F340758

General Info

Members Datasets Scaffolds Average Seq Length
228 184 228 173

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100012906|Ga0070697_1000129062
Length 203
Sequence VPGYPRSVISPGCPHRRSTGFAVTSEESMVKITALVAAGLIVGLLVYAGTKPDAFSVQRSMDIKAPSEKIFTLIDDLQNWAAWSPWEKMDPIMKRTYSGAARGKGAVYEWEGNRDVGKGRMEITDTSSPSKVVIKLDFITPFEAHNTAEFTLGPAGDFTNVTWAMYGPNPYMSKVMTVFFDMDSMIGKQFETGLANLKAIAEN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
182 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.04
Nodule 0
Rhizoplane 4.82
Rhizosphere 76.32
Stem 0
Stem Tuber 0
Unclassified 4.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1033581 2162886007 Bacteria 1939
2 MBSR1b_contig_11036974 2162886012 Bacteria 829
3 JGI25156J39149_1005888 3300002705 Bacteria 3450
4 JGI25154J39366_1000117 3300002738 Bacteria 65094
5 Ga0055526_1000086 3300003771 Bacteria 86198
6 Ga0055537_1000012 3300003773 Bacteria 133761
7 Ga0055524_1002521 3300003775 Bacteria 9389
8 Ga0055534_1000436 3300003784 Bacteria 24676
9 Ga0055528_1000134 3300003790 Bacteria 60071
10 Ga0065704_10104974 3300005289 Bacteria 2124
11 Ga0065704_10370839 3300005289 Bacteria 721
12 Ga0065715_10002055 3300005293 Bacteria 5461
13 Ga0065707_10207597 3300005295 Bacteria 1281
14 Ga0070690_100722316 3300005330 Bacteria 767
15 Ga0070670_100122143 3300005331 Bacteria 2246
16 Ga0068869_100726025 3300005334 Bacteria 849
17 Ga0070666_10177269 3300005335 Unclassified 1494
18 Ga0070666_10246563 3300005335 Bacteria 1264
19 Ga0070666_10512334 3300005335 Bacteria 870
20 Ga0068868_100045608 3300005338 Bacteria 3430
21 Ga0070689_100049661 3300005340 Bacteria 3240
22 Ga0070661_100035428 3300005344 Bacteria 3624
23 Ga0070669_100224917 3300005353 Bacteria 1485
24 Ga0070671_100017377 3300005355 Bacteria 5826
25 Ga0070674_100291834 3300005356 Unclassified 1297
26 Ga0070673_100069776 3300005364 Bacteria 2818
27 Ga0070659_101166452 3300005366 Unclassified 680
28 Ga0070709_10218795 3300005434 Bacteria 1357
29 Ga0070709_10640417 3300005434 Bacteria 822
30 Ga0070714_100265809 3300005435 Unclassified 1589
31 Ga0070713_100016796 3300005436 Bacteria 5512
32 Ga0070710_10177902 3300005437 Bacteria 1330
33 Ga0070701_10444404 3300005438 Bacteria 831
34 Ga0070701_10907088 3300005438 Bacteria 609
35 Ga0070705_100321640 3300005440 Bacteria 1117
36 Ga0070705_100375853 3300005440 Bacteria 1044
37 Ga0070705_100377651 3300005440 Bacteria 1042
38 Ga0070694_100558999 3300005444 Bacteria 917
39 Ga0070708_100260813 3300005445 Bacteria 1629
40 Ga0070681_10168287 3300005458 Bacteria 2114
41 Ga0068867_100268630 3300005459 Bacteria 1393
42 Ga0070685_10316750 3300005466 Bacteria 1056
43 Ga0070706_100115804 3300005467 Bacteria 2496
44 Ga0070706_100184117 3300005467 Bacteria 1951
45 Ga0070707_100000981 3300005468 Bacteria 28230
46 Ga0070707_100536523 3300005468 Bacteria 1132
47 Ga0070698_100165435 3300005471 Bacteria 2155
48 Ga0070698_100248997 3300005471 Bacteria 1710
49 Ga0070699_100010847 3300005518 Bacteria 7884
50 Ga0070699_101283778 3300005518 Viruses 671
51 Ga0070697_100012906 3300005536 Bacteria 6546
52 Ga0070697_100320861 3300005536 Bacteria 1334
53 Ga0070672_100019058 3300005543 Bacteria 4972
54 Ga0070695_100045491 3300005545 Bacteria 2798
55 Ga0070696_100232010 3300005546 Bacteria 1389
56 Ga0070696_100342227 3300005546 Bacteria 1156
57 Ga0070696_100426604 3300005546 Bacteria 1042
58 Ga0070664_100079513 3300005564 Bacteria 2823
59 Ga0068857_100282229 3300005577 Bacteria 1528
60 Ga0068854_100008160 3300005578 Bacteria 6716
61 Ga0068854_100110019 3300005578 Bacteria 2077
62 Ga0068852_100010080 3300005616 Bacteria 7033
63 Ga0068859_100345885 3300005617 Bacteria 1581
64 Ga0068864_100831832 3300005618 Bacteria 909
65 Ga0068864_101020894 3300005618 Bacteria 821
66 Ga0068861_100813692 3300005719 Unclassified 878
67 Ga0068858_101138415 3300005842 Bacteria 766
68 Ga0070717_10768879 3300006028 Bacteria 876
69 Ga0075365_10044139 3300006038 Bacteria 2920
70 Ga0070716_100592103 3300006173 Unclassified 833
71 Ga0075362_10000952 3300006177 Bacteria 8838
72 Ga0075362_10139074 3300006177 Bacteria 1159
73 Ga0075362_10244965 3300006177 Bacteria 881
74 Ga0075369_10088355 3300006186 Bacteria 1381
75 Ga0075366_10167418 3300006195 Bacteria 1333
76 Ga0075366_10428875 3300006195 Bacteria 815
77 Ga0097621_100006785 3300006237 Bacteria 8136
78 Ga0097621_100149739 3300006237 Bacteria 2001
79 Ga0097621_101227472 3300006237 Bacteria 707
80 Ga0075370_10707042 3300006353 Bacteria 613
81 Ga0068871_100005203 3300006358 Bacteria 9095
82 Ga0075428_100157992 3300006844 Bacteria 2461
83 Ga0075428_100663613 3300006844 Bacteria 1112
84 Ga0075431_100421486 3300006847 Bacteria 1334
85 Ga0075433_10161393 3300006852 Bacteria 1995
86 Ga0075434_101051906 3300006871 Bacteria 828
87 Ga0068865_100498515 3300006881 Bacteria 1015
88 Ga0097620_100345881 3300006931 Bacteria 1581
89 Ga0099794_10067901 3300007265 Bacteria 1742
90 Ga0111539_10004381 3300009094 Bacteria 18469
91 Ga0105242_10410643 3300009176 Bacteria 1266
92 Ga0105248_10087205 3300009177 Bacteria 3512
93 Ga0105249_11130260 3300009553 Bacteria 854
94 Ga0099796_10309957 3300010159 Bacteria 671
95 Ga0157374_10014168 3300013296 Bacteria 6971
96 Ga0157378_10031378 3300013297 Bacteria 4695
97 Ga0163162_10032970 3300013306 Bacteria 5144
98 Ga0163162_11101845 3300013306 Bacteria 900
99 Ga0157380_10718729 3300014326 Bacteria 1006
100 Ga0157376_10139415 3300014969 Bacteria 2174
101 Ga0163161_10095881 3300017792 Bacteria 2201
102 Ga0213876_10001491 3300021384 Bacteria 14550
103 Ga0209435_100140 3300025206 Bacteria 24371
104 Ga0209646_1000020 3300025246 Bacteria 462204
105 Ga0209026_1002806 3300025250 Bacteria 6174
106 Ga0209759_1000073 3300025256 Bacteria 178048
107 Ga0209233_1003344 3300025261 Bacteria 5672
108 Ga0209565_1000057 3300025263 Bacteria 196908
109 Ga0209673_1000051 3300025273 Bacteria 282161
110 Ga0209675_1000027 3300025291 Bacteria 282175
111 Ga0209676_1016312 3300025292 Bacteria 2687
112 Ga0209564_1000009 3300025295 Bacteria 950196
113 Ga0209564_1000094 3300025295 Bacteria 243176
114 Ga0209256_1000139 3300025299 Bacteria 155515
115 Ga0207426_1005838 3300025302 Bacteria 5500
116 Ga0207680_10022388 3300025903 Bacteria 3436
117 Ga0207680_10875065 3300025903 Bacteria 644
118 Ga0207699_10020124 3300025906 Bacteria 3571
119 Ga0207699_10179176 3300025906 Bacteria 1423
120 Ga0207705_10030293 3300025909 Bacteria 3861
121 Ga0207684_10074327 3300025910 Bacteria 2888
122 Ga0207684_10193358 3300025910 Bacteria 1755
123 Ga0207646_10000125 3300025922 Bacteria 103911
124 Ga0207650_10009822 3300025925 Bacteria 6545
125 Ga0207659_10081934 3300025926 Bacteria 2387
126 Ga0207659_10172372 3300025926 Bacteria 1708
127 Ga0207700_10036339 3300025928 Bacteria 3556
128 Ga0207644_10014001 3300025931 Bacteria 5362
129 Ga0207670_10208010 3300025936 Bacteria 1490
130 Ga0207665_10870229 3300025939 Unclassified 714
131 Ga0207691_10025338 3300025940 Bacteria 5571
132 Ga0207711_10666533 3300025941 Bacteria 970
133 Ga0207651_10360968 3300025960 Bacteria 1226
134 Ga0207677_10005665 3300026023 Bacteria 6794
135 Ga0207648_10056026 3300026089 Bacteria 3441
136 Ga0207676_10717348 3300026095 Bacteria 970
137 Ga0207674_10079318 3300026116 Bacteria 3287
138 Ga0207675_100092861 3300026118 Unclassified 2838
139 Ga0207675_100145603 3300026118 Bacteria 2252
140 Ga0207683_10004513 3300026121 Bacteria 12013
141 Ga0207428_10015704 3300027907 Bacteria 6541
142 Ga0265327_10001967 3300031251 Bacteria 23494
143 Ga0307408_100033235 3300031548 Bacteria 3602
144 Ga0307405_10025221 3300031731 Bacteria 3409
145 Ga0307413_10078921 3300031824 Bacteria 2102
146 Ga0307410_10010843 3300031852 Bacteria 5186
147 Ga0307407_10008304 3300031903 Bacteria 4759
148 Ga0307412_10022906 3300031911 Bacteria 3836
149 Ga0307409_100004179 3300031995 Bacteria 8044
150 Ga0307416_100004578 3300032002 Bacteria 8357
151 Ga0307411_10120743 3300032005 Bacteria 1895
152 Ga0307415_100055006 3300032126 Bacteria 2720
153 Ga0373934_0149252 3300035086 Bacteria 957
154 Ga0373933_0086899 3300035724 Bacteria 1925
155 Ga0373933_0339093 3300035724 Bacteria 976
156 Ga0373937_0084695 3300036401 Bacteria 2933
157 Ga0395898_1280741 3300037466 Bacteria 663
158 Ga0436365_0921625 3300039437 Bacteria 24575
159 Ga0436362_0741099 3300039453 Bacteria 4353
160 Ga0451804_1159627 3300041463 Bacteria 866
161 Ga0451807_2722753 3300041486 Bacteria 725
162 Ga0495629_0013187 3300046459 Bacteria 5967
163 Ga0495662_0284244 3300046476 Bacteria 814
164 Ga0495584_0001834 3300046491 Bacteria 12339
165 Ga0495585_0000184 3300046492 Bacteria 66520
166 Ga0495585_0080102 3300046492 Bacteria 1770
167 Ga0495596_0001167 3300046500 Bacteria 15399
168 Ga0495583_0000903 3300046506 Bacteria 35338
169 Ga0495663_0019041 3300046525 Bacteria 1960
170 Ga0495642_0014970 3300046528 Bacteria 3010
171 Ga0495633_0001584 3300046558 Bacteria 17352
172 Ga0495668_0001881 3300046616 Bacteria 18807
173 Ga0495668_0231813 3300046616 Bacteria 1011
174 Ga0495661_0275494 3300046665 Bacteria 850
175 Ga0495599_0155747 3300046678 Bacteria 1414
176 Ga0495624_0813917 3300046690 Bacteria 552
177 Ga0495636_0012418 3300047318 Bacteria 3373
178 Ga0495680_0494205 3300047322 Bacteria 831
179 Ga0495683_0000182 3300047323 Bacteria 61818
180 Ga0495685_036472 3300047447 Bacteria 1688
181 Ga0495626_0297641 3300048091 Bacteria 638
182 Ga0496102_0008653 3300048905 Bacteria 8736
183 Ga0496102_0024737 3300048905 Bacteria 5341
184 Ga0496102_0050972 3300048905 Bacteria 3770
185 Ga0496103_0025232 3300048906 Bacteria 3591
186 Ga0496107_0301278 3300048910 Bacteria 1193
187 Ga0496109_0011004 3300048912 Bacteria 7754
188 Ga0496110_0075121 3300048913 Bacteria 3003
189 Ga0496114_0021498 3300048917 Bacteria 5249
190 Ga0496114_0184526 3300048917 Bacteria 1823
191 Ga0496125_0002721 3300048928 Bacteria 22456
192 Ga0496125_0164873 3300048928 Bacteria 1499
193 Ga0496126_0080226 3300048929 Bacteria 2888
194 Ga0501034_0029409 3300049571 Bacteria 5583
195 Ga0501038_0256158 3300049574 Bacteria 1384
196 Ga0501046_0000010 3300049580 Bacteria 331082
197 Ga0501047_0268001 3300049581 Bacteria 1554
198 Ga0501071_0483271 3300049587 Bacteria 949
199 Ga0501072_0091615 3300049588 Bacteria 2413
200 Ga0501074_0895388 3300049590 Bacteria 625
201 Ga0501076_0119648 3300049592 Bacteria 2132
202 Ga0501076_0126124 3300049592 Bacteria 2074
203 Ga0501077_0129119 3300049593 Bacteria 1602
204 Ga0501079_0149424 3300049741 Bacteria 1821
205 Ga0501083_0008389 3300049744 Bacteria 7306
206 Ga0501045_0070232 3300049824 Bacteria 2576
207 Ga0501045_0545140 3300049824 Bacteria 860
208 nmdc:mga03683_169405_c1 3300050489 Bacteria 992
209 nmdc:mga03683_264579_c1 3300050489 Bacteria 801
210 nmdc:mga03683_31154_c1 3300050489 Bacteria 2138
211 nmdc:mga03683_6420_c1 3300050489 Bacteria 4024
212 nmdc:mga03683_91595_c1 3300050489 Bacteria 1326
213 nmdc:mga0yw44_12735_c1 3300050492 Bacteria 4396
214 nmdc:mga06z11_327152_c1 3300050494 Bacteria 915
215 nmdc:mga09592_22502_c1 3300050508 Bacteria 5202
216 nmdc:mga0qj67_23465_c1 3300050509 Bacteria 4747
217 nmdc:mga0qj67_74728_c1 3300050509 Bacteria 2708
218 nmdc:mga06r32_15002_c1 3300050510 Bacteria 7033
219 nmdc:mga06r32_425529_c1 3300050510 Bacteria 1309
220 nmdc:mga08y16_22236_c1 3300050511 Bacteria 6692
221 nmdc:mga0n895_348598_c1 3300050512 Bacteria 1499
222 nmdc:mga0sz30_65732_c1 3300050516 Bacteria 1555
223 Ga0495601_0041676 3300053077 Bacteria 2879
224 Ga0495619_0082087 3300053085 Bacteria 2172
225 Ga0500636_0037115 3300053177 Bacteria 2883
226 Ga0500552_017957 3300053733 Bacteria 975
227 Ga0501082_0326745 3300060353 Bacteria 1336
228 Ga0530510_0080995 3300061734 Bacteria 2363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0339093 Ga0373933_0339093_56_481 141
2 3300046476 Ga0495662_0284244 Ga0495662_0284244_29_454 141
3 3300046690 Ga0495624_0813917 Ga0495624_0813917_24_449 141
4 3300047322 Ga0495680_0494205 Ga0495680_0494205_354_779 141
5 3300005435 Ga0070714_100265809 Ga0070714_1002658092 152
6 3300005436 Ga0070713_100016796 Ga0070713_1000167967 152
7 3300005437 Ga0070710_10177902 Ga0070710_101779021 152
8 3300006173 Ga0070716_100592103 Ga0070716_1005921032 152
9 3300025906 Ga0207699_10020124 Ga0207699_100201242 152
10 3300025928 Ga0207700_10036339 Ga0207700_100363392 152
11 3300025939 Ga0207665_10870229 Ga0207665_108702292 152
12 3300006844 Ga0075428_100663613 Ga0075428_1006636132 158
13 3300009094 Ga0111539_10004381 Ga0111539_1000438114 158
14 3300027907 Ga0207428_10015704 Ga0207428_100157042 158
15 3300050511 nmdc:mga08y16_22236_c1 nmdc:mga08y16_22236_c1_5692_6237 158
16 3300050508 nmdc:mga09592_22502_c1 nmdc:mga09592_22502_c1_4353_4928 160
17 3300050509 nmdc:mga0qj67_23465_c1 nmdc:mga0qj67_23465_c1_3811_4389 160
18 3300050510 nmdc:mga06r32_15002_c1 nmdc:mga06r32_15002_c1_5955_6533 160
19 3300050512 nmdc:mga0n895_348598_c1 nmdc:mga0n895_348598_c1_427_957 160
20 3300005335 Ga0070666_10246563 Ga0070666_102465632 162
21 3300005356 Ga0070674_100291834 Ga0070674_1002918342 162
22 3300005440 Ga0070705_100321640 Ga0070705_1003216402 162
23 3300005459 Ga0068867_100268630 Ga0068867_1002686301 162
24 3300005543 Ga0070672_100019058 Ga0070672_1000190584 162
25 3300005578 Ga0068854_100008160 Ga0068854_1000081609 162
26 3300005616 Ga0068852_100010080 Ga0068852_1000100806 162
27 3300006237 Ga0097621_100006785 Ga0097621_1000067856 162
28 3300006237 Ga0097621_100149739 Ga0097621_1001497393 162
29 3300006881 Ga0068865_100498515 Ga0068865_1004985152 162
30 3300009176 Ga0105242_10410643 Ga0105242_104106432 162
31 3300013306 Ga0163162_11101845 Ga0163162_111018451 162
32 3300014326 Ga0157380_10718729 Ga0157380_107187292 162
33 3300025903 Ga0207680_10022388 Ga0207680_100223884 162
34 3300025903 Ga0207680_10875065 Ga0207680_108750651 162
35 3300025909 Ga0207705_10030293 Ga0207705_100302933 162
36 3300025926 Ga0207659_10081934 Ga0207659_100819343 162
37 3300025940 Ga0207691_10025338 Ga0207691_100253386 162
38 3300026089 Ga0207648_10056026 Ga0207648_100560262 162
39 3300041486 Ga0451807_2722753 Ga0451807_2722753_53_589 162
40 3300048910 Ga0496107_0301278 Ga0496107_0301278_621_1157 162
41 3300048913 Ga0496110_0075121 Ga0496110_0075121_2298_2834 162
42 3300005518 Ga0070699_101283778 Ga0070699_1012837781 163
43 3300007265 Ga0099794_10067901 Ga0099794_100679012 163
44 3300010159 Ga0099796_10309957 Ga0099796_103099571 163
45 3300006844 Ga0075428_100157992 Ga0075428_1001579924 164
46 3300006847 Ga0075431_100421486 Ga0075431_1004214862 164
47 3300006871 Ga0075434_101051906 Ga0075434_1010519062 164
48 3300048905 Ga0496102_0050972 Ga0496102_0050972_2691_3230 164
49 3300048906 Ga0496103_0025232 Ga0496103_0025232_109_648 164
50 3300049571 Ga0501034_0029409 Ga0501034_0029409_667_1200 164
51 3300050509 nmdc:mga0qj67_74728_c1 nmdc:mga0qj67_74728_c1_959_1486 164
52 3300050510 nmdc:mga06r32_425529_c1 nmdc:mga06r32_425529_c1_616_1143 164
53 3300053177 Ga0500636_0037115 Ga0500636_0037115_1565_2098 164
54 2162886012 MBSR1b_contig_11036974 MBSR1b_0141.00003220 166
55 3300005331 Ga0070670_100122143 Ga0070670_1001221431 166
56 3300005334 Ga0068869_100726025 Ga0068869_1007260252 166
57 3300005335 Ga0070666_10177269 Ga0070666_101772692 166
58 3300005338 Ga0068868_100045608 Ga0068868_1000456085 166
59 3300005344 Ga0070661_100035428 Ga0070661_1000354285 166
60 3300005355 Ga0070671_100017377 Ga0070671_1000173771 166
61 3300005564 Ga0070664_100079513 Ga0070664_1000795132 166
62 3300005618 Ga0068864_101020894 Ga0068864_1010208942 166
63 3300005842 Ga0068858_101138415 Ga0068858_1011384151 166
64 3300006028 Ga0070717_10768879 Ga0070717_107688792 166
65 3300006358 Ga0068871_100005203 Ga0068871_1000052035 166
66 3300009177 Ga0105248_10087205 Ga0105248_100872055 166
67 3300009553 Ga0105249_11130260 Ga0105249_111302602 166
68 3300013296 Ga0157374_10014168 Ga0157374_100141682 166
69 3300013297 Ga0157378_10031378 Ga0157378_100313781 166
70 3300013306 Ga0163162_10032970 Ga0163162_100329707 166
71 3300014969 Ga0157376_10139415 Ga0157376_101394152 166
72 3300017792 Ga0163161_10095881 Ga0163161_100958812 166
73 3300025925 Ga0207650_10009822 Ga0207650_100098226 166
74 3300025931 Ga0207644_10014001 Ga0207644_100140017 166
75 3300025941 Ga0207711_10666533 Ga0207711_106665332 166
76 3300026023 Ga0207677_10005665 Ga0207677_100056652 166
77 3300026095 Ga0207676_10717348 Ga0207676_107173482 166
78 3300026121 Ga0207683_10004513 Ga0207683_100045132 166
79 3300048905 Ga0496102_0024737 Ga0496102_0024737_254_781 166
80 3300048912 Ga0496109_0011004 Ga0496109_0011004_6565_7101 166
81 3300050494 nmdc:mga06z11_327152_c1 nmdc:mga06z11_327152_c1_336_872 166
82 3300005434 Ga0070709_10218795 Ga0070709_102187952 167
83 3300005434 Ga0070709_10640417 Ga0070709_106404172 167
84 3300005458 Ga0070681_10168287 Ga0070681_101682872 167
85 3300025906 Ga0207699_10179176 Ga0207699_101791762 167
86 3300049744 Ga0501083_0008389 Ga0501083_0008389_1883_2404 167
87 3300003771 Ga0055526_1000086 Ga0055526_100008636 168
88 3300003773 Ga0055537_1000012 Ga0055537_1000012115 168
89 3300003775 Ga0055524_1002521 Ga0055524_10025215 168
90 3300003784 Ga0055534_1000436 Ga0055534_100043614 168
91 3300003790 Ga0055528_1000134 Ga0055528_100013459 168
92 3300005330 Ga0070690_100722316 Ga0070690_1007223162 168
93 3300005335 Ga0070666_10512334 Ga0070666_105123342 168
94 3300005340 Ga0070689_100049661 Ga0070689_1000496612 168
95 3300005353 Ga0070669_100224917 Ga0070669_1002249172 168
96 3300005366 Ga0070659_101166452 Ga0070659_1011664521 168
97 3300005438 Ga0070701_10444404 Ga0070701_104444042 168
98 3300005440 Ga0070705_100375853 Ga0070705_1003758532 168
99 3300005466 Ga0070685_10316750 Ga0070685_103167502 168
100 3300005546 Ga0070696_100426604 Ga0070696_1004266041 168
101 3300005617 Ga0068859_100345885 Ga0068859_1003458852 168
102 3300005618 Ga0068864_100831832 Ga0068864_1008318321 168
103 3300006237 Ga0097621_101227472 Ga0097621_1012274721 168
104 3300006931 Ga0097620_100345881 Ga0097620_1003458812 168
105 3300025261 Ga0209233_1003344 Ga0209233_10033442 168
106 3300025263 Ga0209565_1000057 Ga0209565_1000057117 168
107 3300025273 Ga0209673_1000051 Ga0209673_1000051171 168
108 3300025291 Ga0209675_1000027 Ga0209675_1000027171 168
109 3300025292 Ga0209676_1016312 Ga0209676_10163123 168
110 3300025295 Ga0209564_1000094 Ga0209564_1000094116 168
111 3300025299 Ga0209256_1000139 Ga0209256_1000139116 168
112 3300025302 Ga0207426_1005838 Ga0207426_10058387 168
113 3300025926 Ga0207659_10172372 Ga0207659_101723722 168
114 3300025936 Ga0207670_10208010 Ga0207670_102080102 168
115 3300025960 Ga0207651_10360968 Ga0207651_103609682 168
116 2162886007 SwRhRL2b_contig_1033581 SwRhRL2b_0961.00005410 169
117 3300002705 JGI25156J39149_1005888 JGI25156J39149_10058885 169
118 3300002738 JGI25154J39366_1000117 JGI25154J39366_100011769 169
119 3300005289 Ga0065704_10104974 Ga0065704_101049742 169
120 3300005289 Ga0065704_10370839 Ga0065704_103708391 169
121 3300005293 Ga0065715_10002055 Ga0065715_100020558 169
122 3300005295 Ga0065707_10207597 Ga0065707_102075972 169
123 3300005364 Ga0070673_100069776 Ga0070673_1000697766 169
124 3300005438 Ga0070701_10907088 Ga0070701_109070881 169
125 3300005440 Ga0070705_100377651 Ga0070705_1003776512 169
126 3300005444 Ga0070694_100558999 Ga0070694_1005589992 169
127 3300005445 Ga0070708_100260813 Ga0070708_1002608132 169
128 3300005467 Ga0070706_100115804 Ga0070706_1001158044 169
129 3300005467 Ga0070706_100184117 Ga0070706_1001841172 169
130 3300005468 Ga0070707_100000981 Ga0070707_1000009817 169
131 3300005468 Ga0070707_100536523 Ga0070707_1005365232 169
132 3300005471 Ga0070698_100165435 Ga0070698_1001654352 169
133 3300005471 Ga0070698_100248997 Ga0070698_1002489973 169
134 3300005518 Ga0070699_100010847 Ga0070699_1000108474 169
135 3300005536 Ga0070697_100012906 Ga0070697_1000129062 169
136 3300005536 Ga0070697_100320861 Ga0070697_1003208612 169
137 3300005545 Ga0070695_100045491 Ga0070695_1000454912 169
138 3300005546 Ga0070696_100232010 Ga0070696_1002320102 169
139 3300005546 Ga0070696_100342227 Ga0070696_1003422272 169
140 3300005577 Ga0068857_100282229 Ga0068857_1002822291 169
141 3300005578 Ga0068854_100110019 Ga0068854_1001100192 169
142 3300005719 Ga0068861_100813692 Ga0068861_1008136922 169
143 3300006038 Ga0075365_10044139 Ga0075365_100441392 169
144 3300006177 Ga0075362_10000952 Ga0075362_100009525 169
145 3300006177 Ga0075362_10139074 Ga0075362_101390742 169
146 3300006177 Ga0075362_10244965 Ga0075362_102449651 169
147 3300006186 Ga0075369_10088355 Ga0075369_100883552 169
148 3300006195 Ga0075366_10167418 Ga0075366_101674181 169
149 3300006195 Ga0075366_10428875 Ga0075366_104288752 169
150 3300006353 Ga0075370_10707042 Ga0075370_107070421 169
151 3300006852 Ga0075433_10161393 Ga0075433_101613933 169
152 3300021384 Ga0213876_10001491 Ga0213876_1000149117 169
153 3300025206 Ga0209435_100140 Ga0209435_10014010 169
154 3300025246 Ga0209646_1000020 Ga0209646_1000020245 169
155 3300025250 Ga0209026_1002806 Ga0209026_10028066 169
156 3300025256 Ga0209759_1000073 Ga0209759_100007351 169
157 3300025295 Ga0209564_1000009 Ga0209564_1000009257 169
158 3300025910 Ga0207684_10074327 Ga0207684_100743271 169
159 3300025910 Ga0207684_10193358 Ga0207684_101933584 169
160 3300025922 Ga0207646_10000125 Ga0207646_10000125109 169
161 3300026116 Ga0207674_10079318 Ga0207674_100793182 169
162 3300026118 Ga0207675_100092861 Ga0207675_1000928612 169
163 3300026118 Ga0207675_100145603 Ga0207675_1001456034 169
164 3300031251 Ga0265327_10001967 Ga0265327_100019673 169
165 3300031548 Ga0307408_100033235 Ga0307408_1000332353 169
166 3300031731 Ga0307405_10025221 Ga0307405_100252216 169
167 3300031824 Ga0307413_10078921 Ga0307413_100789213 169
168 3300031852 Ga0307410_10010843 Ga0307410_100108434 169
169 3300031903 Ga0307407_10008304 Ga0307407_100083044 169
170 3300031911 Ga0307412_10022906 Ga0307412_100229064 169
171 3300031995 Ga0307409_100004179 Ga0307409_1000041794 169
172 3300032002 Ga0307416_100004578 Ga0307416_1000045787 169
173 3300032005 Ga0307411_10120743 Ga0307411_101207433 169
174 3300032126 Ga0307415_100055006 Ga0307415_1000550063 169
175 3300035086 Ga0373934_0149252 Ga0373934_0149252_98_625 169
176 3300035724 Ga0373933_0086899 Ga0373933_0086899_1201_1731 169
177 3300036401 Ga0373937_0084695 Ga0373937_0084695_756_1286 169
178 3300037466 Ga0395898_1280741 Ga0395898_1280741_31_618 169
179 3300039437 Ga0436365_0921625 Ga0436365_0921625_4103_4639 169
180 3300039453 Ga0436362_0741099 Ga0436362_0741099_166_702 169
181 3300041463 Ga0451804_1159627 Ga0451804_1159627_62_598 169
182 3300046459 Ga0495629_0013187 Ga0495629_0013187_2892_3419 169
183 3300046491 Ga0495584_0001834 Ga0495584_0001834_3791_4318 169
184 3300046492 Ga0495585_0000184 Ga0495585_0000184_4440_4967 169
185 3300046492 Ga0495585_0080102 Ga0495585_0080102_14_541 169
186 3300046500 Ga0495596_0001167 Ga0495596_0001167_13622_14149 169
187 3300046506 Ga0495583_0000903 Ga0495583_0000903_33972_34499 169
188 3300046525 Ga0495663_0019041 Ga0495663_0019041_1404_1931 169
189 3300046528 Ga0495642_0014970 Ga0495642_0014970_1956_2483 169
190 3300046558 Ga0495633_0001584 Ga0495633_0001584_13072_13599 169
191 3300046616 Ga0495668_0001881 Ga0495668_0001881_15679_16206 169
192 3300046616 Ga0495668_0231813 Ga0495668_0231813_388_915 169
193 3300046665 Ga0495661_0275494 Ga0495661_0275494_151_678 169
194 3300046678 Ga0495599_0155747 Ga0495599_0155747_571_1098 169
195 3300047318 Ga0495636_0012418 Ga0495636_0012418_1740_2276 169
196 3300047323 Ga0495683_0000182 Ga0495683_0000182_30118_30645 169
197 3300047447 Ga0495685_036472 Ga0495685_036472_283_810 169
198 3300048091 Ga0495626_0297641 Ga0495626_0297641_48_575 169
199 3300048905 Ga0496102_0008653 Ga0496102_0008653_1255_1824 169
200 3300048917 Ga0496114_0021498 Ga0496114_0021498_1906_2433 169
201 3300048917 Ga0496114_0184526 Ga0496114_0184526_268_837 169
202 3300048928 Ga0496125_0002721 Ga0496125_0002721_9898_10425 169
203 3300048928 Ga0496125_0164873 Ga0496125_0164873_651_1178 169
204 3300048929 Ga0496126_0080226 Ga0496126_0080226_2303_2830 169
205 3300049574 Ga0501038_0256158 Ga0501038_0256158_152_682 169
206 3300049580 Ga0501046_0000010 Ga0501046_0000010_173076_173615 169
207 3300049581 Ga0501047_0268001 Ga0501047_0268001_45_584 169
208 3300049587 Ga0501071_0483271 Ga0501071_0483271_50_583 169
209 3300049588 Ga0501072_0091615 Ga0501072_0091615_644_1174 169
210 3300049590 Ga0501074_0895388 Ga0501074_0895388_29_577 169
211 3300049592 Ga0501076_0119648 Ga0501076_0119648_931_1461 169
212 3300049592 Ga0501076_0126124 Ga0501076_0126124_311_844 169
213 3300049593 Ga0501077_0129119 Ga0501077_0129119_661_1191 169
214 3300049741 Ga0501079_0149424 Ga0501079_0149424_1170_1703 169
215 3300049824 Ga0501045_0070232 Ga0501045_0070232_484_1017 169
216 3300049824 Ga0501045_0545140 Ga0501045_0545140_35_565 169
217 3300050489 nmdc:mga03683_169405_c1 nmdc:mga03683_169405_c1_72_608 169
218 3300050489 nmdc:mga03683_264579_c1 nmdc:mga03683_264579_c1_157_693 169
219 3300050489 nmdc:mga03683_31154_c1 nmdc:mga03683_31154_c1_386_922 169
220 3300050489 nmdc:mga03683_6420_c1 nmdc:mga03683_6420_c1_529_1077 169
221 3300050489 nmdc:mga03683_91595_c1 nmdc:mga03683_91595_c1_27_563 169
222 3300050492 nmdc:mga0yw44_12735_c1 nmdc:mga0yw44_12735_c1_2906_3442 169
223 3300050516 nmdc:mga0sz30_65732_c1 nmdc:mga0sz30_65732_c1_465_1001 169
224 3300053077 Ga0495601_0041676 Ga0495601_0041676_2281_2808 169
225 3300053085 Ga0495619_0082087 Ga0495619_0082087_117_647 169
226 3300053733 Ga0500552_017957 Ga0500552_017957_124_660 169
227 3300060353 Ga0501082_0326745 Ga0501082_0326745_397_930 169
228 3300061734 Ga0530510_0080995 Ga0530510_0080995_1589_2122 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

54

202

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.7966 21 168
2qpv-assembly1.cif.gz_A crystal structure of uncharacterized protein atu1531 0.7909 17 169
2qpv-assembly1.cif.gz_A crystal structure of uncharacterized protein atu1531 0.7857 17 169
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7824 18 169
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7775 18 169
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7966 21 168 3.30.530.20
af_I6XI16_7_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7926 25 169 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7905 18 167 3.30.530.20
af_O53961_7_149_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7887 23 169 3.30.530.20
af_I6XI16_7_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7823 25 169 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4Q4XAQ7-F1-model_v4 PhnB-like domain-containing protein 0.9872 2 169 GO:0016020
AF-A0A2W4T9M8-F1-model_v4 Polyketide cyclase 0.9852 2 169
AF-A0A7Y1US70-F1-model_v4 SRPBCC family protein 0.9849 23 115
AF-A0A1H2EWI8-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9838 5 169
AF-A0A7Y3B323-F1-model_v4 SRPBCC family protein 0.9816 23 129

Feature Viewer

pLDDT pTM Quality
93.42 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map