga0501081_0476110 3300049743 Bacteria 929
206 nmdc:mga03n38_28563_c1 3300050490 Bacteria 2326
207 nmdc:mga00v17_797902_c1 3300050491 Bacteria 602
208 nmdc:mga0yw44_297792_c1 3300050492 Bacteria 1080
209 nmdc:mga06z11_146813_c1 3300050494 Bacteria 1337
210 nmdc:mga05p37_342075_c1 3300050507 Bacteria 1764
211 nmdc:mga05p37_390076_c1 3300050507 Bacteria 1629
212 nmdc:mga05p37_705729_c1 3300050507 Bacteria 1120
213 nmdc:mga09592_175953_c1 3300050508 Bacteria 1851
214 nmdc:mga0qj67_37956_c1 3300050509 Bacteria 3777
215 nmdc:mga06r32_185705_c1 3300050510 Bacteria 2066
216 nmdc:mga06r32_59346_c1 3300050510 Bacteria 3679
217 Ga0495612_0137865 3300053078 Bacteria 1057
218 Ga0495595_0037816 3300053084 Bacteria 2196
219 Ga0495595_0062109 3300053084 Bacteria 1751
220 Ga0495595_0400337 3300053084 Unclassified 696
221 Ga0495619_0068624 3300053085 Bacteria 2369
222 Ga0495619_0356633 3300053085 Bacteria 1011
223 Ga0495619_0431550 3300053085 Bacteria 909
224 Ga0500566_0508360 3300053094 Unclassified 517
225 Ga0501084_0429910 3300054114 Bacteria 1116
226 Ga0501084_1547308 3300054114 Bacteria 555
227 Ga0501082_1740476 3300060353 Bacteria 544
228 Ga0530510_0263082 3300061734 Bacteria 1287
229 Ga0265326_10237171
230 Ga0070670_100284656
231 Ga0070682_100965568
232 Ga0068868_100202012
233 Ga0068868_100220341
234 Ga0070669_101086596
235 Ga0070669_101290642
236 Ga0070675_101436115
237 Ga0070674_101631914
238 Ga0070688_100656090
239 Ga0070667_100584727
240 Ga0070705_100576425
241 Ga0070708_100959875
242 Ga0070663_101702369
243 Ga0070681_11072547
244 Ga0070685_10853208
245 Ga0070706_101931723
246 Ga0070684_101373855
247 Ga0068853_100916556
248 Ga0070672_100889991
249 Ga0070696_100538558
250 Ga0070665_101962939
251 Ga0068855_100830718
252 Ga0070664_101151537
253 Ga0068854_101982699
254 Ga0070702_100837643
255 Ga0068861_100148147
256 Ga0068851_10219741
257 Ga0068870_10763438
258 Ga0068863_101033292
259 Ga0068863_102737599
260 Ga0068862_101632108
261 Ga0075365_10279865
262 Ga0075363_100047192
263 Ga0075363_100191772
264 Ga0075364_10332562
265 Ga0070716_101118707
266 Ga0070712_101689820
267 Ga0075367_10175069
268 Ga0097621_101799810
269 Ga0075428_100135629
270 Ga0075428_100780943
271 Ga0075430_100045002
272 Ga0075431_100111419
273 Ga0075431_100206257
274 Ga0075429_100231913
275 Ga0075429_100607162
276 Ga0114129_10198389
277 Ga0114129_11870045
278 Ga0105243_10278593
279 Ga0105242_12418853
280 Ga0105248_11192050
281 Ga0105249_10504915
282 Ga0157374_11144099
283 Ga0163162_10891317
284 Ga0157375_10159824
285 Ga0157375_10850976
286 Ga0163163_10559873
287 Ga0157380_12162010
288 Ga0157376_10716151
289 Ga0157376_11070416
290 Ga0163161_10349720
291 Ga0207680_10627937
292 Ga0207643_10578419
293 Ga0207693_10540411
294 Ga0207657_11020549
295 Ga0207649_10979111
296 Ga0207646_11580745
297 Ga0207681_11376166
298 Ga0207694_11318729
299 Ga0207650_10102238
300 Ga0207669_10196344
301 Ga0207669_11915135
302 Ga0207704_11200353
303 Ga0207704_11394039
304 Ga0207691_10241184
305 Ga0207691_10874095
306 Ga0207651_11622792
307 Ga0207651_11712376
308 Ga0207668_10722890
309 Ga0207658_10631450
310 Ga0207703_11301759
311 Ga0207678_11418233
312 Ga0207708_10184655
313 Ga0207641_11206589
314 Ga0207648_10335932
315 Ga0207675_100450813
316 Ga0207675_101103605
317 Ga0268266_12169526
318 Ga0268265_10298214
319 Ga0265338_10001282
320 Ga0265338_10173439
321 Ga0265338_10201032
322 Ga0265338_10566082
323 Ga0265762_1118510
324 Ga0265325_10001453
325 Ga0265340_10122028
326 Ga0265340_10188798
327 Ga0265340_10319064
328 Ga0265339_10022129
329 Ga0265339_10104854
330 Ga0265327_10000524
331 Ga0265327_10003431
332 Ga0265316_10056463
333 Ga0265313_10000591
334 Ga0265313_10263384
335 Ga0265313_10347965
336 Ga0316575_10248824
337 Ga0265314_10063972
338 Ga0265314_10637663
339 Ga0265342_10164888
340 Ga0316576_10091391
341 Ga0316578_10339963
342 Ga0316578_10415304
343 Ga0307410_10990120
344 Ga0307409_100477696
345 Ga0316574_0033328
346 Ga0316574_0060924
347 Ga0316574_0099350
348 Ga0373933_0647630
349 Ga0373947_0256131
350 Ga0373947_0958600
351 Ga0373937_1642906
352 Ga0310112_019802
353 Ga0395901_0450036
354 Ga0436365_0056817
355 Ga0436363_0508287
356 Ga0451802_0049353
357 Ga0451853_3943528
358 Ga0466966_0209146
359 Ga0466961_0049476
360 Ga0466959_0115231
361 Ga0495592_0142565
362 Ga0495592_0239343
363 Ga0495603_0227500
364 Ga0495603_0576913
365 Ga0495629_0270253
366 Ga0495641_0144176
367 Ga0495651_0158704
368 Ga0495653_0006990
369 Ga0495653_0330935
370 Ga0495582_0078664
371 Ga0495582_0247463
372 Ga0495639_0333334
373 Ga0495664_0225284
374 Ga0495608_0096970
375 Ga0495608_0102156
376 Ga0495618_0328041
377 Ga0495618_0782430
378 Ga0495628_0011552
379 Ga0495628_0043701
380 Ga0495628_0430236
381 Ga0495630_0118058
382 Ga0495630_0281033
383 Ga0495630_0282796
384 Ga0495630_0817136
385 Ga0495665_0062875
386 Ga0495640_0044799
387 Ga0495640_0238801
388 Ga0495640_0251056
389 Ga0495586_0070644
390 Ga0495586_0346958
391 Ga0495586_0639348
392 Ga0495621_0458095
393 Ga0495645_0042683
394 Ga0495622_0073417
395 Ga0495667_0038857
396 Ga0495667_0194737
397 Ga0495656_0286768
398 Ga0495668_0555536
399 Ga0495634_0042602
400 Ga0495657_0144854
401 Ga0495657_0166840
402 Ga0495599_0137014
403 Ga0495647_0193292
404 Ga0495658_0023845
405 Ga0495658_0047035
406 Ga0495613_0405419
407 Ga0495624_0933956
408 Ga0495670_0055541
409 Ga0495600_0768648
410 Ga0495636_0065665
411 Ga0495674_0069369
412 Ga0495674_0392817
413 Ga0495672_0007217
414 Ga0495676_0143719
415 Ga0495676_0456694
416 Ga0495680_0093342
417 Ga0495680_0180984
418 Ga0495675_0408003
419 Ga0495684_0030605
420 Ga0495684_0726633
421 Ga0495602_0126746
422 Ga0496100_0481236
423 Ga0496104_0408209
424 Ga0496108_0006464
425 Ga0496109_0071210
426 Ga0496111_0278801
427 Ga0496114_0012427
428 Ga0501039_0846045
429 Ga0501072_0221241
430 Ga0501072_1285462
431 Ga0501075_0648925
432 Ga0501080_0445345
433 Ga0501081_0476110
434 nmdc:mga03n38_28563_c1
435 nmdc:mga00v17_797902_c1
436 nmdc:mga0yw44_297792_c1
437 nmdc:mga06z11_146813_c1
438 nmdc:mga05p37_342075_c1
439 nmdc:mga05p37_390076_c1
440 nmdc:mga05p37_705729_c1
441 nmdc:mga09592_175953_c1
442 nmdc:mga0qj67_37956_c1
443 nmdc:mga06r32_185705_c1
444 nmdc:mga06r32_59346_c1
445 Ga0495612_0137865
446 Ga0495595_0037816
447 Ga0495595_0062109
448 Ga0495595_0400337
449 Ga0495619_0068624
450 Ga0495619_0356633
451 Ga0495619_0431550
452 Ga0500566_0508360
453 Ga0501084_0429910
454 Ga0501084_1547308
455 Ga0501082_1740476
456 Ga0530510_0263082

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

17

106

0.95

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

19

117

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.9661 1 101
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.964 2 102
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.952 1 104
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.952 3 101
2yvj-assembly1.cif.gz_B crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex 0.9497 2 102
ID Description Score Start End Superfamily
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9746 1 107 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9661 1 101 2.102.10.10
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9656 1 107 2.102.10.10
3dqyA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9641 2 102 2.102.10.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.952 3 101 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A0C1UXI1-F1-model_v4 Rieske domain-containing protein 0.9978 5 104 GO:0046872
GO:0051537
AF-A0A3C1CHC2-F1-model_v4 Rieske (2Fe-2S) protein 0.9977 2 104 GO:0046872
GO:0051537
AF-A0A7C4XPC5-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9915 1 104 GO:0046872
GO:0051537
AF-A0A7Y3LG20-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9909 4 104 GO:0046872
GO:0051537
AF-A0A3N5JC70-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9887 4 102 GO:0046872
GO:0051537

Map