F340899

General Info

Members Datasets Scaffolds Average Seq Length
228 161 456 104

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10708028|Ga0105245_107080282
Length 118
Sequence MPTRTTRPIREGLAMPVTEINGHAIHVDDEGFMTSYDEWDDDLAKVLAANIGIDLTDAHWKVIHFLRADYKDKGETATTRRVQTVGGVPVKEQFALFPKKPGKKMAYIAGLPKPHGCV

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
37 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
82 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
95 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
96 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
97 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
155 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
156 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
157 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
158 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
159 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
160 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
161 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 6.14
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0
Rhizoplane 8.33
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10708028 3300009098 Bacteria 1041
2 Ga0070658_10075138 3300005327 Bacteria 2772
3 Ga0070658_10263663 3300005327 Bacteria 1464
4 Ga0070683_100150550 3300005329 Bacteria 2206
5 Ga0068869_100060306 3300005334 Bacteria 2780
6 Ga0070680_100029215 3300005336 Bacteria 4428
7 Ga0068868_100019087 3300005338 Bacteria 5134
8 Ga0070660_100075812 3300005339 Bacteria 2634
9 Ga0070660_100106574 3300005339 Bacteria 2226
10 Ga0070661_100917253 3300005344 Bacteria 724
11 Ga0070673_102149368 3300005364 Bacteria 530
12 Ga0070688_101703093 3300005365 Bacteria 516
13 Ga0070659_100001443 3300005366 Bacteria 17145
14 Ga0070659_100800573 3300005366 Bacteria 820
15 Ga0070709_10096995 3300005434 Bacteria 1956
16 Ga0070709_10635810 3300005434 Bacteria 825
17 Ga0070713_100030807 3300005436 Bacteria 4266
18 Ga0070713_100181219 3300005436 Bacteria 1893
19 Ga0070711_100104805 3300005439 Bacteria 2064
20 Ga0070711_101471973 3300005439 Bacteria 594
21 Ga0070663_101983068 3300005455 Bacteria 524
22 Ga0070681_10053244 3300005458 Bacteria 4033
23 Ga0070679_100005652 3300005530 Bacteria 11588
24 Ga0070684_101908389 3300005535 Bacteria 560
25 Ga0070684_102093654 3300005535 Unclassified 534
26 Ga0068853_101991127 3300005539 Bacteria 563
27 Ga0068855_100677171 3300005563 Bacteria 1106
28 Ga0068855_100974891 3300005563 Bacteria 892
29 Ga0068856_101759139 3300005614 Bacteria 632
30 Ga0068864_100012262 3300005618 Bacteria 7083
31 Ga0068870_11281438 3300005840 Bacteria 533
32 Ga0068863_100040671 3300005841 Bacteria 4420
33 Ga0068858_100637917 3300005842 Bacteria 1035
34 Ga0081455_10149756 3300005937 Bacteria 1800
35 Ga0070717_10027559 3300006028 Bacteria 4542
36 Ga0070717_11388497 3300006028 Bacteria 638
37 Ga0070715_10139243 3300006163 Bacteria 1177
38 Ga0070712_100018256 3300006175 Bacteria 4553
39 Ga0070712_100823142 3300006175 Bacteria 797
40 Ga0105245_10354807 3300009098 Bacteria 1454
41 Ga0105245_12841221 3300009098 Bacteria 537
42 Ga0105247_11286674 3300009101 Bacteria 586
43 Ga0105242_10259989 3300009176 Bacteria 1568
44 Ga0105248_10482283 3300009177 Bacteria 1398
45 Ga0105237_11224110 3300009545 Bacteria 757
46 Ga0105238_10238138 3300009551 Bacteria 1797
47 Ga0105238_10616083 3300009551 Bacteria 1094
48 Ga0105238_11398466 3300009551 Bacteria 727
49 Ga0105238_12779382 3300009551 Bacteria 526
50 Ga0105239_10147150 3300010375 Bacteria 2628
51 Ga0105239_10512918 3300010375 Bacteria 1364
52 Ga0105239_11480538 3300010375 Bacteria 784
53 Ga0157315_1002704 3300012508 Bacteria 1132
54 Ga0157316_1020704 3300012510 Bacteria 717
55 Ga0157370_10225706 3300013104 Bacteria 1734
56 Ga0157370_10851125 3300013104 Bacteria 829
57 Ga0157369_10000550 3300013105 Bacteria 49206
58 Ga0157369_10066401 3300013105 Bacteria 3881
59 Ga0157374_11978710 3300013296 Bacteria 609
60 Ga0157374_11987114 3300013296 Bacteria 608
61 Ga0157374_12287252 3300013296 Bacteria 568
62 Ga0157378_13212587 3300013297 Bacteria 508
63 Ga0157372_10234092 3300013307 Bacteria 2130
64 Ga0157372_10768026 3300013307 Bacteria 1120
65 Ga0157372_11556755 3300013307 Bacteria 761
66 Ga0157375_10021528 3300013308 Bacteria 5914
67 Ga0157375_10820883 3300013308 Bacteria 1078
68 Ga0163163_10001227 3300014325 Bacteria 21689
69 Ga0157379_10066281 3300014968 Bacteria 3228
70 Ga0206351_10979573 3300020077 Bacteria 755
71 Ga0206354_10430809 3300020081 Bacteria 559
72 Ga0206353_10839417 3300020082 Bacteria 686
73 Ga0224712_10254143 3300022467 Bacteria 813
74 Ga0207710_10610219 3300025900 Bacteria 570
75 Ga0207647_10234179 3300025904 Bacteria 1056
76 Ga0207699_10103371 3300025906 Bacteria 1812
77 Ga0207699_11058402 3300025906 Bacteria 600
78 Ga0207705_10027475 3300025909 Bacteria 4058
79 Ga0207705_10065331 3300025909 Bacteria 2630
80 Ga0207705_10139043 3300025909 Bacteria 1812
81 Ga0207707_10079071 3300025912 Bacteria 2872
82 Ga0207693_10033545 3300025915 Bacteria 4051
83 Ga0207693_10329514 3300025915 Bacteria 1195
84 Ga0207663_10139685 3300025916 Bacteria 1686
85 Ga0207663_11292159 3300025916 Bacteria 588
86 Ga0207660_10171543 3300025917 Bacteria 1679
87 Ga0207657_10080158 3300025919 Bacteria 2745
88 Ga0207657_10114312 3300025919 Bacteria 2226
89 Ga0207657_10229364 3300025919 Bacteria 1485
90 Ga0207649_10917056 3300025920 Bacteria 687
91 Ga0207652_10019238 3300025921 Bacteria 5613
92 Ga0207652_10944771 3300025921 Bacteria 760
93 Ga0207694_10178043 3300025924 Bacteria 1723
94 Ga0207687_10281772 3300025927 Bacteria 1332
95 Ga0207700_10060834 3300025928 Bacteria 2861
96 Ga0207700_10442487 3300025928 Bacteria 1144
97 Ga0207690_10000226 3300025932 Bacteria 42329
98 Ga0207690_10521028 3300025932 Bacteria 964
99 Ga0207686_10225461 3300025934 Bacteria 1356
100 Ga0207711_10201481 3300025941 Bacteria 1816
101 Ga0207689_10209422 3300025942 Bacteria 1610
102 Ga0207661_10116498 3300025944 Bacteria 2268
103 Ga0207661_11584225 3300025944 Bacteria 599
104 Ga0207667_10612971 3300025949 Bacteria 1097
105 Ga0207667_11313368 3300025949 Bacteria 699
106 Ga0207677_10022341 3300026023 Bacteria 3887
107 Ga0207708_11938664 3300026075 Bacteria 516
108 Ga0207641_10135016 3300026088 Bacteria 2220
109 Ga0207676_11609216 3300026095 Bacteria 647
110 Ga0207674_10139576 3300026116 Bacteria 2384
111 Ga0307515_10049889 3300028794 Bacteria 6280
112 Ga0307515_10199675 3300028794 Bacteria 1879
113 Ga0307515_10903550 3300028794 Bacteria 514
114 Ga0265338_10121886 3300028800 Bacteria 2077
115 Ga0265325_10169287 3300031241 Bacteria 1023
116 Ga0307513_10245825 3300031456 Bacteria 1590
117 Ga0307509_10061552 3300031507 Bacteria 3961
118 Ga0307509_10510558 3300031507 Bacteria 885
119 Ga0307508_10000257 3300031616 Bacteria 64856
120 Ga0307508_10122011 3300031616 Bacteria 2209
121 Ga0307514_10285526 3300031649 Bacteria 940
122 Ga0316579_10005133 3300031691 Bacteria 5258
123 Ga0265342_10210951 3300031712 Bacteria 1050
124 Ga0316576_10000610 3300031727 Bacteria 17181
125 Ga0316576_10003622 3300031727 Bacteria 9108
126 Ga0316578_10003501 3300031728 Bacteria 7203
127 Ga0307516_10006695 3300031730 Bacteria 13464
128 Ga0307516_10018849 3300031730 Bacteria 7163
129 Ga0316577_10078222 3300031733 Bacteria 1847
130 Ga0307410_10094951 3300031852 Bacteria 2125
131 Ga0307406_10249173 3300031901 Bacteria 1337
132 Ga0307409_100011747 3300031995 Bacteria 5541
133 Ga0307409_100657261 3300031995 Bacteria 1043
134 Ga0307409_100985434 3300031995 Bacteria 860
135 Ga0307416_100043707 3300032002 Bacteria 3511
136 Ga0307416_100247013 3300032002 Bacteria 1734
137 Ga0307411_10923357 3300032005 Bacteria 777
138 Ga0307415_101402912 3300032126 Bacteria 665
139 Ga0316583_10001843 3300032133 Bacteria 7213
140 Ga0316585_10001312 3300032137 Bacteria 6527
141 Ga0316580_10028930 3300032139 Bacteria 1713
142 Ga0316580_10259139 3300032139 Bacteria 538
143 Ga0316593_10004411 3300032168 Bacteria 3611
144 Ga0307507_10659107 3300033179 Bacteria 530
145 Ga0316592_1001227 3300033524 Bacteria 4046
146 Ga0316586_1000463 3300033527 Bacteria 3938
147 Ga0316588_1001040 3300033528 Bacteria 4361
148 Ga0316588_1058485 3300033528 Bacteria 939
149 Ga0316588_1185997 3300033528 Bacteria 540
150 Ga0316587_1000552 3300033529 Bacteria 3902
151 Ga0316596_1001543 3300033541 Bacteria 4687
152 Ga0316596_1032485 3300033541 Bacteria 1358
153 Ga0316596_1035116 3300033541 Bacteria 1310
154 Ga0373962_0001717 3300035242 Bacteria 5205
155 Ga0316574_0461183 3300035398 Bacteria 795
156 Ga0316582_0270613 3300036647 Bacteria 1165
157 Ga0316584_0002335 3300036712 Bacteria 11962
158 Ga0316584_0765081 3300036712 Bacteria 658
159 Ga0316584_1071925 3300036712 Bacteria 536
160 Ga0373925_0875352 3300037068 Bacteria 740
161 Ga0373925_1242903 3300037068 Bacteria 612
162 Ga0373925_1627305 3300037068 Bacteria 528
163 Ga0395899_0002118 3300037312 Bacteria 16312
164 Ga0316581_0000947 3300037588 Bacteria 6178
165 Ga0439460_0040174 3300042461 Bacteria 1370
166 Ga0439440_0171797 3300042993 Bacteria 631
167 Ga0466969_0087865 3300044656 Bacteria 1476
168 Ga0466969_0156086 3300044656 Bacteria 1050
169 Ga0466966_0041686 3300044684 Bacteria 2949
170 Ga0466961_0209358 3300044693 Bacteria 1204
171 Ga0466961_0263548 3300044693 Bacteria 1056
172 Ga0466963_0485639 3300044694 Bacteria 872
173 Ga0466963_0740451 3300044694 Bacteria 693
174 Ga0466959_0011693 3300045049 Bacteria 6314
175 Ga0466967_0140470 3300045976 Bacteria 2249
176 Ga0495603_0189040 3300046455 Bacteria 1191
177 Ga0495580_0595903 3300046472 Bacteria 731
178 Ga0495639_0298518 3300046475 Bacteria 803
179 Ga0495608_0424578 3300046511 Bacteria 811
180 Ga0495632_0100562 3300046519 Bacteria 1363
181 Ga0495632_0292089 3300046519 Bacteria 724
182 Ga0495667_0229127 3300046559 Bacteria 1185
183 Ga0495647_0144974 3300046681 Bacteria 1015
184 Ga0495658_0844664 3300046683 Bacteria 586
185 Ga0495649_0233038 3300046694 Bacteria 950
186 Ga0495593_0196898 3300047673 Bacteria 1013
187 Ga0496101_1092352 3300048904 Bacteria 626
188 Ga0496103_0625544 3300048906 Bacteria 685
189 Ga0496104_0161376 3300048907 Bacteria 2150
190 Ga0496104_0277318 3300048907 Bacteria 1589
191 Ga0496104_0586750 3300048907 Bacteria 1025
192 Ga0496108_0136169 3300048911 Bacteria 2113
193 Ga0496108_0205894 3300048911 Bacteria 1707
194 Ga0496108_0258293 3300048911 Bacteria 1516
195 Ga0496109_0323533 3300048912 Bacteria 1455
196 Ga0496109_1597232 3300048912 Bacteria 586
197 Ga0496110_0003609 3300048913 Bacteria 11907
198 Ga0496110_0283926 3300048913 Bacteria 1507
199 Ga0496110_0484321 3300048913 Bacteria 1127
200 Ga0496111_0076504 3300048914 Bacteria 2439
201 Ga0496112_0016267 3300048915 Bacteria 6963
202 Ga0496112_0161044 3300048915 Bacteria 2211
203 Ga0496113_0046173 3300048916 Bacteria 3233
204 Ga0496114_0015994 3300048917 Bacteria 6038
205 Ga0496115_0385750 3300048918 Bacteria 1139
206 Ga0496126_0000048 3300048929 Bacteria 317977
207 Ga0501031_0933490 3300049568 Bacteria 555
208 Ga0501034_0333987 3300049571 Bacteria 1447
209 Ga0501037_0525014 3300049573 Bacteria 801
210 Ga0501039_0337056 3300049575 Bacteria 1185
211 Ga0501040_0719003 3300049576 Bacteria 722
212 Ga0501042_0241077 3300049578 Bacteria 1305
213 Ga0501048_0645580 3300049582 Bacteria 760
214 Ga0501070_0061746 3300049586 Bacteria 3105
215 Ga0501075_0434998 3300049591 Bacteria 1000
216 Ga0501076_0444056 3300049592 Bacteria 1068
217 Ga0495595_0220409 3300053084 Bacteria 947
218 Ga0495595_0687291 3300053084 Bacteria 524
219 Ga0500583_0559913 3300053092 Bacteria 530
220 Ga0500641_0013657 3300053096 Bacteria 2985
221 Ga0500614_070516 3300053123 Bacteria 959
222 Ga0500652_021257 3300053131 Bacteria 2442
223 Ga0500588_0081363 3300053146 Bacteria 1084
224 Ga0500630_282715 3300053159 Bacteria 554
225 2515496803 2515154088 Bacteria 5526283
226 2515758883 2515154137 Bacteria 5711575
227 2516090862 2515154203 Bacteria 5458536
228 2932433485 2932431166 Bacteria 4215299
229 Ga0105245_10708028
230 Ga0070658_10075138
231 Ga0070658_10263663
232 Ga0070683_100150550
233 Ga0068869_100060306
234 Ga0070680_100029215
235 Ga0068868_100019087
236 Ga0070660_100075812
237 Ga0070660_100106574
238 Ga0070661_100917253
239 Ga0070673_102149368
240 Ga0070688_101703093
241 Ga0070659_100001443
242 Ga0070659_100800573
243 Ga0070709_10096995
244 Ga0070709_10635810
245 Ga0070713_100030807
246 Ga0070713_100181219
247 Ga0070711_100104805
248 Ga0070711_101471973
249 Ga0070663_101983068
250 Ga0070681_10053244
251 Ga0070679_100005652
252 Ga0070684_101908389
253 Ga0070684_102093654
254 Ga0068853_101991127
255 Ga0068855_100677171
256 Ga0068855_100974891
257 Ga0068856_101759139
258 Ga0068864_100012262
259 Ga0068870_11281438
260 Ga0068863_100040671
261 Ga0068858_100637917
262 Ga0081455_10149756
263 Ga0070717_10027559
264 Ga0070717_11388497
265 Ga0070715_10139243
266 Ga0070712_100018256
267 Ga0070712_100823142
268 Ga0105245_10354807
269 Ga0105245_12841221
270 Ga0105247_11286674
271 Ga0105242_10259989
272 Ga0105248_10482283
273 Ga0105237_11224110
274 Ga0105238_10238138
275 Ga0105238_10616083
276 Ga0105238_11398466
277 Ga0105238_12779382
278 Ga0105239_10147150
279 Ga0105239_10512918
280 Ga0105239_11480538
281 Ga0157315_1002704
282 Ga0157316_1020704
283 Ga0157370_10225706
284 Ga0157370_10851125
285 Ga0157369_10000550
286 Ga0157369_10066401
287 Ga0157374_11978710
288 Ga0157374_11987114
289 Ga0157374_12287252
290 Ga0157378_13212587
291 Ga0157372_10234092
292 Ga0157372_10768026
293 Ga0157372_11556755
294 Ga0157375_10021528
295 Ga0157375_10820883
296 Ga0163163_10001227
297 Ga0157379_10066281
298 Ga0206351_10979573
299 Ga0206354_10430809
300 Ga0206353_10839417
301 Ga0224712_10254143
302 Ga0207710_10610219
303 Ga0207647_10234179
304 Ga0207699_10103371
305 Ga0207699_11058402
306 Ga0207705_10027475
307 Ga0207705_10065331
308 Ga0207705_10139043
309 Ga0207707_10079071
310 Ga0207693_10033545
311 Ga0207693_10329514
312 Ga0207663_10139685
313 Ga0207663_11292159
314 Ga0207660_10171543
315 Ga0207657_10080158
316 Ga0207657_10114312
317 Ga0207657_10229364
318 Ga0207649_10917056
319 Ga0207652_10019238
320 Ga0207652_10944771
321 Ga0207694_10178043
322 Ga0207687_10281772
323 Ga0207700_10060834
324 Ga0207700_10442487
325 Ga0207690_10000226
326 Ga0207690_10521028
327 Ga0207686_10225461
328 Ga0207711_10201481
329 Ga0207689_10209422
330 Ga0207661_10116498
331 Ga0207661_11584225
332 Ga0207667_10612971
333 Ga0207667_11313368
334 Ga0207677_10022341
335 Ga0207708_11938664
336 Ga0207641_10135016
337 Ga0207676_11609216
338 Ga0207674_10139576
339 Ga0307515_10049889
340 Ga0307515_10199675
341 Ga0307515_10903550
342 Ga0265338_10121886
343 Ga0265325_10169287
344 Ga0307513_10245825
345 Ga0307509_10061552
346 Ga0307509_10510558
347 Ga0307508_10000257
348 Ga0307508_10122011
349 Ga0307514_10285526
350 Ga0316579_10005133
351 Ga0265342_10210951
352 Ga0316576_10000610
353 Ga0316576_10003622
354 Ga0316578_10003501
355 Ga0307516_10006695
356 Ga0307516_10018849
357 Ga0316577_10078222
358 Ga0307410_10094951
359 Ga0307406_10249173
360 Ga0307409_100011747
361 Ga0307409_100657261
362 Ga0307409_100985434
363 Ga0307416_100043707
364 Ga0307416_100247013
365 Ga0307411_10923357
366 Ga0307415_101402912
367 Ga0316583_10001843
368 Ga0316585_10001312
369 Ga0316580_10028930
370 Ga0316580_10259139
371 Ga0316593_10004411
372 Ga0307507_10659107
373 Ga0316592_1001227
374 Ga0316586_1000463
375 Ga0316588_1001040
376 Ga0316588_1058485
377 Ga0316588_1185997
378 Ga0316587_1000552
379 Ga0316596_1001543
380 Ga0316596_1032485
381 Ga0316596_1035116
382 Ga0373962_0001717
383 Ga0316574_0461183
384 Ga0316582_0270613
385 Ga0316584_0002335
386 Ga0316584_0765081
387 Ga0316584_1071925
388 Ga0373925_0875352
389 Ga0373925_1242903
390 Ga0373925_1627305
391 Ga0395899_0002118
392 Ga0316581_0000947
393 Ga0439460_0040174
394 Ga0439440_0171797
395 Ga0466969_0087865
396 Ga0466969_0156086
397 Ga0466966_0041686
398 Ga0466961_0209358
399 Ga0466961_0263548
400 Ga0466963_0485639
401 Ga0466963_0740451
402 Ga0466959_0011693
403 Ga0466967_0140470
404 Ga0495603_0189040
405 Ga0495580_0595903
406 Ga0495639_0298518
407 Ga0495608_0424578
408 Ga0495632_0100562
409 Ga0495632_0292089
410 Ga0495667_0229127
411 Ga0495647_0144974
412 Ga0495658_0844664
413 Ga0495649_0233038
414 Ga0495593_0196898
415 Ga0496101_1092352
416 Ga0496103_0625544
417 Ga0496104_0161376
418 Ga0496104_0277318
419 Ga0496104_0586750
420 Ga0496108_0136169
421 Ga0496108_0205894
422 Ga0496108_0258293
423 Ga0496109_0323533
424 Ga0496109_1597232
425 Ga0496110_0003609
426 Ga0496110_0283926
427 Ga0496110_0484321
428 Ga0496111_0076504
429 Ga0496112_0016267
430 Ga0496112_0161044
431 Ga0496113_0046173
432 Ga0496114_0015994
433 Ga0496115_0385750
434 Ga0496126_0000048
435 Ga0501031_0933490
436 Ga0501034_0333987
437 Ga0501037_0525014
438 Ga0501039_0337056
439 Ga0501040_0719003
440 Ga0501042_0241077
441 Ga0501048_0645580
442 Ga0501070_0061746
443 Ga0501075_0434998
444 Ga0501076_0444056
445 Ga0495595_0220409
446 Ga0495595_0687291
447 Ga0500583_0559913
448 Ga0500641_0013657
449 Ga0500614_070516
450 Ga0500652_021257
451 Ga0500588_0081363
452 Ga0500630_282715
453 2515496803
454 2515758883
455 2516090862
456 2932433485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04358

DsrC

DsrC like protein

19

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jso-assembly1.cif.gz_B classic protein with a new twist: crystal structure of a lexa repressor dna complex 0.8808 40 73
2v4j-assembly1.cif.gz_F the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration 0.864 4 104
2xsj-assembly1.cif.gz_F structure of desulforubidin from desulfomicrobium norvegicum 0.8591 2 104
3or1-assembly1.cif.gz_F crystal structure of dissimilatory sulfite reductase i (dsri) 0.8554 2 104
3or2-assembly1.cif.gz_F crystal structure of dissimilatory sulfite reductase ii (dsrii) 0.8441 2 104
ID Description Score Start End Superfamily
2v4jF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.8575 41 104 1.10.10.370
3or1F02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.8501 41 104 1.10.10.370
2v4jF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.8457 41 104 1.10.10.370
3or1F02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.8385 41 104 1.10.10.370
af_Q58629_1_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8212 39 73 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y1UXM6-F1-model_v4 TusE/DsrC/DsvC family sulfur relay protein 0.9845 26 104 GO:0002143
GO:0005737
GO:0097163
AF-T0Z464-F1-model_v4 Sulfur relay protein, TusE/DsrC/DsvC family 0.9737 20 104 GO:0002143
GO:0005737
GO:0097163
AF-A0A7Y1UXM6-F1-model_v4 TusE/DsrC/DsvC family sulfur relay protein 0.9723 26 104 GO:0002143
GO:0005737
GO:0097163
AF-A0A1G6GEF8-F1-model_v4 tRNA 2-thiouridine synthesizing protein E 0.9707 1 104 GO:0002143
GO:0005737
GO:0097163
AF-A0A5Q2FAF3-F1-model_v4 TusE/DsrC/DsvC family sulfur relay protein 0.9702 1 104 GO:0002143
GO:0005737
GO:0097163

Map