F340127

General Info

Members Datasets Scaffolds Average Seq Length
227 154 454 325

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0014276|Ga0373944_0014276_729_1784
Length 330
Sequence MTGRLLVALAFLSVASLVAPGIGRAQTFKVEKFDIKGDGGTDYVAAEAATGRVFVSRGTHMMVVEGRTGKVLGDIQNTPGVHGAGIATKAGHGFTTNGGDMTVTMFDLKTLAEIKRITVGPGLDGIMYDEPDDKIILTNHSNPGTLTALDPKTGDIVATVELEDNAPEGAAADGKGHIYVNNERKNTMQVIDVKTWKATASWPLAPCEGPTGIAYDKSSNRIFSGCNGTSVVVDPASGKVVATIKNGTRVDALGWDPSKKLIYIPNGAEGTVTVAHQDSADAYSVVATVPTFAGAKTITVDTKTHNVYLFQPERGPLGPIVASWFIVITQ

Samples

Sample ID Description Type Environment
1 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0
Rhizoplane 1.32
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 20.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373944_0014276 3300035089 Unclassified 2215
2 Ga0065712_10073838 3300005290 Bacteria 4265
3 Ga0065715_10139328 3300005293 Bacteria 1878
4 Ga0065707_10106619 3300005295 Bacteria 2588
5 Ga0070676_10006142 3300005328 Bacteria 6415
6 Ga0070683_100235023 3300005329 Bacteria 1743
7 Ga0070690_100016069 3300005330 Bacteria 4476
8 Ga0070670_100012533 3300005331 Bacteria 7257
9 Ga0068869_100207322 3300005334 Unclassified 1548
10 Ga0068869_100320846 3300005334 Bacteria 1256
11 Ga0070669_100013726 3300005353 Bacteria 5759
12 Ga0070669_100096939 3300005353 Bacteria 2219
13 Ga0070675_100001450 3300005354 Bacteria 17452
14 Ga0070675_100010123 3300005354 Bacteria 7354
15 Ga0070671_100004421 3300005355 Bacteria 11117
16 Ga0070673_100021121 3300005364 Bacteria 4711
17 Ga0070673_100048373 3300005364 Unclassified 3315
18 Ga0070673_100126743 3300005364 Unclassified 2137
19 Ga0070673_100321711 3300005364 Bacteria 1366
20 Ga0070673_100409659 3300005364 Bacteria 1214
21 Ga0070667_100005062 3300005367 Bacteria 11033
22 Ga0070667_100239269 3300005367 Unclassified 1620
23 Ga0070701_10061014 3300005438 Bacteria 1987
24 Ga0070705_100219007 3300005440 Bacteria 1317
25 Ga0070708_100026241 3300005445 Bacteria 4986
26 Ga0070708_100438637 3300005445 Unclassified 1232
27 Ga0070678_100066593 3300005456 Bacteria 2678
28 Ga0070662_100070474 3300005457 Bacteria 2576
29 Ga0070707_100003331 3300005468 Bacteria 15174
30 Ga0070699_100133295 3300005518 Bacteria 2191
31 Ga0070697_100044424 3300005536 Unclassified 3599
32 Ga0070672_100037667 3300005543 Bacteria 3691
33 Ga0070686_100016365 3300005544 Unclassified 4314
34 Ga0070695_100029612 3300005545 Unclassified 3402
35 Ga0070696_100084920 3300005546 Bacteria 2247
36 Ga0070664_100002046 3300005564 Bacteria 16157
37 Ga0068854_100141165 3300005578 Bacteria 1849
38 Ga0068859_100050250 3300005617 Unclassified 4189
39 Ga0068859_100170435 3300005617 Unclassified 2258
40 Ga0068859_100387853 3300005617 Unclassified 1492
41 Ga0068864_100011160 3300005618 Bacteria 7426
42 Ga0068864_100129376 3300005618 Bacteria 2266
43 Ga0068870_10050829 3300005840 Bacteria 2191
44 Ga0068863_100002057 3300005841 Bacteria 19929
45 Ga0068863_100040759 3300005841 Bacteria 4415
46 Ga0068863_100107748 3300005841 Bacteria 2652
47 Ga0068858_100004084 3300005842 Bacteria 14382
48 Ga0068858_100012473 3300005842 Bacteria 8014
49 Ga0068858_100056108 3300005842 Bacteria 3642
50 Ga0068858_100189768 3300005842 Bacteria 1942
51 Ga0068860_100371411 3300005843 Bacteria 1410
52 Ga0068862_100168496 3300005844 Bacteria 1959
53 Ga0068862_100390736 3300005844 Bacteria 1299
54 Ga0070717_10194611 3300006028 Unclassified 1773
55 Ga0070717_10375177 3300006028 Unclassified 1275
56 Ga0075368_10016565 3300006042 Bacteria 2748
57 Ga0075364_10080008 3300006051 Bacteria 2160
58 Ga0075432_10022353 3300006058 Bacteria 2163
59 Ga0070716_100067607 3300006173 Unclassified 2088
60 Ga0075367_10021597 3300006178 Bacteria 3599
61 Ga0075366_10006937 3300006195 Bacteria 6234
62 Ga0097621_100006476 3300006237 Bacteria 8316
63 Ga0097621_100028102 3300006237 Bacteria 4431
64 Ga0097621_100149768 3300006237 Unclassified 2000
65 Ga0075370_10017321 3300006353 Bacteria 3892
66 Ga0068871_100013454 3300006358 Bacteria 6074
67 Ga0068871_100037057 3300006358 Bacteria 3887
68 Ga0068871_100040615 3300006358 Bacteria 3727
69 Ga0068871_100064344 3300006358 Unclassified 3003
70 Ga0068871_100426566 3300006358 Unclassified 1185
71 Ga0075428_100032035 3300006844 Bacteria 5807
72 Ga0075434_100001198 3300006871 Bacteria 21539
73 Ga0075434_100142378 3300006871 Bacteria 2418
74 Ga0075429_100043279 3300006880 Bacteria 3918
75 Ga0068865_100097257 3300006881 Bacteria 2148
76 Ga0075436_100009230 3300006914 Bacteria 6749
77 Ga0075436_100240165 3300006914 Unclassified 1288
78 Ga0097620_100050248 3300006931 Unclassified 4189
79 Ga0097620_100170439 3300006931 Unclassified 2258
80 Ga0097620_100387883 3300006931 Unclassified 1492
81 Ga0075435_100000009 3300007076 Bacteria 114381
82 Ga0075435_100119177 3300007076 Unclassified 2201
83 Ga0111539_10064870 3300009094 Bacteria 4318
84 Ga0111539_10125869 3300009094 Unclassified 3002
85 Ga0105245_10024973 3300009098 Bacteria 5252
86 Ga0105245_10036800 3300009098 Unclassified 4349
87 Ga0105245_10047034 3300009098 Bacteria 3857
88 Ga0105245_10287090 3300009098 Bacteria 1610
89 Ga0114129_10010085 3300009147 Bacteria 13469
90 Ga0105243_10420375 3300009148 Bacteria 1247
91 Ga0105242_10018957 3300009176 Bacteria 5389
92 Ga0105242_10021973 3300009176 Bacteria 5015
93 Ga0105248_10083575 3300009177 Bacteria 3591
94 Ga0105238_10168088 3300009551 Bacteria 2169
95 Ga0157371_10188621 3300013102 Unclassified 1476
96 Ga0157374_10233345 3300013296 Bacteria 1808
97 Ga0157378_10006402 3300013297 Bacteria 10295
98 Ga0163162_10052008 3300013306 Bacteria 4112
99 Ga0163162_10248124 3300013306 Unclassified 1912
100 Ga0157375_10129227 3300013308 Bacteria 2644
101 Ga0163163_10012109 3300014325 Bacteria 7849
102 Ga0157380_10107091 3300014326 Bacteria 2340
103 Ga0157377_10036254 3300014745 Bacteria 2712
104 Ga0157376_10053651 3300014969 Bacteria 3357
105 Ga0157376_10172672 3300014969 Bacteria 1970
106 Ga0207688_10006161 3300025901 Bacteria 6528
107 Ga0207643_10003194 3300025908 Bacteria 8825
108 Ga0207707_10033787 3300025912 Bacteria 4476
109 Ga0207649_10020894 3300025920 Unclassified 3760
110 Ga0207649_10303694 3300025920 Bacteria 1168
111 Ga0207646_10004926 3300025922 Bacteria 14283
112 Ga0207681_10021182 3300025923 Bacteria 4129
113 Ga0207681_10164782 3300025923 Bacteria 1674
114 Ga0207650_10011539 3300025925 Bacteria 6085
115 Ga0207650_10089725 3300025925 Unclassified 2347
116 Ga0207650_10144077 3300025925 Bacteria 1875
117 Ga0207659_10000080 3300025926 Bacteria 60332
118 Ga0207659_10044330 3300025926 Unclassified 3129
119 Ga0207687_10021088 3300025927 Bacteria 4325
120 Ga0207644_10047738 3300025931 Bacteria 3057
121 Ga0207706_10180065 3300025933 Bacteria 1856
122 Ga0207686_10010669 3300025934 Bacteria 5004
123 Ga0207669_10211086 3300025937 Bacteria 1417
124 Ga0207704_10008189 3300025938 Bacteria 4981
125 Ga0207704_10022701 3300025938 Unclassified 3367
126 Ga0207665_10031883 3300025939 Bacteria 3488
127 Ga0207691_10082540 3300025940 Bacteria 2887
128 Ga0207711_10002617 3300025941 Bacteria 15958
129 Ga0207711_10087570 3300025941 Unclassified 2732
130 Ga0207689_10010748 3300025942 Bacteria 7878
131 Ga0207679_10002633 3300025945 Bacteria 11075
132 Ga0207679_10008013 3300025945 Bacteria 6716
133 Ga0207651_10002709 3300025960 Bacteria 8494
134 Ga0207651_10064144 3300025960 Bacteria 2569
135 Ga0207651_10075577 3300025960 Bacteria 2404
136 Ga0207658_10014220 3300025986 Bacteria 5450
137 Ga0207658_10068030 3300025986 Bacteria 2685
138 Ga0207677_10009807 3300026023 Bacteria 5396
139 Ga0207677_10036802 3300026023 Bacteria 3193
140 Ga0207677_10228380 3300026023 Bacteria 1497
141 Ga0207677_10333786 3300026023 Bacteria 1264
142 Ga0207703_10028852 3300026035 Bacteria 4378
143 Ga0207703_10172885 3300026035 Bacteria 1901
144 Ga0207641_10001056 3300026088 Bacteria 27821
145 Ga0207641_10075643 3300026088 Bacteria 2908
146 Ga0207648_10016101 3300026089 Bacteria 6850
147 Ga0207676_10021259 3300026095 Bacteria 4761
148 Ga0207676_10100707 3300026095 Bacteria 2394
149 Ga0207676_10387783 3300026095 Bacteria 1302
150 Ga0207675_100043558 3300026118 Bacteria 4191
151 Ga0207683_10016863 3300026121 Bacteria 6214
152 Ga0207428_10127826 3300027907 Bacteria 1946
153 Ga0268266_10025157 3300028379 Bacteria 5067
154 Ga0268265_10053127 3300028380 Unclassified 3068
155 Ga0268265_10236464 3300028380 Bacteria 1609
156 Ga0268264_10221106 3300028381 Unclassified 1743
157 Ga0265314_10116783 3300031711 Unclassified 1686
158 Ga0373952_0025216 3300035092 Bacteria 1282
159 Ga0373954_0094021 3300035118 Bacteria 1442
160 Ga0373956_0037315 3300035119 Unclassified 2148
161 Ga0373943_0000503 3300035170 Bacteria 16759
162 Ga0373946_0001515 3300035171 Bacteria 8076
163 Ga0373955_0004754 3300035172 Bacteria 6042
164 Ga0373955_0023310 3300035172 Bacteria 3152
165 Ga0373931_0012227 3300035691 Bacteria 4156
166 Ga0373935_0007830 3300035692 Bacteria 6406
167 Ga0373933_0112460 3300035724 Unclassified 1700
168 Ga0373947_0052477 3300035725 Unclassified 2456
169 Ga0373937_0019575 3300036401 Bacteria 6058
170 Ga0373925_0002015 3300037068 Bacteria 16822
171 Ga0451853_1078057 3300041512 Bacteria 1085
172 Ga0451577_0001798 3300042876 Bacteria 27438
173 Ga0451577_0031485 3300042876 Bacteria 4785
174 Ga0453684_0144285 3300044712 Bacteria 2838
175 Ga0495651_0046612 3300046462 Bacteria 3354
176 Ga0495651_0106368 3300046462 Unclassified 2080
177 Ga0495639_0084565 3300046475 Bacteria 1482
178 Ga0495639_0098312 3300046475 Bacteria 1380
179 Ga0495628_0065198 3300046516 Bacteria 2850
180 Ga0495628_0077034 3300046516 Bacteria 2594
181 Ga0495630_0053327 3300046517 Bacteria 3028
182 Ga0495652_0021527 3300046529 Bacteria 5730
183 Ga0495652_0090406 3300046529 Unclassified 2505
184 Ga0495640_0140709 3300046533 Bacteria 1556
185 Ga0495586_0117737 3300046535 Bacteria 1482
186 Ga0495621_0018636 3300046539 Bacteria 2256
187 Ga0495645_0013472 3300046543 Bacteria 5782
188 Ga0495645_0019041 3300046543 Unclassified 4942
189 Ga0495667_0025759 3300046559 Bacteria 3962
190 Ga0495634_0034219 3300046642 Bacteria 3488
191 Ga0495635_0024673 3300046663 Bacteria 4191
192 Ga0495588_0088236 3300046674 Bacteria 1623
193 Ga0495646_0134932 3300046680 Bacteria 1386
194 Ga0495647_0086769 3300046681 Bacteria 1277
195 Ga0495658_0011589 3300046683 Bacteria 4440
196 Ga0495613_0007876 3300046689 Bacteria 7921
197 Ga0495613_0105162 3300046689 Bacteria 2038
198 Ga0495613_0285808 3300046689 Bacteria 1144
199 Ga0495581_0222716 3300047315 Bacteria 1103
200 Ga0495604_0147032 3300047317 Unclassified 1679
201 Ga0495674_0050015 3300047319 Unclassified 3689
202 Ga0495676_0026255 3300047321 Bacteria 5017
203 Ga0495680_0034213 3300047322 Unclassified 4107
204 Ga0495684_0010930 3300047471 Bacteria 7017
205 Ga0495684_0014526 3300047471 Bacteria 6062
206 Ga0495602_0046645 3300048088 Unclassified 3912
207 Ga0495602_0048211 3300048088 Unclassified 3832
208 Ga0495602_0177578 3300048088 Unclassified 1646
209 Ga0496104_0266961 3300048907 Bacteria 1624
210 Ga0496105_0342082 3300048908 Bacteria 1196
211 Ga0496112_0096413 3300048915 Bacteria 2928
212 nmdc:mga00v17_8433_c1 3300050491 Bacteria 5547
213 nmdc:mga0k408_27182_c1 3300050493 Bacteria 3248
214 nmdc:mga06z11_15132_c1 3300050494 Bacteria 3436
215 nmdc:mga04h51_9899_c1 3300050495 Bacteria 2602
216 nmdc:mga05p37_23257_c1 3300050507 Bacteria 7517
217 nmdc:mga08y16_163523_c1 3300050511 Bacteria 2312
218 nmdc:mga08y16_17979_c1 3300050511 Bacteria 7448
219 nmdc:mga0n895_233506_c1 3300050512 Bacteria 1867
220 nmdc:mga0n895_244159_c1 3300050512 Bacteria 1822
221 nmdc:mga0n895_76_c1 3300050512 Bacteria 56942
222 nmdc:mga0rr50_100722_c1 3300050513 Bacteria 2269
223 nmdc:mga0rr50_103856_c1 3300050513 Bacteria 2237
224 nmdc:mga0rr50_25_c1 3300050513 Bacteria 114931
225 nmdc:mga08x19_2573_c1 3300050514 Bacteria 11014
226 nmdc:mga0a205_49746_c1 3300050515 Bacteria 4047
227 Ga0495619_0168585 3300053085 Bacteria 1514
228 Ga0373944_0014276
229 Ga0065712_10073838
230 Ga0065715_10139328
231 Ga0065707_10106619
232 Ga0070676_10006142
233 Ga0070683_100235023
234 Ga0070690_100016069
235 Ga0070670_100012533
236 Ga0068869_100207322
237 Ga0068869_100320846
238 Ga0070669_100013726
239 Ga0070669_100096939
240 Ga0070675_100001450
241 Ga0070675_100010123
242 Ga0070671_100004421
243 Ga0070673_100021121
244 Ga0070673_100048373
245 Ga0070673_100126743
246 Ga0070673_100321711
247 Ga0070673_100409659
248 Ga0070667_100005062
249 Ga0070667_100239269
250 Ga0070701_10061014
251 Ga0070705_100219007
252 Ga0070708_100026241
253 Ga0070708_100438637
254 Ga0070678_100066593
255 Ga0070662_100070474
256 Ga0070707_100003331
257 Ga0070699_100133295
258 Ga0070697_100044424
259 Ga0070672_100037667
260 Ga0070686_100016365
261 Ga0070695_100029612
262 Ga0070696_100084920
263 Ga0070664_100002046
264 Ga0068854_100141165
265 Ga0068859_100050250
266 Ga0068859_100170435
267 Ga0068859_100387853
268 Ga0068864_100011160
269 Ga0068864_100129376
270 Ga0068870_10050829
271 Ga0068863_100002057
272 Ga0068863_100040759
273 Ga0068863_100107748
274 Ga0068858_100004084
275 Ga0068858_100012473
276 Ga0068858_100056108
277 Ga0068858_100189768
278 Ga0068860_100371411
279 Ga0068862_100168496
280 Ga0068862_100390736
281 Ga0070717_10194611
282 Ga0070717_10375177
283 Ga0075368_10016565
284 Ga0075364_10080008
285 Ga0075432_10022353
286 Ga0070716_100067607
287 Ga0075367_10021597
288 Ga0075366_10006937
289 Ga0097621_100006476
290 Ga0097621_100028102
291 Ga0097621_100149768
292 Ga0075370_10017321
293 Ga0068871_100013454
294 Ga0068871_100037057
295 Ga0068871_100040615
296 Ga0068871_100064344
297 Ga0068871_100426566
298 Ga0075428_100032035
299 Ga0075434_100001198
300 Ga0075434_100142378
301 Ga0075429_100043279
302 Ga0068865_100097257
303 Ga0075436_100009230
304 Ga0075436_100240165
305 Ga0097620_100050248
306 Ga0097620_100170439
307 Ga0097620_100387883
308 Ga0075435_100000009
309 Ga0075435_100119177
310 Ga0111539_10064870
311 Ga0111539_10125869
312 Ga0105245_10024973
313 Ga0105245_10036800
314 Ga0105245_10047034
315 Ga0105245_10287090
316 Ga0114129_10010085
317 Ga0105243_10420375
318 Ga0105242_10018957
319 Ga0105242_10021973
320 Ga0105248_10083575
321 Ga0105238_10168088
322 Ga0157371_10188621
323 Ga0157374_10233345
324 Ga0157378_10006402
325 Ga0163162_10052008
326 Ga0163162_10248124
327 Ga0157375_10129227
328 Ga0163163_10012109
329 Ga0157380_10107091
330 Ga0157377_10036254
331 Ga0157376_10053651
332 Ga0157376_10172672
333 Ga0207688_10006161
334 Ga0207643_10003194
335 Ga0207707_10033787
336 Ga0207649_10020894
337 Ga0207649_10303694
338 Ga0207646_10004926
339 Ga0207681_10021182
340 Ga0207681_10164782
341 Ga0207650_10011539
342 Ga0207650_10089725
343 Ga0207650_10144077
344 Ga0207659_10000080
345 Ga0207659_10044330
346 Ga0207687_10021088
347 Ga0207644_10047738
348 Ga0207706_10180065
349 Ga0207686_10010669
350 Ga0207669_10211086
351 Ga0207704_10008189
352 Ga0207704_10022701
353 Ga0207665_10031883
354 Ga0207691_10082540
355 Ga0207711_10002617
356 Ga0207711_10087570
357 Ga0207689_10010748
358 Ga0207679_10002633
359 Ga0207679_10008013
360 Ga0207651_10002709
361 Ga0207651_10064144
362 Ga0207651_10075577
363 Ga0207658_10014220
364 Ga0207658_10068030
365 Ga0207677_10009807
366 Ga0207677_10036802
367 Ga0207677_10228380
368 Ga0207677_10333786
369 Ga0207703_10028852
370 Ga0207703_10172885
371 Ga0207641_10001056
372 Ga0207641_10075643
373 Ga0207648_10016101
374 Ga0207676_10021259
375 Ga0207676_10100707
376 Ga0207676_10387783
377 Ga0207675_100043558
378 Ga0207683_10016863
379 Ga0207428_10127826
380 Ga0268266_10025157
381 Ga0268265_10053127
382 Ga0268265_10236464
383 Ga0268264_10221106
384 Ga0265314_10116783
385 Ga0373952_0025216
386 Ga0373954_0094021
387 Ga0373956_0037315
388 Ga0373943_0000503
389 Ga0373946_0001515
390 Ga0373955_0004754
391 Ga0373955_0023310
392 Ga0373931_0012227
393 Ga0373935_0007830
394 Ga0373933_0112460
395 Ga0373947_0052477
396 Ga0373937_0019575
397 Ga0373925_0002015
398 Ga0451853_1078057
399 Ga0451577_0001798
400 Ga0451577_0031485
401 Ga0453684_0144285
402 Ga0495651_0046612
403 Ga0495651_0106368
404 Ga0495639_0084565
405 Ga0495639_0098312
406 Ga0495628_0065198
407 Ga0495628_0077034
408 Ga0495630_0053327
409 Ga0495652_0021527
410 Ga0495652_0090406
411 Ga0495640_0140709
412 Ga0495586_0117737
413 Ga0495621_0018636
414 Ga0495645_0013472
415 Ga0495645_0019041
416 Ga0495667_0025759
417 Ga0495634_0034219
418 Ga0495635_0024673
419 Ga0495588_0088236
420 Ga0495646_0134932
421 Ga0495647_0086769
422 Ga0495658_0011589
423 Ga0495613_0007876
424 Ga0495613_0105162
425 Ga0495613_0285808
426 Ga0495581_0222716
427 Ga0495604_0147032
428 Ga0495674_0050015
429 Ga0495676_0026255
430 Ga0495680_0034213
431 Ga0495684_0010930
432 Ga0495684_0014526
433 Ga0495602_0046645
434 Ga0495602_0048211
435 Ga0495602_0177578
436 Ga0496104_0266961
437 Ga0496105_0342082
438 Ga0496112_0096413
439 nmdc:mga00v17_8433_c1
440 nmdc:mga0k408_27182_c1
441 nmdc:mga06z11_15132_c1
442 nmdc:mga04h51_9899_c1
443 nmdc:mga05p37_23257_c1
444 nmdc:mga08y16_163523_c1
445 nmdc:mga08y16_17979_c1
446 nmdc:mga0n895_233506_c1
447 nmdc:mga0n895_244159_c1
448 nmdc:mga0n895_76_c1
449 nmdc:mga0rr50_100722_c1
450 nmdc:mga0rr50_103856_c1
451 nmdc:mga0rr50_25_c1
452 nmdc:mga08x19_2573_c1
453 nmdc:mga0a205_49746_c1
454 Ga0495619_0168585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yzv-assembly1.cif.gz_B biophysical and structural characterization of the thermostable wd40 domain of a prokaryotic protein, thermomonospora curvata pkwa 0.8731 30 337
3sfz-assembly1.cif.gz_A crystal structure of full-length murine apaf-1 0.8683 31 310
3ow8-assembly2.cif.gz_B crystal structure of the wd repeat-containing protein 61 0.8679 31 341
5yzv-assembly1.cif.gz_A biophysical and structural characterization of the thermostable wd40 domain of a prokaryotic protein, thermomonospora curvata pkwa 0.8658 31 339
2co0-assembly2.cif.gz_C wdr5 and unmodified histone h3 complex at 2.25 angstrom 0.8651 27 340
ID Description Score Start End Superfamily
af_Q79FU2_202_331_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9206 168 275 2.40.10.500
4exrA02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9002 134 163 3.10.450.40
af_Q79FU0_283_386_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8964 168 259 2.40.10.500
af_Q99973_1648_1792_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8909 114 240 2.130.10.10
af_I1JGD6_255_439_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8909 81 243 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1Q7Z204-F1-model_v4 YVTN family beta-propeller domain-containing protein 0.987 35 306
AF-A0A2N9M4G6-F1-model_v4 YVTN family beta-propeller domain-containing protein 0.9813 17 285 GO:0016020
AF-A0A1Q7Z204-F1-model_v4 YVTN family beta-propeller domain-containing protein 0.9729 35 306
AF-A0A3D4YMV4-F1-model_v4 YVTN family beta-propeller domain-containing protein 0.9728 25 341
AF-A0A2V7KTM2-F1-model_v4 YVTN family beta-propeller domain-containing protein 0.9622 17 262

Map