F339744

General Info

Members Datasets Scaffolds Average Seq Length
227 121 454 221

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100473385|Ga0068863_1004733852
Length 241
Sequence MTHGATNCAVGEGVLRSTLIADLERTMRTAFACREFTDEPVTDDDLVALLELARFAPSGGNRQGWRVVVVRDQATKDQLVELSLPALRLYVAQRAAGENPWNTVVPSAIDPASIDHTDDRGVEWFRILAQAPVLIVVGVDLSVVASADSQLDRIGVISGGSIYPFVQNLLLAARGRGLAGALTTFLAASEPAAQALLGFPPEVAVAAMVPIGHPKQDITKLRRQPVSSFARLERWDGPPLG

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
63 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
64 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
81 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
82 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
83 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
106 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
107 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.05
Nodule 0
Rhizoplane 3.96
Rhizosphere 87.67
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100473385 3300005841 Bacteria 1231
2 Ga0065707_10116093 3300005295 Bacteria 2248
3 Ga0070689_100474307 3300005340 Bacteria 1068
4 Ga0070691_10010216 3300005341 Bacteria 4281
5 Ga0070691_10036455 3300005341 Bacteria 2318
6 Ga0070671_100044707 3300005355 Bacteria 3681
7 Ga0070703_10117141 3300005406 Bacteria 961
8 Ga0070701_10451660 3300005438 Bacteria 825
9 Ga0070711_100064226 3300005439 Bacteria 2565
10 Ga0070705_100007127 3300005440 Bacteria 5500
11 Ga0070705_100266114 3300005440 Unclassified 1212
12 Ga0070705_100298772 3300005440 Bacteria 1153
13 Ga0070708_100005034 3300005445 Bacteria 10458
14 Ga0070708_100028754 3300005445 Bacteria 4785
15 Ga0070708_100062317 3300005445 Unclassified 3335
16 Ga0070708_100091375 3300005445 Bacteria 2772
17 Ga0070708_100115788 3300005445 Bacteria 2468
18 Ga0070708_100117608 3300005445 Bacteria 2448
19 Ga0070708_100413646 3300005445 Unclassified 1272
20 Ga0070708_100553939 3300005445 Bacteria 1084
21 Ga0070681_10559762 3300005458 Bacteria 1057
22 Ga0070706_100010348 3300005467 Bacteria 8665
23 Ga0070706_100080708 3300005467 Bacteria 3012
24 Ga0070706_100183853 3300005467 Bacteria 1952
25 Ga0070706_100204592 3300005467 Bacteria 1844
26 Ga0070706_100938859 3300005467 Bacteria 798
27 Ga0070707_100021004 3300005468 Bacteria 6165
28 Ga0070707_100171751 3300005468 Bacteria 2113
29 Ga0070707_100726106 3300005468 Bacteria 956
30 Ga0070698_100013416 3300005471 Bacteria 8673
31 Ga0070698_100013874 3300005471 Bacteria 8521
32 Ga0070698_100034206 3300005471 Bacteria 5264
33 Ga0070698_101130897 3300005471 Bacteria 732
34 Ga0070699_100000041 3300005518 Bacteria 128767
35 Ga0070699_100005852 3300005518 Bacteria 10744
36 Ga0070699_100005931 3300005518 Bacteria 10669
37 Ga0070699_100009085 3300005518 Bacteria 8616
38 Ga0070699_100118822 3300005518 Bacteria 2324
39 Ga0070699_100292563 3300005518 Bacteria 1460
40 Ga0070699_100562167 3300005518 Bacteria 1039
41 Ga0070697_100102576 3300005536 Bacteria 2377
42 Ga0070697_100108440 3300005536 Bacteria 2311
43 Ga0070697_100512631 3300005536 Bacteria 1049
44 Ga0070697_100711121 3300005536 Bacteria 887
45 Ga0070696_100062801 3300005546 Bacteria 2601
46 Ga0070696_100156542 3300005546 Bacteria 1676
47 Ga0070696_100339349 3300005546 Bacteria 1161
48 Ga0070704_100280611 3300005549 Bacteria 1380
49 Ga0070704_100526812 3300005549 Bacteria 1029
50 Ga0070704_100736243 3300005549 Bacteria 877
51 Ga0068859_100184082 3300005617 Bacteria 2172
52 Ga0068866_10077126 3300005718 Bacteria 1779
53 Ga0068863_100119700 3300005841 Bacteria 2510
54 Ga0068860_100090922 3300005843 Bacteria 2908
55 Ga0068862_100544532 3300005844 Bacteria 1107
56 Ga0081455_10002726 3300005937 Bacteria 20849
57 Ga0081455_10046975 3300005937 Bacteria 3742
58 Ga0081455_10207230 3300005937 Bacteria 1463
59 Ga0081539_10000020 3300005985 Bacteria 366549
60 Ga0070717_10000370 3300006028 Bacteria 28818
61 Ga0075365_10024658 3300006038 Bacteria 3798
62 Ga0075368_10015700 3300006042 Bacteria 2814
63 Ga0075363_100002922 3300006048 Bacteria 7120
64 Ga0075363_100004980 3300006048 Bacteria 5880
65 Ga0075363_100144539 3300006048 Bacteria 1341
66 Ga0075364_10016397 3300006051 Bacteria 4609
67 Ga0075432_10117311 3300006058 Bacteria 997
68 Ga0070716_100048677 3300006173 Bacteria 2398
69 Ga0075367_10019439 3300006178 Bacteria 3766
70 Ga0075367_10304824 3300006178 Bacteria 1003
71 Ga0075370_10087804 3300006353 Bacteria 1792
72 Ga0075428_100000420 3300006844 Bacteria 42195
73 Ga0075428_100013133 3300006844 Bacteria 9211
74 Ga0075428_100176714 3300006844 Bacteria 2312
75 Ga0075428_100450019 3300006844 Bacteria 1379
76 Ga0075428_100540335 3300006844 Bacteria 1246
77 Ga0075430_100000614 3300006846 Bacteria 27161
78 Ga0075430_100019407 3300006846 Bacteria 5782
79 Ga0075430_100174758 3300006846 Bacteria 1787
80 Ga0075430_100468211 3300006846 Bacteria 1040
81 Ga0075431_100000641 3300006847 Bacteria 29614
82 Ga0075431_100004922 3300006847 Bacteria 13157
83 Ga0075431_100077038 3300006847 Bacteria 3441
84 Ga0075431_100199771 3300006847 Bacteria 2046
85 Ga0075431_100209991 3300006847 Bacteria 1989
86 Ga0075431_100775302 3300006847 Unclassified 933
87 Ga0075433_10002745 3300006852 Bacteria 13463
88 Ga0075433_10017494 3300006852 Bacteria 5939
89 Ga0075433_10050009 3300006852 Bacteria 3638
90 Ga0075433_10624668 3300006852 Bacteria 945
91 Ga0075434_100068073 3300006871 Bacteria 3546
92 Ga0075434_100149431 3300006871 Bacteria 2356
93 Ga0075434_100173124 3300006871 Bacteria 2179
94 Ga0075434_100968448 3300006871 Bacteria 865
95 Ga0075429_100000177 3300006880 Bacteria 41340
96 Ga0075429_100007105 3300006880 Bacteria 9722
97 Ga0075429_100122577 3300006880 Bacteria 2272
98 Ga0075436_100016002 3300006914 Bacteria 5135
99 Ga0097620_100184087 3300006931 Bacteria 2172
100 Ga0099794_10022947 3300007265 Bacteria 2849
101 Ga0111539_10026788 3300009094 Bacteria 7044
102 Ga0111539_10215086 3300009094 Bacteria 2239
103 Ga0114129_10012744 3300009147 Bacteria 11970
104 Ga0114129_10013466 3300009147 Bacteria 11653
105 Ga0114129_10021903 3300009147 Bacteria 9071
106 Ga0114129_10030816 3300009147 Bacteria 7585
107 Ga0114129_10128793 3300009147 Bacteria 3478
108 Ga0114129_10211052 3300009147 Bacteria 2625
109 Ga0105243_10206417 3300009148 Unclassified 1727
110 Ga0105243_10420487 3300009148 Unclassified 1246
111 Ga0105248_10571768 3300009177 Unclassified 1275
112 Ga0105249_10018705 3300009553 Bacteria 6171
113 Ga0163162_10349540 3300013306 Bacteria 1611
114 Ga0157375_10242760 3300013308 Bacteria 1961
115 Ga0157375_10437040 3300013308 Bacteria 1474
116 Ga0157375_10937056 3300013308 Bacteria 1008
117 Ga0157380_10711131 3300014326 Unclassified 1011
118 Ga0207699_10083415 3300025906 Bacteria 1988
119 Ga0207684_10001391 3300025910 Bacteria 26317
120 Ga0207684_10027992 3300025910 Bacteria 4802
121 Ga0207684_10051018 3300025910 Bacteria 3509
122 Ga0207684_10357362 3300025910 Bacteria 1257
123 Ga0207684_10686652 3300025910 Bacteria 871
124 Ga0207646_10002289 3300025922 Bacteria 22751
125 Ga0207646_10120300 3300025922 Bacteria 2359
126 Ga0207709_10183801 3300025935 Bacteria 1479
127 Ga0207665_10011893 3300025939 Bacteria 5715
128 Ga0207665_10085547 3300025939 Bacteria 2177
129 Ga0207711_10941753 3300025941 Bacteria 802
130 Ga0207677_10090243 3300026023 Bacteria 2226
131 Ga0207641_10131663 3300026088 Bacteria 2246
132 Ga0207648_10205299 3300026089 Bacteria 1748
133 Ga0209588_1031506 3300027671 Bacteria 1697
134 Ga0207428_10009666 3300027907 Bacteria 8642
135 Ga0207428_10241799 3300027907 Bacteria 1348
136 Ga0316576_10413218 3300031727 Bacteria 999
137 Ga0373951_0016099 3300035091 Bacteria 1686
138 Ga0373961_0057660 3300035241 Bacteria 1169
139 Ga0395899_0076986 3300037312 Bacteria 2434
140 Ga0395905_0020817 3300037471 Bacteria 6211
141 Ga0436365_1274938 3300039437 Bacteria 2379
142 Ga0436362_0981525 3300039453 Bacteria 741
143 Ga0466963_0036184 3300044694 Bacteria 3219
144 Ga0466970_0043137 3300044765 Bacteria 2400
145 Ga0466960_0058846 3300044901 Bacteria 1878
146 Ga0451576_0018584 3300045051 Bacteria 7610
147 Ga0451576_0421922 3300045051 Unclassified 1399
148 Ga0451576_0780731 3300045051 Bacteria 1003
149 Ga0466967_0527839 3300045976 Bacteria 1160
150 Ga0495629_0173864 3300046459 Bacteria 1494
151 Ga0495629_0565986 3300046459 Bacteria 762
152 Ga0495641_0073631 3300046461 Bacteria 1532
153 Ga0495580_0008588 3300046472 Bacteria 8105
154 Ga0495630_0353210 3300046517 Bacteria 1125
155 Ga0495640_0213277 3300046533 Bacteria 1220
156 Ga0495656_0217298 3300046615 Unclassified 955
157 Ga0495611_0269778 3300046648 Bacteria 787
158 Ga0495659_0078072 3300046664 Unclassified 1252
159 Ga0495600_0311324 3300046809 Bacteria 992
160 Ga0495680_0057594 3300047322 Bacteria 3005
161 Ga0496104_0349110 3300048907 Bacteria 1392
162 Ga0496106_0595152 3300048909 Bacteria 886
163 Ga0496108_0150432 3300048911 Bacteria 2008
164 Ga0496108_0241541 3300048911 Bacteria 1571
165 Ga0496109_0204742 3300048912 Bacteria 1855
166 Ga0496109_0396015 3300048912 Bacteria 1305
167 Ga0496109_0857721 3300048912 Bacteria 846
168 Ga0496110_0186887 3300048913 Bacteria 1881
169 Ga0496114_0466037 3300048917 Bacteria 1118
170 Ga0496124_0098043 3300048927 Bacteria 2379
171 Ga0496126_0000027 3300048929 Bacteria 396518
172 Ga0501037_0341119 3300049573 Bacteria 1035
173 Ga0501040_0094173 3300049576 Bacteria 2084
174 Ga0501046_0129731 3300049580 Bacteria 1913
175 Ga0501048_0147756 3300049582 Bacteria 1662
176 Ga0501067_0097278 3300049583 Bacteria 1635
177 Ga0501071_0077264 3300049587 Bacteria 2432
178 Ga0501072_0002823 3300049588 Bacteria 13045
179 Ga0501072_0286055 3300049588 Bacteria 1311
180 Ga0501075_0117199 3300049591 Bacteria 2024
181 Ga0501076_0012863 3300049592 Bacteria 6262
182 Ga0501076_0616051 3300049592 Bacteria 895
183 Ga0501077_0044975 3300049593 Bacteria 2805
184 Ga0501077_0264821 3300049593 Bacteria 1093
185 Ga0501079_0155315 3300049741 Bacteria 1784
186 Ga0501080_0051800 3300049742 Bacteria 3821
187 Ga0501081_0166488 3300049743 Bacteria 1590
188 Ga0501045_0029204 3300049824 Bacteria 3984
189 Ga0501045_0435450 3300049824 Bacteria 975
190 nmdc:mga03n38_128806_c1 3300050490 Bacteria 1252
191 nmdc:mga03n38_45630_c1 3300050490 Bacteria 1931
192 nmdc:mga00v17_79697_c1 3300050491 Bacteria 2043
193 nmdc:mga00v17_8204_c1 3300050491 Bacteria 5614
194 nmdc:mga0yw44_148520_c1 3300050492 Bacteria 1528
195 nmdc:mga0yw44_557501_c1 3300050492 Bacteria 778
196 nmdc:mga07m45_91650_c1 3300050496 Bacteria 1741
197 nmdc:mga05p37_108146_c1 3300050507 Bacteria 3421
198 nmdc:mga05p37_17372_c1 3300050507 Bacteria 8680
199 nmdc:mga05p37_6642_c1 3300050507 Bacteria 13642
200 nmdc:mga05p37_683_c1 3300050507 Bacteria 37611
201 nmdc:mga09592_445_c1 3300050508 Bacteria 30603
202 nmdc:mga09592_4618_c1 3300050508 Bacteria 11154
203 nmdc:mga09592_81496_c1 3300050508 Bacteria 2757
204 nmdc:mga0qj67_143049_c1 3300050509 Bacteria 1939
205 nmdc:mga0qj67_1493_c1 3300050509 Bacteria 16406
206 nmdc:mga0qj67_170096_c1 3300050509 Bacteria 1769
207 nmdc:mga06r32_2459_c1 3300050510 Bacteria 16570
208 nmdc:mga06r32_38690_c1 3300050510 Bacteria 4521
209 nmdc:mga06r32_42915_c1 3300050510 Bacteria 4302
210 nmdc:mga06r32_74361_c1 3300050510 Bacteria 3294
211 nmdc:mga06r32_7855_c1 3300050510 Bacteria 9585
212 nmdc:mga08y16_162390_c1 3300050511 Bacteria 2321
213 nmdc:mga08y16_372042_c1 3300050511 Bacteria 1466
214 nmdc:mga0n895_147104_c1 3300050512 Unclassified 2386
215 nmdc:mga0n895_8276_c1 3300050512 Bacteria 8995
216 nmdc:mga0n895_837620_c1 3300050512 Bacteria 908
217 nmdc:mga0rr50_228552_c1 3300050513 Bacteria 1539
218 nmdc:mga08x19_308620_c1 3300050514 Bacteria 1100
219 nmdc:mga08x19_4556_c1 3300050514 Bacteria 8224
220 nmdc:mga08x19_6131_c1 3300050514 Bacteria 7110
221 nmdc:mga0a205_102136_c1 3300050515 Bacteria 2766
222 nmdc:mga0a205_2359_c1 3300050515 Bacteria 16652
223 nmdc:mga0a205_3803_c1 3300050515 Bacteria 13526
224 Ga0501084_0085929 3300054114 Bacteria 2641
225 Ga0501082_0496193 3300060353 Bacteria 1067
226 Ga0530510_0259743 3300061734 Bacteria 1295
227 Ga0530510_0737405 3300061734 Bacteria 751
228 Ga0068863_100473385
229 Ga0065707_10116093
230 Ga0070689_100474307
231 Ga0070691_10010216
232 Ga0070691_10036455
233 Ga0070671_100044707
234 Ga0070703_10117141
235 Ga0070701_10451660
236 Ga0070711_100064226
237 Ga0070705_100007127
238 Ga0070705_100266114
239 Ga0070705_100298772
240 Ga0070708_100005034
241 Ga0070708_100028754
242 Ga0070708_100062317
243 Ga0070708_100091375
244 Ga0070708_100115788
245 Ga0070708_100117608
246 Ga0070708_100413646
247 Ga0070708_100553939
248 Ga0070681_10559762
249 Ga0070706_100010348
250 Ga0070706_100080708
251 Ga0070706_100183853
252 Ga0070706_100204592
253 Ga0070706_100938859
254 Ga0070707_100021004
255 Ga0070707_100171751
256 Ga0070707_100726106
257 Ga0070698_100013416
258 Ga0070698_100013874
259 Ga0070698_100034206
260 Ga0070698_101130897
261 Ga0070699_100000041
262 Ga0070699_100005852
263 Ga0070699_100005931
264 Ga0070699_100009085
265 Ga0070699_100118822
266 Ga0070699_100292563
267 Ga0070699_100562167
268 Ga0070697_100102576
269 Ga0070697_100108440
270 Ga0070697_100512631
271 Ga0070697_100711121
272 Ga0070696_100062801
273 Ga0070696_100156542
274 Ga0070696_100339349
275 Ga0070704_100280611
276 Ga0070704_100526812
277 Ga0070704_100736243
278 Ga0068859_100184082
279 Ga0068866_10077126
280 Ga0068863_100119700
281 Ga0068860_100090922
282 Ga0068862_100544532
283 Ga0081455_10002726
284 Ga0081455_10046975
285 Ga0081455_10207230
286 Ga0081539_10000020
287 Ga0070717_10000370
288 Ga0075365_10024658
289 Ga0075368_10015700
290 Ga0075363_100002922
291 Ga0075363_100004980
292 Ga0075363_100144539
293 Ga0075364_10016397
294 Ga0075432_10117311
295 Ga0070716_100048677
296 Ga0075367_10019439
297 Ga0075367_10304824
298 Ga0075370_10087804
299 Ga0075428_100000420
300 Ga0075428_100013133
301 Ga0075428_100176714
302 Ga0075428_100450019
303 Ga0075428_100540335
304 Ga0075430_100000614
305 Ga0075430_100019407
306 Ga0075430_100174758
307 Ga0075430_100468211
308 Ga0075431_100000641
309 Ga0075431_100004922
310 Ga0075431_100077038
311 Ga0075431_100199771
312 Ga0075431_100209991
313 Ga0075431_100775302
314 Ga0075433_10002745
315 Ga0075433_10017494
316 Ga0075433_10050009
317 Ga0075433_10624668
318 Ga0075434_100068073
319 Ga0075434_100149431
320 Ga0075434_100173124
321 Ga0075434_100968448
322 Ga0075429_100000177
323 Ga0075429_100007105
324 Ga0075429_100122577
325 Ga0075436_100016002
326 Ga0097620_100184087
327 Ga0099794_10022947
328 Ga0111539_10026788
329 Ga0111539_10215086
330 Ga0114129_10012744
331 Ga0114129_10013466
332 Ga0114129_10021903
333 Ga0114129_10030816
334 Ga0114129_10128793
335 Ga0114129_10211052
336 Ga0105243_10206417
337 Ga0105243_10420487
338 Ga0105248_10571768
339 Ga0105249_10018705
340 Ga0163162_10349540
341 Ga0157375_10242760
342 Ga0157375_10437040
343 Ga0157375_10937056
344 Ga0157380_10711131
345 Ga0207699_10083415
346 Ga0207684_10001391
347 Ga0207684_10027992
348 Ga0207684_10051018
349 Ga0207684_10357362
350 Ga0207684_10686652
351 Ga0207646_10002289
352 Ga0207646_10120300
353 Ga0207709_10183801
354 Ga0207665_10011893
355 Ga0207665_10085547
356 Ga0207711_10941753
357 Ga0207677_10090243
358 Ga0207641_10131663
359 Ga0207648_10205299
360 Ga0209588_1031506
361 Ga0207428_10009666
362 Ga0207428_10241799
363 Ga0316576_10413218
364 Ga0373951_0016099
365 Ga0373961_0057660
366 Ga0395899_0076986
367 Ga0395905_0020817
368 Ga0436365_1274938
369 Ga0436362_0981525
370 Ga0466963_0036184
371 Ga0466970_0043137
372 Ga0466960_0058846
373 Ga0451576_0018584
374 Ga0451576_0421922
375 Ga0451576_0780731
376 Ga0466967_0527839
377 Ga0495629_0173864
378 Ga0495629_0565986
379 Ga0495641_0073631
380 Ga0495580_0008588
381 Ga0495630_0353210
382 Ga0495640_0213277
383 Ga0495656_0217298
384 Ga0495611_0269778
385 Ga0495659_0078072
386 Ga0495600_0311324
387 Ga0495680_0057594
388 Ga0496104_0349110
389 Ga0496106_0595152
390 Ga0496108_0150432
391 Ga0496108_0241541
392 Ga0496109_0204742
393 Ga0496109_0396015
394 Ga0496109_0857721
395 Ga0496110_0186887
396 Ga0496114_0466037
397 Ga0496124_0098043
398 Ga0496126_0000027
399 Ga0501037_0341119
400 Ga0501040_0094173
401 Ga0501046_0129731
402 Ga0501048_0147756
403 Ga0501067_0097278
404 Ga0501071_0077264
405 Ga0501072_0002823
406 Ga0501072_0286055
407 Ga0501075_0117199
408 Ga0501076_0012863
409 Ga0501076_0616051
410 Ga0501077_0044975
411 Ga0501077_0264821
412 Ga0501079_0155315
413 Ga0501080_0051800
414 Ga0501081_0166488
415 Ga0501045_0029204
416 Ga0501045_0435450
417 nmdc:mga03n38_128806_c1
418 nmdc:mga03n38_45630_c1
419 nmdc:mga00v17_79697_c1
420 nmdc:mga00v17_8204_c1
421 nmdc:mga0yw44_148520_c1
422 nmdc:mga0yw44_557501_c1
423 nmdc:mga07m45_91650_c1
424 nmdc:mga05p37_108146_c1
425 nmdc:mga05p37_17372_c1
426 nmdc:mga05p37_6642_c1
427 nmdc:mga05p37_683_c1
428 nmdc:mga09592_445_c1
429 nmdc:mga09592_4618_c1
430 nmdc:mga09592_81496_c1
431 nmdc:mga0qj67_143049_c1
432 nmdc:mga0qj67_1493_c1
433 nmdc:mga0qj67_170096_c1
434 nmdc:mga06r32_2459_c1
435 nmdc:mga06r32_38690_c1
436 nmdc:mga06r32_42915_c1
437 nmdc:mga06r32_74361_c1
438 nmdc:mga06r32_7855_c1
439 nmdc:mga08y16_162390_c1
440 nmdc:mga08y16_372042_c1
441 nmdc:mga0n895_147104_c1
442 nmdc:mga0n895_8276_c1
443 nmdc:mga0n895_837620_c1
444 nmdc:mga0rr50_228552_c1
445 nmdc:mga08x19_308620_c1
446 nmdc:mga08x19_4556_c1
447 nmdc:mga08x19_6131_c1
448 nmdc:mga0a205_102136_c1
449 nmdc:mga0a205_2359_c1
450 nmdc:mga0a205_3803_c1
451 Ga0501084_0085929
452 Ga0501082_0496193
453 Ga0530510_0259743
454 Ga0530510_0737405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

27

213

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gb5-assembly1.cif.gz_A-2 crystal structure of mus musculus iodotyrosine deiodinase (iyd) bound to fmn 0.8493 4 209
3e10-assembly1.cif.gz_A crystal structure of putative nadh oxidase (np_348178.1) from clostridium acetobutylicum at 1.40 a resolution 0.8436 6 214
3to0-assembly1.cif.gz_A crystal structure of mus musculus iodotyrosine deiodinase (iyd) c217a, c239a bound to fmn 0.8366 4 209
3e39-assembly1.cif.gz_B crystal structure of a putative nitroreductase in complex with fmn (dde_0787) from desulfovibrio desulfuricans subsp. at 1.70 a resolution 0.8353 1 207
3e10-assembly1.cif.gz_A crystal structure of putative nadh oxidase (np_348178.1) from clostridium acetobutylicum at 1.40 a resolution 0.8344 6 214
ID Description Score Start End Superfamily
3gb5A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8493 4 209 3.40.109.10
3e39B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8328 1 207 3.40.109.10
3e10B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8204 6 214 3.40.109.10
3e10B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8112 6 214 3.40.109.10
5uu6C00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8091 4 215 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A1Q7RXL2-F1-model_v4 Nitroreductase 0.9878 1 189 GO:0016491
AF-A0A1Q7SP62-F1-model_v4 Nitroreductase 0.9865 1 221 GO:0016491
AF-A0A5A7WRA7-F1-model_v4 Nitroreductase 0.9838 1 219 GO:0016491
AF-A0A3N0CPP9-F1-model_v4 Nitroreductase family protein 0.9836 1 219 GO:0016491
AF-A0A417XYC6-F1-model_v4 Nitroreductase 0.9831 1 218 GO:0016491

Map