F340701

General Info

Members Datasets Scaffolds Average Seq Length
228 144 456 265

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100004123|Ga0070713_10000412311
Length 289
Sequence MLIRSPNTRVPIDYAAFQRTPEKPHPLVWIAGPCVIESEEHVRRMACAIREVLGNFVFKASFDKANRTSGDAYRGPGLQEGLRILASLRKEGFSILTDIHEPSQAEPAAEAADILQIPAFLCRQTDLLIAAGRTGRIVNIKKGQFVAPHDIHRAADKVASTGNSRVVLTERGSSFGYNNLVVDMRGLKIMRDAGWPVVFDATHSVQLPGGAGTASGGQPQFIEPLARAAVAAGVEGVFVEVHDHPEKALSDGPNALRLSLLAGFRERVEAVHRLICSFDALHAPGAPDV

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
82 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
144 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0.44
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0.44
Rhizosphere 90.79
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100004123 3300005436 Bacteria 9690
2 JGI24739J22299_10001901 3300001989 Bacteria 7986
3 Ga0070658_10015197 3300005327 Bacteria 6158
4 Ga0070658_10029665 3300005327 Bacteria 4395
5 Ga0070683_100062232 3300005329 Bacteria 3470
6 Ga0070683_100171693 3300005329 Bacteria 2058
7 Ga0070683_100608194 3300005329 Bacteria 1046
8 Ga0070690_100198985 3300005330 Bacteria 1393
9 Ga0070680_100000610 3300005336 Bacteria 24737
10 Ga0070660_100314876 3300005339 Bacteria 1285
11 Ga0070661_100183910 3300005344 Bacteria 1591
12 Ga0070671_100110118 3300005355 Bacteria 2313
13 Ga0070673_100579948 3300005364 Bacteria 1021
14 Ga0070709_10419273 3300005434 Bacteria 1003
15 Ga0070713_100554085 3300005436 Bacteria 1089
16 Ga0070711_100057951 3300005439 Bacteria 2684
17 Ga0070663_100078368 3300005455 Bacteria 2422
18 Ga0070681_10002423 3300005458 Bacteria 17060
19 Ga0070681_10224206 3300005458 Bacteria 1795
20 Ga0070679_100034254 3300005530 Bacteria 5032
21 Ga0070684_100007240 3300005535 Bacteria 8623
22 Ga0070684_100042106 3300005535 Bacteria 3941
23 Ga0070684_100289356 3300005535 Unclassified 1502
24 Ga0070684_100451529 3300005535 Bacteria 1188
25 Ga0068853_100034497 3300005539 Bacteria 4295
26 Ga0070695_100033859 3300005545 Bacteria 3198
27 Ga0068855_100016548 3300005563 Bacteria 8870
28 Ga0068855_100018733 3300005563 Bacteria 8324
29 Ga0068855_100046349 3300005563 Bacteria 5140
30 Ga0068855_100049189 3300005563 Bacteria 4973
31 Ga0068855_100149913 3300005563 Bacteria 2652
32 Ga0068855_100238596 3300005563 Bacteria 2032
33 Ga0070664_100230958 3300005564 Bacteria 1658
34 Ga0068857_100002639 3300005577 Bacteria 14725
35 Ga0068857_100032800 3300005577 Bacteria 4590
36 Ga0068857_100042494 3300005577 Bacteria 4033
37 Ga0068856_100011891 3300005614 Bacteria 8429
38 Ga0068856_100150004 3300005614 Unclassified 2340
39 Ga0068856_100302930 3300005614 Bacteria 1616
40 Ga0068859_100630965 3300005617 Bacteria 1164
41 Ga0068864_100008158 3300005618 Bacteria 8638
42 Ga0068864_100084000 3300005618 Bacteria 2797
43 Ga0068863_100145548 3300005841 Bacteria 2266
44 Ga0068858_100003703 3300005842 Bacteria 15141
45 Ga0068858_100262840 3300005842 Bacteria 1641
46 Ga0068858_100902823 3300005842 Bacteria 864
47 Ga0070717_10038060 3300006028 Bacteria 3909
48 Ga0070717_10236487 3300006028 Bacteria 1610
49 Ga0070717_10249376 3300006028 Bacteria 1568
50 Ga0097621_100035218 3300006237 Bacteria 3999
51 Ga0068871_100015738 3300006358 Bacteria 5673
52 Ga0075428_100173231 3300006844 Bacteria 2338
53 Ga0075428_100598579 3300006844 Bacteria 1178
54 Ga0075430_100025610 3300006846 Bacteria 5020
55 Ga0075431_100105317 3300006847 Bacteria 2911
56 Ga0075434_100493617 3300006871 Bacteria 1245
57 Ga0097620_100630939 3300006931 Bacteria 1164
58 Ga0105240_10003547 3300009093 Bacteria 24213
59 Ga0105240_10009838 3300009093 Bacteria 13495
60 Ga0105240_10240419 3300009093 Bacteria 2099
61 Ga0105240_10563231 3300009093 Bacteria 1259
62 Ga0105245_10012081 3300009098 Bacteria 7509
63 Ga0105245_10257766 3300009098 Bacteria 1696
64 Ga0114129_10022817 3300009147 Bacteria 8872
65 Ga0105242_10105600 3300009176 Bacteria 2392
66 Ga0105248_10018209 3300009177 Bacteria 7758
67 Ga0105248_10048032 3300009177 Bacteria 4787
68 Ga0105237_10068803 3300009545 Bacteria 3535
69 Ga0105237_10341509 3300009545 Bacteria 1502
70 Ga0105238_10021910 3300009551 Bacteria 6510
71 Ga0105238_10096985 3300009551 Bacteria 2934
72 Ga0105249_10011656 3300009553 Bacteria 7731
73 Ga0105249_10196359 3300009553 Bacteria 1972
74 Ga0105239_10012976 3300010375 Bacteria 9269
75 Ga0105239_10051472 3300010375 Bacteria 4515
76 Ga0105246_10001657 3300011119 Bacteria 13285
77 Ga0157371_10014853 3300013102 Bacteria 5863
78 Ga0157371_10030843 3300013102 Bacteria 3864
79 Ga0157370_10002854 3300013104 Bacteria 20634
80 Ga0157370_10631818 3300013104 Bacteria 979
81 Ga0157369_10004642 3300013105 Bacteria 16142
82 Ga0157369_10016354 3300013105 Bacteria 8348
83 Ga0157369_10078840 3300013105 Bacteria 3528
84 Ga0157378_10191748 3300013297 Bacteria 1928
85 Ga0163162_10348083 3300013306 Bacteria 1614
86 Ga0163162_10419263 3300013306 Bacteria 1471
87 Ga0157372_10042511 3300013307 Bacteria 5027
88 Ga0157375_10042698 3300013308 Bacteria 4391
89 Ga0157375_10182846 3300013308 Bacteria 2249
90 Ga0163163_10008711 3300014325 Bacteria 9025
91 Ga0163163_10351940 3300014325 Unclassified 1529
92 Ga0157379_10062026 3300014968 Bacteria 3343
93 Ga0157376_10064470 3300014969 Bacteria 3090
94 Ga0157376_10184476 3300014969 Bacteria 1909
95 Ga0183365_10001 3300015684 Bacteria 2090444
96 Ga0213872_10000121 3300021361 Bacteria 73359
97 Ga0213876_10046531 3300021384 Bacteria 2294
98 Ga0213875_10002468 3300021388 Bacteria 11041
99 Ga0213875_10033888 3300021388 Bacteria 2413
100 Ga0213875_10135738 3300021388 Bacteria 1151
101 Ga0207705_10007401 3300025909 Bacteria 8075
102 Ga0207695_10011051 3300025913 Bacteria 10970
103 Ga0207695_10015150 3300025913 Bacteria 9091
104 Ga0207695_10067042 3300025913 Bacteria 3683
105 Ga0207671_10059187 3300025914 Bacteria 2840
106 Ga0207671_10279933 3300025914 Bacteria 1315
107 Ga0207663_10036372 3300025916 Bacteria 2962
108 Ga0207660_10003804 3300025917 Bacteria 9826
109 Ga0207660_10026044 3300025917 Bacteria 3978
110 Ga0207657_10024661 3300025919 Bacteria 5562
111 Ga0207649_10334260 3300025920 Bacteria 1117
112 Ga0207652_10000228 3300025921 Bacteria 58720
113 Ga0207652_10161813 3300025921 Bacteria 2007
114 Ga0207694_10009048 3300025924 Bacteria 7517
115 Ga0207694_10080659 3300025924 Bacteria 2554
116 Ga0207687_10005880 3300025927 Bacteria 8112
117 Ga0207687_10049494 3300025927 Bacteria 2922
118 Ga0207687_10258624 3300025927 Bacteria 1387
119 Ga0207700_10021107 3300025928 Bacteria 4439
120 Ga0207644_10292530 3300025931 Bacteria 1310
121 Ga0207686_10009147 3300025934 Bacteria 5371
122 Ga0207711_10043968 3300025941 Bacteria 3811
123 Ga0207661_10192138 3300025944 Bacteria 1790
124 Ga0207661_10361395 3300025944 Bacteria 1311
125 Ga0207667_10000312 3300025949 Bacteria 67340
126 Ga0207667_10015460 3300025949 Bacteria 8668
127 Ga0207667_10021280 3300025949 Bacteria 7188
128 Ga0207667_10340549 3300025949 Bacteria 1530
129 Ga0207703_10010083 3300026035 Bacteria 7405
130 Ga0207703_10207753 3300026035 Bacteria 1744
131 Ga0207639_10031038 3300026041 Bacteria 3925
132 Ga0207678_10045114 3300026067 Bacteria 3812
133 Ga0207702_10011313 3300026078 Bacteria 7440
134 Ga0207702_10142441 3300026078 Unclassified 2171
135 Ga0207641_10003180 3300026088 Bacteria 14698
136 Ga0207676_10004919 3300026095 Bacteria 9475
137 Ga0207676_10008550 3300026095 Bacteria 7277
138 Ga0207676_10197547 3300026095 Bacteria 1775
139 Ga0265323_10000292 3300028653 Bacteria 28941
140 Ga0265762_1030218 3300030760 Bacteria 1027
141 Ga0265328_10052084 3300031239 Bacteria 1503
142 Ga0265331_10121322 3300031250 Bacteria 1195
143 Ga0265316_10004242 3300031344 Bacteria 14324
144 Ga0265316_10065539 3300031344 Bacteria 2813
145 Ga0265316_10162638 3300031344 Bacteria 1668
146 Ga0265314_10064492 3300031711 Bacteria 2480
147 Ga0373927_0023618 3300035695 Bacteria 4025
148 Ga0373933_0418867 3300035724 Bacteria 875
149 Ga0373925_0131568 3300037068 Bacteria 1951
150 Ga0395900_0360756 3300037418 Bacteria 1425
151 Ga0395898_0043051 3300037466 Bacteria 4450
152 Ga0436364_0116239 3300037853 Bacteria 8798
153 Ga0436364_0385907 3300037853 Bacteria 1530
154 Ga0436364_0421806 3300037853 Bacteria 4707
155 Ga0436364_0761205 3300037853 Bacteria 33133
156 Ga0436364_1269583 3300037853 Bacteria 7095
157 Ga0436364_1323635 3300037853 Bacteria 1806
158 Ga0436364_1415525 3300037853 Bacteria 425173
159 Ga0436364_1466575 3300037853 Bacteria 5069
160 Ga0436365_0789875 3300039437 Bacteria 1671
161 Ga0436365_0802548 3300039437 Bacteria 4578
162 Ga0436365_1596572 3300039437 Bacteria 5145
163 Ga0436360_0466734 3300039438 Bacteria 2798
164 Ga0436361_0610116 3300039447 Bacteria 176709
165 Ga0436363_1377227 3300039450 Bacteria 1911
166 Ga0436362_0027809 3300039453 Bacteria 1617
167 Ga0466961_0013597 3300044693 Bacteria 5213
168 Ga0466964_0016250 3300044706 Bacteria 2839
169 Ga0466959_0062214 3300045049 Bacteria 2713
170 Ga0451576_0015310 3300045051 Bacteria 8500
171 Ga0466967_0005539 3300045976 Bacteria 8765
172 Ga0495592_0069185 3300046454 Bacteria 2574
173 Ga0495651_0007479 3300046462 Bacteria 8354
174 Ga0495580_0011559 3300046472 Bacteria 6828
175 Ga0495662_0001672 3300046476 Bacteria 11053
176 Ga0495664_0021200 3300046477 Bacteria 3753
177 Ga0495664_0306967 3300046477 Bacteria 958
178 Ga0495608_0357308 3300046511 Bacteria 898
179 Ga0495628_0007388 3300046516 Bacteria 9514
180 Ga0495628_0139591 3300046516 Bacteria 1850
181 Ga0495630_0126046 3300046517 Bacteria 1943
182 Ga0495652_0019702 3300046529 Bacteria 6004
183 Ga0495665_0065916 3300046531 Bacteria 1912
184 Ga0495640_0154404 3300046533 Bacteria 1474
185 Ga0495586_0267490 3300046535 Bacteria 977
186 Ga0495587_0003294 3300046536 Bacteria 10784
187 Ga0495645_0002580 3300046543 Bacteria 12320
188 Ga0495645_0172112 3300046543 Bacteria 1490
189 Ga0495645_0290283 3300046543 Bacteria 1072
190 Ga0495667_0308785 3300046559 Bacteria 1002
191 Ga0495634_0022034 3300046642 Bacteria 4493
192 Ga0495635_0020964 3300046663 Bacteria 4555
193 Ga0495635_0126962 3300046663 Bacteria 1739
194 Ga0495657_0294713 3300046675 Bacteria 968
195 Ga0495599_0025638 3300046678 Bacteria 3691
196 Ga0495623_0011650 3300046679 Bacteria 5697
197 Ga0495623_0028199 3300046679 Bacteria 3613
198 Ga0495623_0053281 3300046679 Bacteria 2555
199 Ga0495623_0177678 3300046679 Bacteria 1239
200 Ga0495646_0057272 3300046680 Bacteria 2333
201 Ga0495613_0036023 3300046689 Bacteria 3669
202 Ga0495600_0141915 3300046809 Bacteria 1558
203 Ga0495604_0033239 3300047317 Bacteria 4084
204 Ga0495604_0169473 3300047317 Bacteria 1537
205 Ga0495604_0214349 3300047317 Bacteria 1329
206 Ga0495674_0010524 3300047319 Bacteria 8755
207 Ga0495674_0014969 3300047319 Bacteria 7260
208 Ga0495674_0133463 3300047319 Bacteria 2090
209 Ga0495674_0598460 3300047319 Bacteria 874
210 Ga0495680_0087035 3300047322 Bacteria 2351
211 Ga0495675_0043153 3300047444 Bacteria 2874
212 Ga0495684_0043565 3300047471 Bacteria 3436
213 Ga0495602_0062262 3300048088 Bacteria 3238
214 Ga0495602_0128087 3300048088 Bacteria 2030
215 Ga0496115_0058304 3300048918 Bacteria 3107
216 Ga0496121_0000951 3300048924 Bacteria 52397
217 Ga0501047_0028267 3300049581 Bacteria 5406
218 Ga0501047_0374222 3300049581 Bacteria 1259
219 Ga0501035_0365276 3300049822 Bacteria 1206
220 nmdc:mga09592_658046_c1 3300050508 Unclassified 894
221 nmdc:mga0qj67_30267_c1 3300050509 Bacteria 4212
222 nmdc:mga0n895_674216_c1 3300050512 Bacteria 1031
223 nmdc:mga08x19_573610_c1 3300050514 Bacteria 799
224 Ga0495619_0245099 3300053085 Bacteria 1242
225 Ga0500618_001816 3300053125 Bacteria 8948
226 Ga0501082_0000257 3300060353 Bacteria 46591
227 2909401274 2909399089 Bacteria 3922598
228 3000020665 3000017691 Bacteria 3772574
229 Ga0070713_100004123
230 JGI24739J22299_10001901
231 Ga0070658_10015197
232 Ga0070658_10029665
233 Ga0070683_100062232
234 Ga0070683_100171693
235 Ga0070683_100608194
236 Ga0070690_100198985
237 Ga0070680_100000610
238 Ga0070660_100314876
239 Ga0070661_100183910
240 Ga0070671_100110118
241 Ga0070673_100579948
242 Ga0070709_10419273
243 Ga0070713_100554085
244 Ga0070711_100057951
245 Ga0070663_100078368
246 Ga0070681_10002423
247 Ga0070681_10224206
248 Ga0070679_100034254
249 Ga0070684_100007240
250 Ga0070684_100042106
251 Ga0070684_100289356
252 Ga0070684_100451529
253 Ga0068853_100034497
254 Ga0070695_100033859
255 Ga0068855_100016548
256 Ga0068855_100018733
257 Ga0068855_100046349
258 Ga0068855_100049189
259 Ga0068855_100149913
260 Ga0068855_100238596
261 Ga0070664_100230958
262 Ga0068857_100002639
263 Ga0068857_100032800
264 Ga0068857_100042494
265 Ga0068856_100011891
266 Ga0068856_100150004
267 Ga0068856_100302930
268 Ga0068859_100630965
269 Ga0068864_100008158
270 Ga0068864_100084000
271 Ga0068863_100145548
272 Ga0068858_100003703
273 Ga0068858_100262840
274 Ga0068858_100902823
275 Ga0070717_10038060
276 Ga0070717_10236487
277 Ga0070717_10249376
278 Ga0097621_100035218
279 Ga0068871_100015738
280 Ga0075428_100173231
281 Ga0075428_100598579
282 Ga0075430_100025610
283 Ga0075431_100105317
284 Ga0075434_100493617
285 Ga0097620_100630939
286 Ga0105240_10003547
287 Ga0105240_10009838
288 Ga0105240_10240419
289 Ga0105240_10563231
290 Ga0105245_10012081
291 Ga0105245_10257766
292 Ga0114129_10022817
293 Ga0105242_10105600
294 Ga0105248_10018209
295 Ga0105248_10048032
296 Ga0105237_10068803
297 Ga0105237_10341509
298 Ga0105238_10021910
299 Ga0105238_10096985
300 Ga0105249_10011656
301 Ga0105249_10196359
302 Ga0105239_10012976
303 Ga0105239_10051472
304 Ga0105246_10001657
305 Ga0157371_10014853
306 Ga0157371_10030843
307 Ga0157370_10002854
308 Ga0157370_10631818
309 Ga0157369_10004642
310 Ga0157369_10016354
311 Ga0157369_10078840
312 Ga0157378_10191748
313 Ga0163162_10348083
314 Ga0163162_10419263
315 Ga0157372_10042511
316 Ga0157375_10042698
317 Ga0157375_10182846
318 Ga0163163_10008711
319 Ga0163163_10351940
320 Ga0157379_10062026
321 Ga0157376_10064470
322 Ga0157376_10184476
323 Ga0183365_10001
324 Ga0213872_10000121
325 Ga0213876_10046531
326 Ga0213875_10002468
327 Ga0213875_10033888
328 Ga0213875_10135738
329 Ga0207705_10007401
330 Ga0207695_10011051
331 Ga0207695_10015150
332 Ga0207695_10067042
333 Ga0207671_10059187
334 Ga0207671_10279933
335 Ga0207663_10036372
336 Ga0207660_10003804
337 Ga0207660_10026044
338 Ga0207657_10024661
339 Ga0207649_10334260
340 Ga0207652_10000228
341 Ga0207652_10161813
342 Ga0207694_10009048
343 Ga0207694_10080659
344 Ga0207687_10005880
345 Ga0207687_10049494
346 Ga0207687_10258624
347 Ga0207700_10021107
348 Ga0207644_10292530
349 Ga0207686_10009147
350 Ga0207711_10043968
351 Ga0207661_10192138
352 Ga0207661_10361395
353 Ga0207667_10000312
354 Ga0207667_10015460
355 Ga0207667_10021280
356 Ga0207667_10340549
357 Ga0207703_10010083
358 Ga0207703_10207753
359 Ga0207639_10031038
360 Ga0207678_10045114
361 Ga0207702_10011313
362 Ga0207702_10142441
363 Ga0207641_10003180
364 Ga0207676_10004919
365 Ga0207676_10008550
366 Ga0207676_10197547
367 Ga0265323_10000292
368 Ga0265762_1030218
369 Ga0265328_10052084
370 Ga0265331_10121322
371 Ga0265316_10004242
372 Ga0265316_10065539
373 Ga0265316_10162638
374 Ga0265314_10064492
375 Ga0373927_0023618
376 Ga0373933_0418867
377 Ga0373925_0131568
378 Ga0395900_0360756
379 Ga0395898_0043051
380 Ga0436364_0116239
381 Ga0436364_0385907
382 Ga0436364_0421806
383 Ga0436364_0761205
384 Ga0436364_1269583
385 Ga0436364_1323635
386 Ga0436364_1415525
387 Ga0436364_1466575
388 Ga0436365_0789875
389 Ga0436365_0802548
390 Ga0436365_1596572
391 Ga0436360_0466734
392 Ga0436361_0610116
393 Ga0436363_1377227
394 Ga0436362_0027809
395 Ga0466961_0013597
396 Ga0466964_0016250
397 Ga0466959_0062214
398 Ga0451576_0015310
399 Ga0466967_0005539
400 Ga0495592_0069185
401 Ga0495651_0007479
402 Ga0495580_0011559
403 Ga0495662_0001672
404 Ga0495664_0021200
405 Ga0495664_0306967
406 Ga0495608_0357308
407 Ga0495628_0007388
408 Ga0495628_0139591
409 Ga0495630_0126046
410 Ga0495652_0019702
411 Ga0495665_0065916
412 Ga0495640_0154404
413 Ga0495586_0267490
414 Ga0495587_0003294
415 Ga0495645_0002580
416 Ga0495645_0172112
417 Ga0495645_0290283
418 Ga0495667_0308785
419 Ga0495634_0022034
420 Ga0495635_0020964
421 Ga0495635_0126962
422 Ga0495657_0294713
423 Ga0495599_0025638
424 Ga0495623_0011650
425 Ga0495623_0028199
426 Ga0495623_0053281
427 Ga0495623_0177678
428 Ga0495646_0057272
429 Ga0495613_0036023
430 Ga0495600_0141915
431 Ga0495604_0033239
432 Ga0495604_0169473
433 Ga0495604_0214349
434 Ga0495674_0010524
435 Ga0495674_0014969
436 Ga0495674_0133463
437 Ga0495674_0598460
438 Ga0495680_0087035
439 Ga0495675_0043153
440 Ga0495684_0043565
441 Ga0495602_0062262
442 Ga0495602_0128087
443 Ga0496115_0058304
444 Ga0496121_0000951
445 Ga0501047_0028267
446 Ga0501047_0374222
447 Ga0501035_0365276
448 nmdc:mga09592_658046_c1
449 nmdc:mga0qj67_30267_c1
450 nmdc:mga0n895_674216_c1
451 nmdc:mga08x19_573610_c1
452 Ga0495619_0245099
453 Ga0500618_001816
454 Ga0501082_0000257
455 2909401274
456 3000020665

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00793

DAHP_synth_1

DAHP synthetase I family

20

276

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fs2-assembly1.cif.gz_A crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from bruciella melitensis at 1.85a resolution 0.9735 17 272
6bng-assembly1.cif.gz_A-2 structure of 2-dehydro-3-deoxyphosphooctonate aldolase from acinetobacter baumannii 0.9705 17 270
4lu0-assembly1.cif.gz_C crystal structure of 2-keto-3-deoxy-d-manno-octulosonate-8-phosphate synthase from pseudomonas aeruginosa. 0.9691 15 270
1fx6-assembly1.cif.gz_A-2 aquifex aeolicus kdo8p synthase 0.969 17 273
1fx6-assembly1.cif.gz_B-2 aquifex aeolicus kdo8p synthase 0.9674 16 272
ID Description Score Start End Superfamily
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.953 17 273 3.20.20.70
1o60D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9393 15 270 3.20.20.70
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9284 17 273 3.20.20.70
4z1aA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9171 16 269 3.20.20.70
3pg8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9063 13 270 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7Y2UIF2-F1-model_v4 deleted 0.9903 16 161
AF-A0A7C1C0K3-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9898 16 189 GO:0005737
GO:0008676
GO:0009103
AF-A0A519WMH6-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9888 16 142 GO:0005737
GO:0008676
GO:0009103
AF-A0A800F255-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.987 91 198 GO:0005737
GO:0008676
GO:0009103
AF-A0A352AZY6-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9835 11 142 GO:0005737
GO:0008676
GO:0009103

Map