F339906

General Info

Members Datasets Scaffolds Average Seq Length
227 145 208 237

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10057258|Ga0157373_100572582
Length 250
Sequence MNNINLPPVVKNLLIINVLFFAAKYVLNNIGLANLDYLLGAFYIDSPFFRVWQLVTYMFMHGDIAHIFFNMFALFMFGGVIESRWGAKRFLNFYLLTGLGAVALQLGVQAYEVYHITGSVFNSGITDMELVNQGIQANISIPGLSEEEKNTLLGIYGFPMVGASGAVFGLLVAFGMLYPNTELYIMLIPIPIKAKFIIPIYILAELFLGVARIPGDSIAHYAHLGGALLGFILVKLWKDKDNNRFYKYYE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2739367663 Pedobacter sp. YR510 Isolate Unclassified
9 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
10 2818991437 Pedobacter terrae 518 Isolate Unclassified
11 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
12 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
13 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
14 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
15 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
16 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
17 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
18 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
19 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
20 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
23 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.19
Metatranscriptomes 0.44
Isolates 8.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.57
Nodule 0
Rhizoplane 0.44
Rhizosphere 79.74
Stem 0
Stem Tuber 0
Unclassified 9.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_200289 2162886007 Bacteria 10699
2 SwRhRL2b_contig_917745 2162886007 Bacteria 1995
3 JGI24737J22298_10005450 3300001990 Bacteria 4395
4 JGI25162J39368_1000008 3300002737 Bacteria 397212
5 JGI25152J39213_1000348 3300002773 Bacteria 28979
6 JGI25150J39212_1000011 3300002774 Bacteria 195312
7 JGI25151J46595_10000033 3300003187 Bacteria 195312
8 JGI25153J46596_10000052 3300003215 Bacteria 139303
9 rootH1_10075620 3300003316 Bacteria 3191
10 rootH2_10184826 3300003320 Bacteria 6927
11 rootL2_10202170 3300003322 Bacteria 2299
12 rootH1_10326301 3300003323 Bacteria 1068
13 Ga0055536_1000004 3300003781 Bacteria 411108
14 Ga0055530_10025417 3300003791 Bacteria 1654
15 Ga0058863_11407668 3300004799 Bacteria 4028
16 Ga0065714_10002344 3300005288 Bacteria 34779
17 Ga0065714_10002459 3300005288 Bacteria 32086
18 Ga0065714_10002777 3300005288 Bacteria 14728
19 Ga0065714_10005625 3300005288 Bacteria 3763
20 Ga0065714_10064653 3300005288 Bacteria 25550
21 Ga0065704_10070225 3300005289 Bacteria 60561
22 Ga0065704_10073961 3300005289 Bacteria 6638
23 Ga0065704_10183998 3300005289 Bacteria 1223
24 Ga0070658_10000069 3300005327 Bacteria 101140
25 Ga0070658_10169976 3300005327 Bacteria 1831
26 Ga0070670_100203911 3300005331 Bacteria 1719
27 Ga0070680_100019485 3300005336 Bacteria 5376
28 Ga0070675_100216603 3300005354 Bacteria 1666
29 Ga0070671_100278226 3300005355 Bacteria 1423
30 Ga0070659_100128027 3300005366 Bacteria 2061
31 Ga0070678_100059185 3300005456 Bacteria 2815
32 Ga0070678_100740259 3300005456 Unclassified 888
33 Ga0070679_100003596 3300005530 Bacteria 14170
34 Ga0070679_100667631 3300005530 Bacteria 982
35 Ga0068853_100097141 3300005539 Bacteria 2600
36 Ga0068855_100000141 3300005563 Bacteria 92463
37 Ga0068855_100321847 3300005563 Bacteria 1709
38 Ga0068857_100030488 3300005577 Bacteria 4762
39 Ga0068856_100018898 3300005614 Bacteria 6684
40 Ga0068856_100062378 3300005614 Bacteria 3682
41 Ga0068856_100086385 3300005614 Bacteria 3117
42 Ga0068856_100396891 3300005614 Bacteria 1399
43 Ga0068852_100050829 3300005616 Bacteria 3554
44 Ga0068866_10222105 3300005718 Bacteria 1140
45 Ga0068863_100837971 3300005841 Bacteria 918
46 Ga0068858_100060264 3300005842 Bacteria 3508
47 Ga0068860_100306426 3300005843 Bacteria 1557
48 Ga0070715_10054334 3300006163 Bacteria 1734
49 Ga0075366_10000019 3300006195 Bacteria 59333
50 Ga0075366_10425517 3300006195 Unclassified 818
51 Ga0097621_100000205 3300006237 Bacteria 38617
52 Ga0068871_100000162 3300006358 Bacteria 44419
53 Ga0068871_100032582 3300006358 Bacteria 4118
54 Ga0068871_100540663 3300006358 Bacteria 1054
55 Ga0068865_100000075 3300006881 Bacteria 51751
56 Ga0105244_10015354 3300009036 Bacteria 4393
57 Ga0105240_11248494 3300009093 Unclassified 785
58 Ga0111539_11419299 3300009094 Unclassified 805
59 Ga0105241_10339940 3300009174 Bacteria 1300
60 Ga0105241_10653946 3300009174 Bacteria 955
61 Ga0105237_10000402 3300009545 Bacteria 61603
62 Ga0105237_10003033 3300009545 Bacteria 20261
63 Ga0105238_10136596 3300009551 Bacteria 2429
64 Ga0105238_10175419 3300009551 Bacteria 2120
65 Ga0105249_10140771 3300009553 Bacteria 2313
66 Ga0105239_10161833 3300010375 Bacteria 2501
67 Ga0157373_10000325 3300013100 Bacteria 38624
68 Ga0157373_10005074 3300013100 Bacteria 9895
69 Ga0157373_10007845 3300013100 Bacteria 7938
70 Ga0157373_10057258 3300013100 Bacteria 2765
71 Ga0157373_10065982 3300013100 Bacteria 2561
72 Ga0157371_10002733 3300013102 Bacteria 16615
73 Ga0157371_10003323 3300013102 Bacteria 14694
74 Ga0157371_10006953 3300013102 Bacteria 9217
75 Ga0157371_10007594 3300013102 Bacteria 8750
76 Ga0157370_10000084 3300013104 Bacteria 104159
77 Ga0157370_10006142 3300013104 Bacteria 13329
78 Ga0157370_10008568 3300013104 Bacteria 11017
79 Ga0157370_10010343 3300013104 Bacteria 9842
80 Ga0157370_10020759 3300013104 Bacteria 6555
81 Ga0157370_10032707 3300013104 Bacteria 5077
82 Ga0157370_10039204 3300013104 Bacteria 4578
83 Ga0157370_10050409 3300013104 Bacteria 3979
84 Ga0157370_10429053 3300013104 Bacteria 1216
85 Ga0157369_10000023 3300013105 Bacteria 226955
86 Ga0157369_10303694 3300013105 Bacteria 1660
87 Ga0157378_10046615 3300013297 Bacteria 3852
88 Ga0163162_10000675 3300013306 Bacteria 31705
89 Ga0163162_10001616 3300013306 Bacteria 21082
90 Ga0163162_10683418 3300013306 Unclassified 1149
91 Ga0163162_11050043 3300013306 Bacteria 922
92 Ga0157372_10001739 3300013307 Bacteria 23620
93 Ga0157372_10319056 3300013307 Bacteria 1809
94 Ga0157375_10075285 3300013308 Bacteria 3400
95 Ga0157375_11019828 3300013308 Bacteria 966
96 Ga0157375_11166394 3300013308 Bacteria 903
97 Ga0163163_10623016 3300014325 Unclassified 1142
98 Ga0157380_10793211 3300014326 Unclassified 963
99 Ga0182008_10000002 3300014497 Bacteria 480216
100 Ga0182008_10000112 3300014497 Bacteria 62174
101 Ga0182008_10062928 3300014497 Unclassified 1828
102 Ga0182008_10186448 3300014497 Bacteria 1051
103 Ga0182008_10244819 3300014497 Bacteria 923
104 Ga0157376_10263262 3300014969 Bacteria 1616
105 Ga0182006_1000219 3300015261 Bacteria 55851
106 Ga0182006_1000234 3300015261 Bacteria 52437
107 Ga0182006_1001379 3300015261 Bacteria 14791
108 Ga0182006_1004168 3300015261 Bacteria 7176
109 Ga0182007_10000002 3300015262 Bacteria 564661
110 Ga0182007_10018473 3300015262 Unclassified 2525
111 Ga0182007_10045777 3300015262 Bacteria 1450
112 Ga0163161_10000352 3300017792 Bacteria 38794
113 Ga0163161_10000834 3300017792 Bacteria 24051
114 Ga0163161_10000894 3300017792 Bacteria 23161
115 Ga0163161_10027179 3300017792 Bacteria 4059
116 Ga0163161_10037646 3300017792 Bacteria 3468
117 Ga0163161_10055974 3300017792 Bacteria 2864
118 Ga0163161_10081738 3300017792 Bacteria 2379
119 Ga0163161_10141731 3300017792 Bacteria 1820
120 Ga0163161_10241678 3300017792 Bacteria 1404
121 Ga0163161_10268856 3300017792 Bacteria 1333
122 Ga0163161_10381224 3300017792 Bacteria 1127
123 Ga0209437_100030 3300025233 Bacteria 532466
124 Ga0207425_1000003 3300025245 Bacteria 1145342
125 Ga0209129_1000076 3300025258 Bacteria 195353
126 Ga0209129_1009224 3300025258 Bacteria 2631
127 Ga0209233_1000657 3300025261 Bacteria 16808
128 Ga0209233_1010405 3300025261 Bacteria 2788
129 Ga0209233_1033554 3300025261 Bacteria 1177
130 Ga0209676_1000009 3300025292 Bacteria 981719
131 Ga0209025_1000007 3300025294 Bacteria 1145109
132 Ga0209758_1000114 3300025297 Bacteria 199324
133 Ga0209050_1000048 3300025298 Bacteria 371553
134 Ga0207655_1060687 3300025728 Bacteria 1464
135 Ga0207647_10000080 3300025904 Bacteria 71854
136 Ga0207705_10000293 3300025909 Bacteria 46583
137 Ga0207705_10255978 3300025909 Bacteria 1336
138 Ga0207654_10178311 3300025911 Bacteria 1384
139 Ga0207671_10003209 3300025914 Bacteria 16467
140 Ga0207671_10003421 3300025914 Bacteria 15844
141 Ga0207671_10042920 3300025914 Bacteria 3345
142 Ga0207660_10030518 3300025917 Bacteria 3705
143 Ga0207652_10009420 3300025921 Bacteria 7854
144 Ga0207694_10063196 3300025924 Bacteria 2884
145 Ga0207644_10385175 3300025931 Bacteria 1144
146 Ga0207690_10004771 3300025932 Bacteria 7996
147 Ga0207686_10124925 3300025934 Bacteria 1757
148 Ga0207709_10072469 3300025935 Bacteria 2191
149 Ga0207704_10006312 3300025938 Bacteria 5520
150 Ga0207691_10172486 3300025940 Bacteria 1893
151 Ga0207667_10000030 3300025949 Bacteria 327226
152 Ga0207712_10423057 3300025961 Unclassified 1124
153 Ga0207703_10168108 3300026035 Unclassified 1926
154 Ga0207639_10010054 3300026041 Bacteria 6543
155 Ga0207702_10034023 3300026078 Bacteria 4259
156 Ga0207702_10047816 3300026078 Bacteria 3606
157 Ga0207702_10290607 3300026078 Bacteria 1548
158 Ga0207702_10345606 3300026078 Bacteria 1422
159 Ga0207674_10043121 3300026116 Bacteria 4654
160 Ga0207683_10003023 3300026121 Bacteria 14688
161 Ga0207683_10094930 3300026121 Bacteria 2658
162 Ga0207698_10174950 3300026142 Unclassified 1894
163 Ga0268264_10257138 3300028381 Bacteria 1625
164 Ga0307515_10000318 3300028794 Bacteria 118891
165 Ga0307509_10135492 3300031507 Bacteria 2409
166 Ga0307408_100000527 3300031548 Bacteria 33024
167 Ga0307407_10000003 3300031903 Bacteria 271723
168 Ga0307412_10000038 3300031911 Bacteria 187857
169 Ga0307409_100024357 3300031995 Bacteria 4220
170 Ga0307416_100000024 3300032002 Bacteria 186924
171 Ga0307414_10000265 3300032004 Bacteria 32893
172 Ga0307414_10001004 3300032004 Bacteria 14421
173 Ga0307414_10026320 3300032004 Bacteria 3743
174 Ga0307414_10083058 3300032004 Bacteria 2351
175 Ga0307414_10086895 3300032004 Bacteria 2309
176 Ga0307414_10090357 3300032004 Bacteria 2272
177 Ga0307414_10102284 3300032004 Unclassified 2159
178 Ga0307414_10105537 3300032004 Bacteria 2130
179 Ga0307414_10125932 3300032004 Bacteria 1979
180 Ga0307411_10034213 3300032005 Unclassified 3160
181 Ga0307510_10000172 3300033180 Bacteria 54812
182 Ga0395899_0000017 3300037312 Bacteria 440179
183 Ga0395900_0000151 3300037418 Bacteria 116281
184 Ga0395901_1006181 3300038443 Bacteria 809
185 Ga0495651_0179267 3300046462 Bacteria 1501
186 Ga0495650_0000050 3300046471 Bacteria 318894
187 Ga0495650_0081061 3300046471 Bacteria 1251
188 Ga0495606_0003028 3300046507 Bacteria 18381
189 Ga0495606_0074243 3300046507 Bacteria 2131
190 Ga0495610_0000130 3300046512 Bacteria 82710
191 Ga0495610_0000188 3300046512 Bacteria 69214
192 Ga0495637_0010866 3300046520 Bacteria 4388
193 Ga0495609_0004315 3300046538 Bacteria 7817
194 Ga0495633_0000012 3300046558 Bacteria 267875
195 Ga0495668_0000055 3300046616 Bacteria 199412
196 Ga0495672_0027814 3300047320 Bacteria 3588
197 Ga0495687_027928 3300047443 Bacteria 2633
198 Ga0495686_0063188 3300047472 Bacteria 2295
199 Ga0496115_0308415 3300048918 Bacteria 1296
200 Ga0496122_0005748 3300048925 Bacteria 14614
201 Ga0496123_0002926 3300048926 Bacteria 19984
202 Ga0496125_0037885 3300048928 Bacteria 4186
203 Ga0501225_0145524 3300049705 Bacteria 719
204 Ga0501241_004185 3300049758 Bacteria 2709
205 nmdc:mga0k408_65_c1 3300050493 Bacteria 52329
206 Ga0500635_0000649 3300053080 Bacteria 8870
207 Ga0500651_0000589 3300053093 Bacteria 18247
208 Ga0500624_000168 3300053157 Bacteria 26458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100060264 Ga0068858_1000602643 184
2 3300049705 Ga0501225_0145524 Ga0501225_0145524_11_601 188
3 3300005331 Ga0070670_100203911 Ga0070670_1002039111 201
4 3300005354 Ga0070675_100216603 Ga0070675_1002166032 201
5 3300005355 Ga0070671_100278226 Ga0070671_1002782262 201
6 3300005456 Ga0070678_100059185 Ga0070678_1000591853 201
7 3300005841 Ga0068863_100837971 Ga0068863_1008379711 201
8 3300006358 Ga0068871_100540663 Ga0068871_1005406632 201
9 3300009094 Ga0111539_11419299 Ga0111539_114192991 201
10 3300013306 Ga0163162_10683418 Ga0163162_106834182 201
11 3300014325 Ga0163163_10623016 Ga0163163_106230162 201
12 3300014326 Ga0157380_10793211 Ga0157380_107932111 201
13 3300025931 Ga0207644_10385175 Ga0207644_103851752 201
14 3300025940 Ga0207691_10172486 Ga0207691_101724861 201
15 3300026121 Ga0207683_10094930 Ga0207683_100949301 201
16 3300006195 Ga0075366_10000019 Ga0075366_100000197 211
17 3300025924 Ga0207694_10063196 Ga0207694_100631962 211
18 3300046558 Ga0495633_0000012 Ga0495633_0000012_61304_62014 211
19 3300050493 nmdc:mga0k408_65_c1 nmdc:mga0k408_65_c1_49874_50584 211
20 3300005530 Ga0070679_100667631 Ga0070679_1006676312 213
21 3300026035 Ga0207703_10168108 Ga0207703_101681082 213
22 3300003316 rootH1_10075620 rootH1_100756202 214
23 3300003322 rootL2_10202170 rootL2_102021702 214
24 3300004799 Ga0058863_11407668 Ga0058863_114076682 214
25 3300005327 Ga0070658_10169976 Ga0070658_101699762 214
26 3300005336 Ga0070680_100019485 Ga0070680_1000194855 214
27 3300005530 Ga0070679_100003596 Ga0070679_1000035969 214
28 3300005563 Ga0068855_100000141 Ga0068855_10000014150 214
29 3300005614 Ga0068856_100018898 Ga0068856_1000188985 214
30 3300005614 Ga0068856_100062378 Ga0068856_1000623782 214
31 3300005614 Ga0068856_100396891 Ga0068856_1003968911 214
32 3300025909 Ga0207705_10255978 Ga0207705_102559782 214
33 3300025917 Ga0207660_10030518 Ga0207660_100305182 214
34 3300025921 Ga0207652_10009420 Ga0207652_100094203 214
35 3300025949 Ga0207667_10000030 Ga0207667_1000003073 214
36 3300026078 Ga0207702_10034023 Ga0207702_100340232 214
37 3300026078 Ga0207702_10047816 Ga0207702_100478162 214
38 3300026078 Ga0207702_10345606 Ga0207702_103456062 214
39 3300005616 Ga0068852_100050829 Ga0068852_1000508292 215
40 3300009551 Ga0105238_10136596 Ga0105238_101365962 215
41 3300009553 Ga0105249_10140771 Ga0105249_101407712 215
42 3300013306 Ga0163162_10001616 Ga0163162_100016163 215
43 3300025961 Ga0207712_10423057 Ga0207712_104230572 215
44 3300026142 Ga0207698_10174950 Ga0207698_101749502 215
45 3300005327 Ga0070658_10000069 Ga0070658_1000006917 216
46 3300010375 Ga0105239_10161833 Ga0105239_101618332 216
47 3300025909 Ga0207705_10000293 Ga0207705_1000029317 216
48 3300003323 rootH1_10326301 rootH1_103263011 217
49 3300005614 Ga0068856_100086385 Ga0068856_1000863852 217
50 3300025261 Ga0209233_1010405 Ga0209233_10104053 217
51 3300026078 Ga0207702_10290607 Ga0207702_102906071 217
52 3300031507 Ga0307509_10135492 Ga0307509_101354922 217
53 3300037312 Ga0395899_0000017 Ga0395899_0000017_37512_38219 217
54 3300053157 Ga0500624_000168 Ga0500624_000168_11352_12083 217
55 iso_pu_bacteria 2958512119 2958515971 217
56 3300005843 Ga0068860_100306426 Ga0068860_1003064262 218
57 3300006163 Ga0070715_10054334 Ga0070715_100543342 218
58 3300006358 Ga0068871_100032582 Ga0068871_1000325824 218
59 3300013104 Ga0157370_10032707 Ga0157370_100327074 218
60 3300013306 Ga0163162_11050043 Ga0163162_110500432 218
61 3300013308 Ga0157375_10075285 Ga0157375_100752854 218
62 3300017792 Ga0163161_10055974 Ga0163161_100559742 218
63 3300028381 Ga0268264_10257138 Ga0268264_102571382 218
64 3300006195 Ga0075366_10425517 Ga0075366_104255171 221
65 3300009093 Ga0105240_11248494 Ga0105240_112484941 221
66 3300009174 Ga0105241_10653946 Ga0105241_106539462 221
67 3300047320 Ga0495672_0027814 Ga0495672_0027814_751_1452 221
68 3300001990 JGI24737J22298_10005450 JGI24737J22298_100054505 222
69 3300005366 Ga0070659_100128027 Ga0070659_1001280272 222
70 3300005563 Ga0068855_100321847 Ga0068855_1003218471 222
71 3300005577 Ga0068857_100030488 Ga0068857_1000304884 222
72 3300013100 Ga0157373_10007845 Ga0157373_100078455 222
73 3300013102 Ga0157371_10006953 Ga0157371_100069537 222
74 3300013104 Ga0157370_10050409 Ga0157370_100504093 222
75 3300013307 Ga0157372_10001739 Ga0157372_100017397 222
76 3300025261 Ga0209233_1000657 Ga0209233_10006576 222
77 3300025904 Ga0207647_10000080 Ga0207647_1000008055 222
78 3300025932 Ga0207690_10004771 Ga0207690_100047717 222
79 3300026116 Ga0207674_10043121 Ga0207674_100431214 222
80 3300038443 Ga0395901_1006181 Ga0395901_1006181_60_773 222
81 3300046507 Ga0495606_0003028 Ga0495606_0003028_13645_14361 222
82 3300046616 Ga0495668_0000055 Ga0495668_0000055_42985_43695 222
83 3300028794 Ga0307515_10000318 Ga0307515_1000031877 223
84 3300031548 Ga0307408_100000527 Ga0307408_1000005272 223
85 3300046462 Ga0495651_0179267 Ga0495651_0179267_543_1265 223
86 3300046471 Ga0495650_0081061 Ga0495650_0081061_136_858 223
87 3300053080 Ga0500635_0000649 Ga0500635_0000649_3274_3990 223
88 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008137 224
89 3300009174 Ga0105241_10339940 Ga0105241_103399402 224
90 3300009545 Ga0105237_10003033 Ga0105237_1000303316 224
91 3300009551 Ga0105238_10175419 Ga0105238_101754192 224
92 3300013307 Ga0157372_10319056 Ga0157372_103190562 224
93 3300025233 Ga0209437_100030 Ga0209437_100030250 224
94 3300025258 Ga0209129_1009224 Ga0209129_10092242 224
95 3300025911 Ga0207654_10178311 Ga0207654_101783112 224
96 3300025914 Ga0207671_10003421 Ga0207671_1000342112 224
97 3300025914 Ga0207671_10042920 Ga0207671_100429202 224
98 3300032004 Ga0307414_10026320 Ga0307414_100263202 224
99 3300032004 Ga0307414_10086895 Ga0307414_100868952 224
100 3300032004 Ga0307414_10102284 Ga0307414_101022842 224
101 3300032005 Ga0307411_10034213 Ga0307411_100342132 224
102 3300037418 Ga0395900_0000151 Ga0395900_0000151_75125_75844 224
103 iso_pu_bacteria 2739367663 2739646564 224
104 iso_pu_bacteria 2954016120 2954021273 224
105 3300003320 rootH2_10184826 rootH2_101848265 225
106 3300005718 Ga0068866_10222105 Ga0068866_102221052 225
107 3300025261 Ga0209233_1033554 Ga0209233_10335541 225
108 3300033180 Ga0307510_10000172 Ga0307510_1000017229 225
109 3300047472 Ga0495686_0063188 Ga0495686_0063188_1519_2223 225
110 3300047443 Ga0495687_027928 Ga0495687_027928_1772_2494 226
111 3300013104 Ga0157370_10008568 Ga0157370_1000856810 228
112 3300013104 Ga0157370_10020759 Ga0157370_100207592 228
113 3300013297 Ga0157378_10046615 Ga0157378_100466155 228
114 3300017792 Ga0163161_10000894 Ga0163161_100008946 228
115 3300017792 Ga0163161_10027179 Ga0163161_100271792 228
116 3300017792 Ga0163161_10081738 Ga0163161_100817382 228
117 3300017792 Ga0163161_10241678 Ga0163161_102416782 228
118 3300017792 Ga0163161_10268856 Ga0163161_102688562 228
119 3300046512 Ga0495610_0000188 Ga0495610_0000188_29768_30469 228
120 3300046520 Ga0495637_0010866 Ga0495637_0010866_2453_3154 228
121 3300046471 Ga0495650_0000050 Ga0495650_0000050_210881_211615 229
122 3300048918 Ga0496115_0308415 Ga0496115_0308415_207_905 230
123 iso_pu_bacteria 2585427687 2586210795 230
124 iso_pu_bacteria 2738541302 2738854345 230
125 iso_pu_bacteria 2818991437 2819545771 230
126 iso_pu_bacteria 2842722452 2842724339 230
127 iso_pu_bacteria 2842909656 2842913526 230
128 iso_pu_bacteria 2849281842 2849284976 230
129 iso_pu_bacteria 2945997725 2945998822 230
130 3300005456 Ga0070678_100740259 Ga0070678_1007402591 231
131 3300005539 Ga0068853_100097141 Ga0068853_1000971412 231
132 3300006237 Ga0097621_100000205 Ga0097621_10000020521 231
133 3300006358 Ga0068871_100000162 Ga0068871_10000016240 231
134 3300006881 Ga0068865_100000075 Ga0068865_1000000752 231
135 3300014969 Ga0157376_10263262 Ga0157376_102632622 231
136 3300025934 Ga0207686_10124925 Ga0207686_101249252 231
137 3300025935 Ga0207709_10072469 Ga0207709_100724692 231
138 3300025938 Ga0207704_10006312 Ga0207704_100063122 231
139 3300026041 Ga0207639_10010054 Ga0207639_100100544 231
140 3300026121 Ga0207683_10003023 Ga0207683_100030234 231
141 iso_pu_bacteria 2738541283 2738758906 231
142 iso_pu_bacteria 2775506987 2776615351 231
143 iso_pu_bacteria 2739367656 2739614469 232
144 iso_pu_bacteria 2857627736 2857632584 232
145 iso_pu_bacteria 2739367651 2739587883 233
146 iso_pu_bacteria 2919186247 2919188970 233
147 iso_pu_bacteria 2939664404 2939666875 233
148 3300003781 Ga0055536_1000004 Ga0055536_100000439 234
149 3300003791 Ga0055530_10025417 Ga0055530_100254171 234
150 3300005288 Ga0065714_10005625 Ga0065714_100056252 234
151 3300005288 Ga0065714_10064653 Ga0065714_1006465311 234
152 3300009036 Ga0105244_10015354 Ga0105244_100153543 234
153 3300013100 Ga0157373_10065982 Ga0157373_100659823 234
154 3300013104 Ga0157370_10429053 Ga0157370_104290532 234
155 3300013105 Ga0157369_10000023 Ga0157369_1000002365 234
156 3300013306 Ga0163162_10000675 Ga0163162_1000067521 234
157 3300013308 Ga0157375_11019828 Ga0157375_110198282 234
158 3300015261 Ga0182006_1000219 Ga0182006_100021926 234
159 3300015261 Ga0182006_1001379 Ga0182006_10013793 234
160 3300015262 Ga0182007_10000002 Ga0182007_10000002494 234
161 3300017792 Ga0163161_10037646 Ga0163161_100376462 234
162 3300025292 Ga0209676_1000009 Ga0209676_1000009512 234
163 3300025298 Ga0209050_1000048 Ga0209050_1000048308 234
164 3300025728 Ga0207655_1060687 Ga0207655_10606872 234
165 3300031903 Ga0307407_10000003 Ga0307407_10000003249 234
166 3300031995 Ga0307409_100024357 Ga0307409_1000243574 234
167 3300032002 Ga0307416_100000024 Ga0307416_100000024126 234
168 3300046507 Ga0495606_0074243 Ga0495606_0074243_64_783 234
169 2162886007 SwRhRL2b_contig_917745 SwRhRL2b_0351.00000770 235
170 3300005288 Ga0065714_10002344 Ga0065714_1000234419 235
171 3300005289 Ga0065704_10073961 Ga0065704_100739614 235
172 3300009545 Ga0105237_10000402 Ga0105237_1000040232 235
173 3300013100 Ga0157373_10005074 Ga0157373_100050746 235
174 3300013102 Ga0157371_10003323 Ga0157371_100033232 235
175 3300013102 Ga0157371_10007594 Ga0157371_100075947 235
176 3300013104 Ga0157370_10000084 Ga0157370_1000008486 235
177 3300013104 Ga0157370_10006142 Ga0157370_100061427 235
178 3300013104 Ga0157370_10039204 Ga0157370_100392042 235
179 3300013105 Ga0157369_10303694 Ga0157369_103036942 235
180 3300013308 Ga0157375_11166394 Ga0157375_111663942 235
181 3300014497 Ga0182008_10000112 Ga0182008_1000011253 235
182 3300014497 Ga0182008_10062928 Ga0182008_100629282 235
183 3300014497 Ga0182008_10186448 Ga0182008_101864482 235
184 3300014497 Ga0182008_10244819 Ga0182008_102448192 235
185 3300015261 Ga0182006_1000234 Ga0182006_100023438 235
186 3300015262 Ga0182007_10018473 Ga0182007_100184732 235
187 3300015262 Ga0182007_10045777 Ga0182007_100457772 235
188 3300017792 Ga0163161_10000352 Ga0163161_1000035233 235
189 3300017792 Ga0163161_10000834 Ga0163161_100008342 235
190 3300017792 Ga0163161_10141731 Ga0163161_101417312 235
191 3300025914 Ga0207671_10003209 Ga0207671_1000320911 235
192 3300031911 Ga0307412_10000038 Ga0307412_1000003812 235
193 3300032004 Ga0307414_10083058 Ga0307414_100830582 235
194 3300032004 Ga0307414_10090357 Ga0307414_100903572 235
195 3300032004 Ga0307414_10125932 Ga0307414_101259322 235
196 3300046538 Ga0495609_0004315 Ga0495609_0004315_3733_4470 235
197 3300048925 Ga0496122_0005748 Ga0496122_0005748_8350_9084 235
198 3300048926 Ga0496123_0002926 Ga0496123_0002926_13500_14234 235
199 3300048928 Ga0496125_0037885 Ga0496125_0037885_2456_3190 235
200 3300002773 JGI25152J39213_1000348 JGI25152J39213_10003483 236
201 3300002774 JGI25150J39212_1000011 JGI25150J39212_10000113 236
202 3300003187 JGI25151J46595_10000033 JGI25151J46595_100000333 236
203 3300003215 JGI25153J46596_10000052 JGI25153J46596_10000052121 236
204 3300013104 Ga0157370_10010343 Ga0157370_100103433 236
205 3300025245 Ga0207425_1000003 Ga0207425_1000003835 236
206 3300025258 Ga0209129_1000076 Ga0209129_10000763 236
207 3300025294 Ga0209025_1000007 Ga0209025_1000007834 236
208 3300025297 Ga0209758_1000114 Ga0209758_1000114164 236
209 3300005289 Ga0065704_10183998 Ga0065704_101839982 237
210 3300015261 Ga0182006_1004168 Ga0182006_10041682 237
211 3300032004 Ga0307414_10000265 Ga0307414_1000026514 237
212 3300046512 Ga0495610_0000130 Ga0495610_0000130_72929_73642 237
213 iso_pu_bacteria 2738541284 2738762004 237
214 iso_pu_bacteria 2852627209 2852628917 237
215 3300013100 Ga0157373_10057258 Ga0157373_100572582 238
216 2162886007 SwRhRL2b_contig_200289 SwRhRL2b_0871.00001910 241
217 3300005288 Ga0065714_10002459 Ga0065714_1000245922 241
218 3300005288 Ga0065714_10002777 Ga0065714_1000277712 241
219 3300005289 Ga0065704_10070225 Ga0065704_1007022526 241
220 3300013100 Ga0157373_10000325 Ga0157373_1000032517 241
221 3300013102 Ga0157371_10002733 Ga0157371_100027339 241
222 3300014497 Ga0182008_10000002 Ga0182008_10000002339 241
223 3300017792 Ga0163161_10381224 Ga0163161_103812242 241
224 3300032004 Ga0307414_10001004 Ga0307414_100010041 241
225 3300032004 Ga0307414_10105537 Ga0307414_101055373 241
226 3300049758 Ga0501241_004185 Ga0501241_004185_1574_2299 241
227 3300053093 Ga0500651_0000589 Ga0500651_0000589_16475_17200 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

49

239

0.88

PF08551

DUF1751

Eukaryotic integral membrane protein (DUF1751)

45

140

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f5k-assembly1.cif.gz_A e.coli glpg y205f mutant complexed with aldehyde inhibitor in dmpc/chapso bicelle 0.7733 8 227
6pj8-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7587 5 227
6pjr-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7549 8 227
6pj5-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7539 8 227
3zmj-assembly1.cif.gz_A structure of e.coli rhomboid protease glpg in complex with monobactam l61 0.7437 5 227
ID Description Score Start End Superfamily
af_Q54NX5_136_340_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8847 8 231 1.20.1540.10
af_F1R9M8_118_305_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8757 9 225 1.20.1540.10
af_I1JZG9_137_329_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8604 9 225 1.20.1540.10
af_Q54NX5_136_340_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8489 8 231 1.20.1540.10
af_I1JZG9_137_329_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8397 9 225 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A2E7B002-F1-model_v4 deleted 0.9357 8 229
AF-A0A7Y4T4J4-F1-model_v4 Rhomboid family intramembrane serine protease 0.9253 4 231 GO:0004252
GO:0006508
GO:0016020
AF-A0A7X6V5M5-F1-model_v4 Rhomboid family intramembrane serine protease 0.9226 5 233 GO:0004252
GO:0006508
GO:0016020
AF-A0A7Y4T4J4-F1-model_v4 Rhomboid family intramembrane serine protease 0.9209 4 231 GO:0004252
GO:0006508
GO:0016020
AF-A0A351PWM9-F1-model_v4 deleted 0.919 12 232

Feature Viewer

pLDDT pTM Quality
86.53 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map