F340823

General Info

Members Datasets Scaffolds Average Seq Length
228 152 227 122

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10018034|Ga0075366_100180347
Length 139
Sequence MPCALASIPWTKIASHKENNMLLGLRTIIYPAPDMQKATAWYTSAIGHAPYFNEPFYVGFNVGGYELGLLPAEEASAPVTYWGTPDIVAERERLIDAGALPDSDIQDVGDGIKVATLKDPFGNVVGLIENPHFKAERAA

Samples

Sample ID Description Type Environment
1 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.3
Nodule 0
Rhizoplane 11.4
Rhizosphere 67.11
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10081466 3300003203 Bacteria 992
2 Ga0065704_10104954 3300005289 Bacteria 2125
3 Ga0070658_10017854 3300005327 Bacteria 5674
4 Ga0070658_10560145 3300005327 Bacteria 989
5 Ga0070658_10969043 3300005327 Bacteria 740
6 Ga0070683_100576806 3300005329 Bacteria 1076
7 Ga0070690_100012253 3300005330 Bacteria 5044
8 Ga0070670_100230048 3300005331 Bacteria 1613
9 Ga0068868_100069426 3300005338 Bacteria 2808
10 Ga0070660_101148529 3300005339 Bacteria 658
11 Ga0070675_100028462 3300005354 Bacteria 4497
12 Ga0070675_101315068 3300005354 Bacteria 666
13 Ga0070671_101226351 3300005355 Bacteria 660
14 Ga0070673_101338378 3300005364 Bacteria 673
15 Ga0070688_100039011 3300005365 Bacteria 2905
16 Ga0070688_100090612 3300005365 Bacteria 1997
17 Ga0070659_100822499 3300005366 Bacteria 809
18 Ga0070659_100958132 3300005366 Bacteria 750
19 Ga0070667_100078747 3300005367 Bacteria 2816
20 Ga0070667_101164584 3300005367 Bacteria 721
21 Ga0070709_11349030 3300005434 Unclassified 576
22 Ga0070714_101798290 3300005435 Bacteria 598
23 Ga0070713_100079257 3300005436 Bacteria 2798
24 Ga0070713_100471201 3300005436 Bacteria 1182
25 Ga0070713_100982021 3300005436 Bacteria 814
26 Ga0070710_10039043 3300005437 Bacteria 2611
27 Ga0070710_10063166 3300005437 Bacteria 2115
28 Ga0070701_10142282 3300005438 Bacteria 1373
29 Ga0070700_100531663 3300005441 Unclassified 910
30 Ga0070694_100430319 3300005444 Unclassified 1038
31 Ga0070662_100952200 3300005457 Bacteria 734
32 Ga0070681_10467234 3300005458 Bacteria 1174
33 Ga0068867_100099308 3300005459 Bacteria 2221
34 Ga0068867_100482779 3300005459 Bacteria 1062
35 Ga0070685_10097284 3300005466 Bacteria 1792
36 Ga0070698_101197082 3300005471 Unclassified 709
37 Ga0070699_100953179 3300005518 Bacteria 786
38 Ga0070679_100144174 3300005530 Bacteria 2360
39 Ga0070679_100925721 3300005530 Bacteria 815
40 Ga0068853_101449632 3300005539 Unclassified 664
41 Ga0070696_101888278 3300005546 Bacteria 517
42 Ga0070704_100871019 3300005549 Bacteria 808
43 Ga0068855_100356024 3300005563 Bacteria 1611
44 Ga0070664_100544411 3300005564 Bacteria 1073
45 Ga0068856_100601242 3300005614 Bacteria 1121
46 Ga0068852_102290784 3300005616 Bacteria 561
47 Ga0068859_100280207 3300005617 Bacteria 1760
48 Ga0068859_100456245 3300005617 Bacteria 1374
49 Ga0068864_100021782 3300005618 Bacteria 5369
50 Ga0068864_100342612 3300005618 Bacteria 1409
51 Ga0068866_10359958 3300005718 Bacteria 927
52 Ga0068861_102537612 3300005719 Bacteria 516
53 Ga0068863_100045410 3300005841 Bacteria 4169
54 Ga0068860_100016906 3300005843 Bacteria 7110
55 Ga0081539_10090717 3300005985 Bacteria 1580
56 Ga0075365_10002018 3300006038 Bacteria 9633
57 Ga0075365_10052562 3300006038 Bacteria 2695
58 Ga0075365_10302047 3300006038 Bacteria 1127
59 Ga0075365_10459122 3300006038 Bacteria 900
60 Ga0075368_10099583 3300006042 Bacteria 1193
61 Ga0075368_10178718 3300006042 Unclassified 894
62 Ga0075363_100003497 3300006048 Bacteria 6688
63 Ga0075363_100096369 3300006048 Bacteria 1633
64 Ga0075363_100251569 3300006048 Unclassified 1017
65 Ga0075363_100315863 3300006048 Bacteria 908
66 Ga0075364_10012463 3300006051 Bacteria 5202
67 Ga0075364_10017349 3300006051 Bacteria 4496
68 Ga0075364_10074424 3300006051 Bacteria 2240
69 Ga0075364_10208439 3300006051 Bacteria 1325
70 Ga0075364_10382569 3300006051 Bacteria 960
71 Ga0075364_10391965 3300006051 Bacteria 947
72 Ga0070712_100356752 3300006175 Bacteria 1198
73 Ga0075362_10007283 3300006177 Bacteria 4181
74 Ga0075362_10550458 3300006177 Bacteria 593
75 Ga0075367_10046407 3300006178 Bacteria 2552
76 Ga0075367_10125113 3300006178 Unclassified 1586
77 Ga0075367_10539361 3300006178 Bacteria 741
78 Ga0075369_10175903 3300006186 Bacteria 984
79 Ga0075366_10018034 3300006195 Unclassified 4074
80 Ga0075366_10182307 3300006195 Bacteria 1276
81 Ga0075366_10311854 3300006195 Unclassified 963
82 Ga0075366_10803184 3300006195 Bacteria 585
83 Ga0097621_100394862 3300006237 Bacteria 1238
84 Ga0068871_100483905 3300006358 Bacteria 1114
85 Ga0097620_100280200 3300006931 Bacteria 1760
86 Ga0097620_100456203 3300006931 Bacteria 1374
87 Ga0105251_10046417 3300009011 Bacteria 2090
88 Ga0105244_10297385 3300009036 Bacteria 747
89 Ga0105245_11698725 3300009098 Bacteria 684
90 Ga0105245_11703279 3300009098 Bacteria 683
91 Ga0105243_11797858 3300009148 Bacteria 644
92 Ga0105243_12502962 3300009148 Bacteria 555
93 Ga0105248_13428054 3300009177 Bacteria 503
94 Ga0105239_13627610 3300010375 Bacteria 501
95 Ga0157374_10064960 3300013296 Bacteria 3426
96 Ga0157374_10738450 3300013296 Bacteria 999
97 Ga0157374_12627416 3300013296 Bacteria 531
98 Ga0157378_10814520 3300013297 Unclassified 960
99 Ga0163162_10663400 3300013306 Bacteria 1166
100 Ga0157375_10013423 3300013308 Bacteria 7290
101 Ga0163163_10034921 3300014325 Bacteria 4874
102 Ga0163163_10210394 3300014325 Bacteria 1994
103 Ga0163163_11947782 3300014325 Bacteria 647
104 Ga0157379_10450595 3300014968 Bacteria 1188
105 Ga0157376_10463230 3300014969 Bacteria 1239
106 Ga0207692_10007884 3300025898 Bacteria 4386
107 Ga0207680_10220888 3300025903 Bacteria 1299
108 Ga0207643_10341594 3300025908 Bacteria 938
109 Ga0207705_10049665 3300025909 Bacteria 3019
110 Ga0207695_10774989 3300025913 Bacteria 839
111 Ga0207660_10879913 3300025917 Bacteria 731
112 Ga0207657_10736178 3300025919 Bacteria 764
113 Ga0207652_10048269 3300025921 Bacteria 3639
114 Ga0207652_11184785 3300025921 Bacteria 665
115 Ga0207659_10244828 3300025926 Bacteria 1452
116 Ga0207700_10092709 3300025928 Unclassified 2389
117 Ga0207700_10175493 3300025928 Bacteria 1791
118 Ga0207700_10330458 3300025928 Bacteria 1323
119 Ga0207664_10147296 3300025929 Unclassified 1997
120 Ga0207664_11606196 3300025929 Bacteria 572
121 Ga0207690_10541680 3300025932 Bacteria 945
122 Ga0207706_10654599 3300025933 Bacteria 899
123 Ga0207704_10639606 3300025938 Bacteria 875
124 Ga0207711_10268454 3300025941 Bacteria 1569
125 Ga0207667_10318567 3300025949 Bacteria 1588
126 Ga0207651_10377999 3300025960 Bacteria 1200
127 Ga0207658_10744880 3300025986 Bacteria 887
128 Ga0207658_11437085 3300025986 Bacteria 631
129 Ga0207703_10839137 3300026035 Bacteria 878
130 Ga0207678_10293256 3300026067 Bacteria 1397
131 Ga0207678_10372030 3300026067 Unclassified 1234
132 Ga0207678_10464988 3300026067 Bacteria 1100
133 Ga0207708_10000036 3300026075 Bacteria 138158
134 Ga0207641_10039113 3300026088 Bacteria 3966
135 Ga0207648_10137024 3300026089 Bacteria 2156
136 Ga0207676_10123905 3300026095 Bacteria 2184
137 Ga0207675_101809076 3300026118 Bacteria 630
138 Ga0207675_102286591 3300026118 Bacteria 555
139 Ga0207683_10009059 3300026121 Bacteria 8483
140 Ga0207698_11793538 3300026142 Bacteria 629
141 Ga0268266_10136258 3300028379 Bacteria 2199
142 Ga0268266_10221214 3300028379 Bacteria 1740
143 Ga0268264_10039428 3300028381 Bacteria 3903
144 Ga0265319_1071169 3300028563 Unclassified 1115
145 Ga0265334_10019269 3300028573 Bacteria 2808
146 Ga0265336_10093263 3300028666 Bacteria 897
147 Ga0265338_10007096 3300028800 Bacteria 14036
148 Ga0265327_10000646 3300031251 Bacteria 56310
149 Ga0265327_10050345 3300031251 Bacteria 2180
150 Ga0265327_10081630 3300031251 Bacteria 1596
151 Ga0307409_100058617 3300031995 Bacteria 2992
152 Ga0373931_0069791 3300035691 Bacteria 1915
153 Ga0373925_0003597 3300037068 Bacteria 11945
154 Ga0373925_0619635 3300037068 Bacteria 891
155 Ga0451853_3773843 3300041512 Bacteria 1155
156 Ga0495606_0427280 3300046507 Bacteria 684
157 Ga0495608_0362475 3300046511 Bacteria 891
158 Ga0495652_0887725 3300046529 Bacteria 589
159 Ga0495668_0269816 3300046616 Bacteria 932
160 Ga0495635_1066629 3300046663 Unclassified 512
161 Ga0495657_0142552 3300046675 Bacteria 1493
162 Ga0495599_0054598 3300046678 Bacteria 2503
163 Ga0495674_1137475 3300047319 Unclassified 593
164 Ga0495672_0000599 3300047320 Bacteria 40591
165 Ga0495676_0156089 3300047321 Bacteria 1619
166 Ga0495680_0137826 3300047322 Bacteria 1788
167 Ga0496100_0015836 3300048903 Bacteria 4413
168 Ga0496100_0142206 3300048903 Bacteria 1702
169 Ga0496100_1115190 3300048903 Bacteria 622
170 Ga0496101_0659751 3300048904 Bacteria 826
171 Ga0496102_0031825 3300048905 Bacteria 4735
172 Ga0496102_0338605 3300048905 Bacteria 1417
173 Ga0496102_1710075 3300048905 Unclassified 547
174 Ga0496103_0339511 3300048906 Bacteria 966
175 Ga0496104_0145836 3300048907 Bacteria 2273
176 Ga0496104_0235873 3300048907 Bacteria 1741
177 Ga0496105_0054811 3300048908 Bacteria 3292
178 Ga0496105_0237415 3300048908 Bacteria 1480
179 Ga0496106_0046017 3300048909 Bacteria 3279
180 Ga0496107_0150176 3300048910 Bacteria 1723
181 Ga0496107_0454094 3300048910 Bacteria 952
182 Ga0496108_0406428 3300048911 Unclassified 1189
183 Ga0496109_0700889 3300048912 Bacteria 950
184 Ga0496109_2035808 3300048912 Bacteria 506
185 Ga0496112_0198739 3300048915 Unclassified 1965
186 Ga0496112_0916046 3300048915 Bacteria 798
187 Ga0496114_0046936 3300048917 Bacteria 3590
188 Ga0496114_0569223 3300048917 Bacteria 1000
189 Ga0496115_0020252 3300048918 Bacteria 5129
190 Ga0496115_0679250 3300048918 Bacteria 811
191 Ga0496115_0683385 3300048918 Bacteria 808
192 Ga0496115_0964449 3300048918 Unclassified 654
193 Ga0496121_0008171 3300048924 Bacteria 12425
194 Ga0496126_0002482 3300048929 Bacteria 24819
195 Ga0496126_0638925 3300048929 Bacteria 834
196 Ga0501043_0417759 3300049579 Bacteria 1011
197 Ga0501069_0023438 3300049585 Bacteria 3366
198 Ga0501070_0015270 3300049586 Bacteria 6462
199 Ga0501071_0001243 3300049587 Bacteria 14439
200 Ga0501073_0108928 3300049589 Bacteria 1922
201 Ga0501074_0761776 3300049590 Bacteria 682
202 Ga0501074_0993274 3300049590 Bacteria 590
203 Ga0501080_0291753 3300049742 Bacteria 1481
204 Ga0501083_0071995 3300049744 Bacteria 2298
205 Ga0501035_0320506 3300049822 Bacteria 1302
206 nmdc:mga03683_19107_c1 3300050489 Bacteria 2612
207 nmdc:mga03n38_225174_c1 3300050490 Unclassified 981
208 nmdc:mga03n38_334572_c1 3300050490 Bacteria 821
209 nmdc:mga03n38_88277_c1 3300050490 Bacteria 1471
210 nmdc:mga00v17_179866_c1 3300050491 Bacteria 1364
211 nmdc:mga00v17_21728_c1 3300050491 Bacteria 3693
212 nmdc:mga00v17_27767_c1 3300050491 Bacteria 3307
213 nmdc:mga00v17_392810_c1 3300050491 Bacteria 902
214 nmdc:mga0yw44_137861_c1 3300050492 Unclassified 1584
215 nmdc:mga0yw44_38948_c1 3300050492 Bacteria 2815
216 nmdc:mga0k408_33835_c1 3300050493 Bacteria 2924
217 nmdc:mga06z11_21570_c1 3300050494 Bacteria 2995
218 nmdc:mga06z11_75299_c1 3300050494 Bacteria 1797
219 nmdc:mga06z11_762637_c1 3300050494 Unclassified 589
220 nmdc:mga04h51_297153_c1 3300050495 Bacteria 657
221 nmdc:mga0sz30_114683_c1 3300050516 Unclassified 1182
222 nmdc:mga0sz30_550629_c1 3300050516 Bacteria 520
223 Ga0495601_0001754 3300053077 Bacteria 12008
224 Ga0500635_0000079 3300053080 Bacteria 63227
225 Ga0495619_0002159 3300053085 Bacteria 13033
226 Ga0495619_0011034 3300053085 Bacteria 5684
227 Ga0495619_0604832 3300053085 Unclassified 750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100012253 Ga0070690_1000122539 100
2 3300005331 Ga0070670_100230048 Ga0070670_1002300482 100
3 3300005338 Ga0068868_100069426 Ga0068868_1000694265 100
4 3300005354 Ga0070675_100028462 Ga0070675_1000284624 100
5 3300005355 Ga0070671_101226351 Ga0070671_1012263511 100
6 3300005365 Ga0070688_100090612 Ga0070688_1000906123 100
7 3300005367 Ga0070667_100078747 Ga0070667_1000787475 100
8 3300005457 Ga0070662_100952200 Ga0070662_1009522001 100
9 3300005564 Ga0070664_100544411 Ga0070664_1005444112 100
10 3300005617 Ga0068859_100280207 Ga0068859_1002802073 100
11 3300005618 Ga0068864_100021782 Ga0068864_1000217823 100
12 3300005841 Ga0068863_100045410 Ga0068863_1000454102 100
13 3300006237 Ga0097621_100394862 Ga0097621_1003948622 100
14 3300006358 Ga0068871_100483905 Ga0068871_1004839052 100
15 3300006931 Ga0097620_100280200 Ga0097620_1002802003 100
16 3300009011 Ga0105251_10046417 Ga0105251_100464171 100
17 3300009177 Ga0105248_13428054 Ga0105248_134280542 100
18 3300013296 Ga0157374_10064960 Ga0157374_100649602 100
19 3300013306 Ga0163162_10663400 Ga0163162_106634002 100
20 3300014325 Ga0163163_10034921 Ga0163163_100349212 100
21 3300014968 Ga0157379_10450595 Ga0157379_104505952 100
22 3300014969 Ga0157376_10463230 Ga0157376_104632302 100
23 3300025903 Ga0207680_10220888 Ga0207680_102208882 100
24 3300025908 Ga0207643_10341594 Ga0207643_103415942 100
25 3300025926 Ga0207659_10244828 Ga0207659_102448282 100
26 3300025941 Ga0207711_10268454 Ga0207711_102684542 100
27 3300025960 Ga0207651_10377999 Ga0207651_103779992 100
28 3300026035 Ga0207703_10839137 Ga0207703_108391372 100
29 3300026067 Ga0207678_10293256 Ga0207678_102932562 100
30 3300026088 Ga0207641_10039113 Ga0207641_100391135 100
31 3300026095 Ga0207676_10123905 Ga0207676_101239052 100
32 3300026121 Ga0207683_10009059 Ga0207683_100090593 100
33 3300028379 Ga0268266_10221214 Ga0268266_102212142 100
34 3300046529 Ga0495652_0887725 Ga0495652_0887725_234_554 100
35 3300009148 Ga0105243_11797858 Ga0105243_117978582 105
36 3300009098 Ga0105245_11698725 Ga0105245_116987251 106
37 3300009148 Ga0105243_12502962 Ga0105243_125029621 107
38 3300014325 Ga0163163_10210394 Ga0163163_102103943 107
39 3300048911 Ga0496108_0406428 Ga0496108_0406428_508_876 107
40 3300048915 Ga0496112_0198739 Ga0496112_0198739_577_945 107
41 3300048915 Ga0496112_0916046 Ga0496112_0916046_271_633 107
42 3300053080 Ga0500635_0000079 Ga0500635_0000079_13337_13726 107
43 3300013296 Ga0157374_12627416 Ga0157374_126274161 108
44 iso_pu_bacteria 2643221632 2644182812 111
45 3300048903 Ga0496100_1115190 Ga0496100_1115190_203_583 112
46 3300005518 Ga0070699_100953179 Ga0070699_1009531792 113
47 3300006042 Ga0075368_10099583 Ga0075368_100995833 113
48 3300006051 Ga0075364_10382569 Ga0075364_103825692 113
49 3300006178 Ga0075367_10046407 Ga0075367_100464072 113
50 3300050491 nmdc:mga00v17_179866_c1 nmdc:mga00v17_179866_c1_680_1030 113
51 3300050494 nmdc:mga06z11_21570_c1 nmdc:mga06z11_21570_c1_1295_1645 113
52 3300050495 nmdc:mga04h51_297153_c1 nmdc:mga04h51_297153_c1_260_610 113
53 3300005327 Ga0070658_10017854 Ga0070658_100178545 114
54 3300005327 Ga0070658_10560145 Ga0070658_105601451 114
55 3300005327 Ga0070658_10969043 Ga0070658_109690432 114
56 3300005339 Ga0070660_101148529 Ga0070660_1011485292 114
57 3300005435 Ga0070714_101798290 Ga0070714_1017982901 114
58 3300005436 Ga0070713_100471201 Ga0070713_1004712012 114
59 3300005437 Ga0070710_10063166 Ga0070710_100631662 114
60 3300005458 Ga0070681_10467234 Ga0070681_104672342 114
61 3300005459 Ga0068867_100482779 Ga0068867_1004827792 114
62 3300005471 Ga0070698_101197082 Ga0070698_1011970822 114
63 3300005530 Ga0070679_100144174 Ga0070679_1001441743 114
64 3300005530 Ga0070679_100925721 Ga0070679_1009257212 114
65 3300005539 Ga0068853_101449632 Ga0068853_1014496321 114
66 3300005546 Ga0070696_101888278 Ga0070696_1018882781 114
67 3300005549 Ga0070704_100871019 Ga0070704_1008710191 114
68 3300006195 Ga0075366_10018034 Ga0075366_100180347 114
69 3300006195 Ga0075366_10182307 Ga0075366_101823072 114
70 3300025909 Ga0207705_10049665 Ga0207705_100496653 114
71 3300025913 Ga0207695_10774989 Ga0207695_107749892 114
72 3300025919 Ga0207657_10736178 Ga0207657_107361782 114
73 3300025921 Ga0207652_10048269 Ga0207652_100482694 114
74 3300025921 Ga0207652_11184785 Ga0207652_111847851 114
75 3300025928 Ga0207700_10330458 Ga0207700_103304582 114
76 3300025929 Ga0207664_11606196 Ga0207664_116061961 114
77 3300025949 Ga0207667_10318567 Ga0207667_103185672 114
78 3300031251 Ga0265327_10000646 Ga0265327_1000064652 114
79 3300031251 Ga0265327_10050345 Ga0265327_100503452 114
80 3300031251 Ga0265327_10081630 Ga0265327_100816302 114
81 3300035691 Ga0373931_0069791 Ga0373931_0069791_842_1204 114
82 3300046511 Ga0495608_0362475 Ga0495608_0362475_364_717 114
83 3300046663 Ga0495635_1066629 Ga0495635_1066629_128_490 114
84 3300046675 Ga0495657_0142552 Ga0495657_0142552_1090_1452 114
85 3300047319 Ga0495674_1137475 Ga0495674_1137475_130_492 114
86 3300047320 Ga0495672_0000599 Ga0495672_0000599_22454_22816 114
87 3300047321 Ga0495676_0156089 Ga0495676_0156089_427_789 114
88 3300047322 Ga0495680_0137826 Ga0495680_0137826_565_927 114
89 3300048903 Ga0496100_0015836 Ga0496100_0015836_148_510 114
90 3300048904 Ga0496101_0659751 Ga0496101_0659751_440_802 114
91 3300048905 Ga0496102_0031825 Ga0496102_0031825_3709_4071 114
92 3300048905 Ga0496102_1710075 Ga0496102_1710075_22_384 114
93 3300048907 Ga0496104_0235873 Ga0496104_0235873_971_1333 114
94 3300048908 Ga0496105_0237415 Ga0496105_0237415_240_602 114
95 3300048909 Ga0496106_0046017 Ga0496106_0046017_1433_1795 114
96 3300048910 Ga0496107_0150176 Ga0496107_0150176_157_519 114
97 3300048912 Ga0496109_0700889 Ga0496109_0700889_225_587 114
98 3300048918 Ga0496115_0683385 Ga0496115_0683385_299_661 114
99 3300049589 Ga0501073_0108928 Ga0501073_0108928_399_761 114
100 3300050493 nmdc:mga0k408_33835_c1 nmdc:mga0k408_33835_c1_1361_1780 114
101 3300053085 Ga0495619_0011034 Ga0495619_0011034_4924_5286 114
102 3300053085 Ga0495619_0604832 Ga0495619_0604832_33_395 114
103 3300003203 JGI25406J46586_10081466 JGI25406J46586_100814662 115
104 3300005289 Ga0065704_10104954 Ga0065704_101049543 115
105 3300005329 Ga0070683_100576806 Ga0070683_1005768062 115
106 3300005354 Ga0070675_101315068 Ga0070675_1013150682 115
107 3300005364 Ga0070673_101338378 Ga0070673_1013383782 115
108 3300005365 Ga0070688_100039011 Ga0070688_1000390112 115
109 3300005366 Ga0070659_100822499 Ga0070659_1008224991 115
110 3300005366 Ga0070659_100958132 Ga0070659_1009581321 115
111 3300005367 Ga0070667_101164584 Ga0070667_1011645842 115
112 3300005434 Ga0070709_11349030 Ga0070709_113490301 115
113 3300005436 Ga0070713_100079257 Ga0070713_1000792572 115
114 3300005436 Ga0070713_100982021 Ga0070713_1009820211 115
115 3300005437 Ga0070710_10039043 Ga0070710_100390435 115
116 3300005438 Ga0070701_10142282 Ga0070701_101422822 115
117 3300005441 Ga0070700_100531663 Ga0070700_1005316632 115
118 3300005444 Ga0070694_100430319 Ga0070694_1004303192 115
119 3300005459 Ga0068867_100099308 Ga0068867_1000993082 115
120 3300005466 Ga0070685_10097284 Ga0070685_100972844 115
121 3300005563 Ga0068855_100356024 Ga0068855_1003560243 115
122 3300005614 Ga0068856_100601242 Ga0068856_1006012421 115
123 3300005616 Ga0068852_102290784 Ga0068852_1022907842 115
124 3300005617 Ga0068859_100456245 Ga0068859_1004562451 115
125 3300005618 Ga0068864_100342612 Ga0068864_1003426122 115
126 3300005718 Ga0068866_10359958 Ga0068866_103599582 115
127 3300005719 Ga0068861_102537612 Ga0068861_1025376121 115
128 3300005843 Ga0068860_100016906 Ga0068860_1000169063 115
129 3300005985 Ga0081539_10090717 Ga0081539_100907172 115
130 3300006038 Ga0075365_10002018 Ga0075365_100020182 115
131 3300006038 Ga0075365_10052562 Ga0075365_100525623 115
132 3300006038 Ga0075365_10302047 Ga0075365_103020472 115
133 3300006038 Ga0075365_10459122 Ga0075365_104591222 115
134 3300006042 Ga0075368_10178718 Ga0075368_101787181 115
135 3300006048 Ga0075363_100003497 Ga0075363_1000034974 115
136 3300006048 Ga0075363_100096369 Ga0075363_1000963692 115
137 3300006048 Ga0075363_100251569 Ga0075363_1002515692 115
138 3300006048 Ga0075363_100315863 Ga0075363_1003158632 115
139 3300006051 Ga0075364_10012463 Ga0075364_100124633 115
140 3300006051 Ga0075364_10017349 Ga0075364_100173494 115
141 3300006051 Ga0075364_10074424 Ga0075364_100744242 115
142 3300006051 Ga0075364_10208439 Ga0075364_102084392 115
143 3300006051 Ga0075364_10391965 Ga0075364_103919652 115
144 3300006175 Ga0070712_100356752 Ga0070712_1003567522 115
145 3300006177 Ga0075362_10007283 Ga0075362_100072833 115
146 3300006177 Ga0075362_10550458 Ga0075362_105504581 115
147 3300006178 Ga0075367_10125113 Ga0075367_101251132 115
148 3300006178 Ga0075367_10539361 Ga0075367_105393612 115
149 3300006186 Ga0075369_10175903 Ga0075369_101759031 115
150 3300006195 Ga0075366_10311854 Ga0075366_103118542 115
151 3300006195 Ga0075366_10803184 Ga0075366_108031842 115
152 3300006931 Ga0097620_100456203 Ga0097620_1004562031 115
153 3300009036 Ga0105244_10297385 Ga0105244_102973852 115
154 3300009098 Ga0105245_11703279 Ga0105245_117032791 115
155 3300010375 Ga0105239_13627610 Ga0105239_136276101 115
156 3300013296 Ga0157374_10738450 Ga0157374_107384502 115
157 3300013297 Ga0157378_10814520 Ga0157378_108145202 115
158 3300013308 Ga0157375_10013423 Ga0157375_1001342313 115
159 3300014325 Ga0163163_11947782 Ga0163163_119477822 115
160 3300025898 Ga0207692_10007884 Ga0207692_100078846 115
161 3300025917 Ga0207660_10879913 Ga0207660_108799131 115
162 3300025928 Ga0207700_10092709 Ga0207700_100927092 115
163 3300025928 Ga0207700_10175493 Ga0207700_101754932 115
164 3300025929 Ga0207664_10147296 Ga0207664_101472962 115
165 3300025932 Ga0207690_10541680 Ga0207690_105416802 115
166 3300025933 Ga0207706_10654599 Ga0207706_106545992 115
167 3300025938 Ga0207704_10639606 Ga0207704_106396062 115
168 3300025986 Ga0207658_10744880 Ga0207658_107448802 115
169 3300025986 Ga0207658_11437085 Ga0207658_114370851 115
170 3300026067 Ga0207678_10372030 Ga0207678_103720301 115
171 3300026067 Ga0207678_10464988 Ga0207678_104649882 115
172 3300026075 Ga0207708_10000036 Ga0207708_1000003659 115
173 3300026089 Ga0207648_10137024 Ga0207648_101370242 115
174 3300026118 Ga0207675_101809076 Ga0207675_1018090762 115
175 3300026118 Ga0207675_102286591 Ga0207675_1022865911 115
176 3300026142 Ga0207698_11793538 Ga0207698_117935382 115
177 3300028379 Ga0268266_10136258 Ga0268266_101362583 115
178 3300028381 Ga0268264_10039428 Ga0268264_100394283 115
179 3300028563 Ga0265319_1071169 Ga0265319_10711691 115
180 3300028573 Ga0265334_10019269 Ga0265334_100192693 115
181 3300028666 Ga0265336_10093263 Ga0265336_100932632 115
182 3300028800 Ga0265338_10007096 Ga0265338_1000709613 115
183 3300031995 Ga0307409_100058617 Ga0307409_1000586173 115
184 3300037068 Ga0373925_0003597 Ga0373925_0003597_11150_11539 115
185 3300037068 Ga0373925_0619635 Ga0373925_0619635_221_610 115
186 3300041512 Ga0451853_3773843 Ga0451853_3773843_303_707 115
187 3300046507 Ga0495606_0427280 Ga0495606_0427280_298_645 115
188 3300046616 Ga0495668_0269816 Ga0495668_0269816_64_411 115
189 3300046678 Ga0495599_0054598 Ga0495599_0054598_1249_1614 115
190 3300048903 Ga0496100_0142206 Ga0496100_0142206_1028_1417 115
191 3300048905 Ga0496102_0338605 Ga0496102_0338605_903_1292 115
192 3300048906 Ga0496103_0339511 Ga0496103_0339511_199_555 115
193 3300048907 Ga0496104_0145836 Ga0496104_0145836_1598_1987 115
194 3300048908 Ga0496105_0054811 Ga0496105_0054811_2269_2658 115
195 3300048910 Ga0496107_0454094 Ga0496107_0454094_81_470 115
196 3300048912 Ga0496109_2035808 Ga0496109_2035808_31_378 115
197 3300048917 Ga0496114_0046936 Ga0496114_0046936_903_1292 115
198 3300048917 Ga0496114_0569223 Ga0496114_0569223_25_411 115
199 3300048918 Ga0496115_0020252 Ga0496115_0020252_1197_1586 115
200 3300048918 Ga0496115_0679250 Ga0496115_0679250_253_642 115
201 3300048918 Ga0496115_0964449 Ga0496115_0964449_136_510 115
202 3300048924 Ga0496121_0008171 Ga0496121_0008171_4800_5192 115
203 3300048929 Ga0496126_0002482 Ga0496126_0002482_5531_5914 115
204 3300048929 Ga0496126_0638925 Ga0496126_0638925_400_789 115
205 3300049579 Ga0501043_0417759 Ga0501043_0417759_188_568 115
206 3300049585 Ga0501069_0023438 Ga0501069_0023438_1646_2026 115
207 3300049586 Ga0501070_0015270 Ga0501070_0015270_3710_4090 115
208 3300049587 Ga0501071_0001243 Ga0501071_0001243_2299_2679 115
209 3300049590 Ga0501074_0761776 Ga0501074_0761776_266_646 115
210 3300049590 Ga0501074_0993274 Ga0501074_0993274_127_492 115
211 3300049742 Ga0501080_0291753 Ga0501080_0291753_324_689 115
212 3300049744 Ga0501083_0071995 Ga0501083_0071995_1722_2102 115
213 3300049822 Ga0501035_0320506 Ga0501035_0320506_505_870 115
214 3300050489 nmdc:mga03683_19107_c1 nmdc:mga03683_19107_c1_1549_1947 115
215 3300050490 nmdc:mga03n38_225174_c1 nmdc:mga03n38_225174_c1_22_420 115
216 3300050490 nmdc:mga03n38_334572_c1 nmdc:mga03n38_334572_c1_239_637 115
217 3300050490 nmdc:mga03n38_88277_c1 nmdc:mga03n38_88277_c1_210_608 115
218 3300050491 nmdc:mga00v17_21728_c1 nmdc:mga00v17_21728_c1_2253_2651 115
219 3300050491 nmdc:mga00v17_27767_c1 nmdc:mga00v17_27767_c1_1305_1703 115
220 3300050491 nmdc:mga00v17_392810_c1 nmdc:mga00v17_392810_c1_394_792 115
221 3300050492 nmdc:mga0yw44_137861_c1 nmdc:mga0yw44_137861_c1_1161_1559 115
222 3300050492 nmdc:mga0yw44_38948_c1 nmdc:mga0yw44_38948_c1_826_1224 115
223 3300050494 nmdc:mga06z11_75299_c1 nmdc:mga06z11_75299_c1_406_804 115
224 3300050494 nmdc:mga06z11_762637_c1 nmdc:mga06z11_762637_c1_101_499 115
225 3300050516 nmdc:mga0sz30_114683_c1 nmdc:mga0sz30_114683_c1_627_1025 115
226 3300050516 nmdc:mga0sz30_550629_c1 nmdc:mga0sz30_550629_c1_63_461 115
227 3300053077 Ga0495601_0001754 Ga0495601_0001754_7673_8038 115
228 3300053085 Ga0495619_0002159 Ga0495619_0002159_11831_12196 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

127

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.8248 5 110
7kyl-assembly2.cif.gz_Z powassan virus envelope protein diii in complex with neutralizing fab powv-80 0.8173 77 97
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8067 1 110
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8055 1 110
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.783 7 108
ID Description Score Start End Superfamily
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9649 6 51 3.30.720.120
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9369 59 107 3.30.720.110
af_B3DIV2_630_713_4.10.1240.30 Few Secondary Structures;Irregular;Hormone receptor fold; 0.8687 90 107 4.10.1240.30
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8518 61 108 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8455 59 106 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6F8YEF0-F1-model_v4 VOC domain-containing protein 0.9884 57 108
AF-A0A543HHE1-F1-model_v4 VOC domain-containing protein 0.9869 1 113
AF-A0A0B0HZU9-F1-model_v4 deleted 0.9851 59 110
AF-A0A344TPV1-F1-model_v4 VOC family protein 0.9836 1 111
AF-A0A521GJG8-F1-model_v4 VOC family protein 0.9823 1 115

Feature Viewer

pLDDT pTM Quality
92.51 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map