F339611

General Info

Members Datasets Scaffolds Average Seq Length
227 165 454 189

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100177328|Ga0070668_1001773282
Length 229
Sequence MPGWLRSVNSGRLTSMRSSATLIGWIGNHQRERGRRQGEDDDRSRAVHAGPGQRGAGTEDGEKWTLILVRELRHSPDKVWQALTDPAHLREWAPFDADGSLGSVGTTVKLTTVGAPTPHVTEARVMRADAPKVLEYNWGDKDIRWELEALAGGTRLTLWHNIDRGFISMGAAGWHICFDVLDHLLSGTPIGRIVAGEAMNFGWPRLNSEYARQFGIEAPDRPSKAAQGS

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300001228 Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 5.29
Rhizosphere 90.75
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100177328 3300005347 Bacteria 1739
2 SwM_104063 3300001228 Bacteria 1131
3 Ga0068869_100134309 3300005334 Bacteria 1905
4 Ga0070666_10035824 3300005335 Bacteria 3291
5 Ga0070680_100129305 3300005336 Bacteria 2112
6 Ga0070671_100658126 3300005355 Bacteria 907
7 Ga0070673_100495150 3300005364 Bacteria 1105
8 Ga0070703_10007183 3300005406 Bacteria 3127
9 Ga0070709_10107490 3300005434 Bacteria 1870
10 Ga0070714_100354158 3300005435 Unclassified 1379
11 Ga0070713_100120194 3300005436 Bacteria 2303
12 Ga0070705_100056053 3300005440 Bacteria 2319
13 Ga0070700_100009715 3300005441 Bacteria 5287
14 Ga0070708_100075327 3300005445 Bacteria 3046
15 Ga0070708_100300151 3300005445 Bacteria 1512
16 Ga0070708_100755537 3300005445 Bacteria 914
17 Ga0070681_10081160 3300005458 Bacteria 3199
18 Ga0070681_10446052 3300005458 Bacteria 1206
19 Ga0068867_101321683 3300005459 Unclassified 666
20 Ga0070706_100022427 3300005467 Bacteria 5812
21 Ga0070706_100127320 3300005467 Bacteria 2375
22 Ga0070706_100171746 3300005467 Bacteria 2024
23 Ga0070707_100318097 3300005468 Bacteria 1512
24 Ga0070707_100360896 3300005468 Bacteria 1411
25 Ga0070698_100042183 3300005471 Bacteria 4680
26 Ga0070698_100102281 3300005471 Bacteria 2836
27 Ga0070698_100308788 3300005471 Bacteria 1512
28 Ga0070699_100042504 3300005518 Bacteria 3933
29 Ga0070679_101115727 3300005530 Bacteria 734
30 Ga0070697_100013062 3300005536 Bacteria 6509
31 Ga0070697_100060215 3300005536 Bacteria 3094
32 Ga0068853_100636028 3300005539 Bacteria 1015
33 Ga0070672_100313176 3300005543 Bacteria 1333
34 Ga0070686_100001182 3300005544 Bacteria 14832
35 Ga0070695_100246442 3300005545 Bacteria 1298
36 Ga0070696_100180339 3300005546 Bacteria 1566
37 Ga0070693_100000041 3300005547 Bacteria 49532
38 Ga0070693_100291297 3300005547 Bacteria 1097
39 Ga0070704_100012379 3300005549 Bacteria 5269
40 Ga0068854_100003545 3300005578 Bacteria 9756
41 Ga0068852_100209420 3300005616 Bacteria 1849
42 Ga0068859_100138829 3300005617 Bacteria 2504
43 Ga0068864_100225496 3300005618 Bacteria 1731
44 Ga0068863_100020528 3300005841 Bacteria 6315
45 Ga0068858_100089249 3300005842 Bacteria 2868
46 Ga0068858_100274767 3300005842 Bacteria 1604
47 Ga0068860_100000612 3300005843 Bacteria 42345
48 Ga0068860_100074408 3300005843 Bacteria 3230
49 Ga0068860_100253386 3300005843 Bacteria 1715
50 Ga0081455_10420624 3300005937 Bacteria 921
51 Ga0070712_100199035 3300006175 Bacteria 1572
52 Ga0097621_100201189 3300006237 Bacteria 1729
53 Ga0068871_100046325 3300006358 Bacteria 3502
54 Ga0075431_101277008 3300006847 Unclassified 695
55 Ga0075433_10126767 3300006852 Bacteria 2267
56 Ga0075433_10130385 3300006852 Bacteria 2233
57 Ga0075434_100197921 3300006871 Bacteria 2029
58 Ga0075434_101166727 3300006871 Bacteria 783
59 Ga0068865_100014987 3300006881 Bacteria 4936
60 Ga0075436_100736073 3300006914 Bacteria 732
61 Ga0097620_100138823 3300006931 Bacteria 2504
62 Ga0075435_100067656 3300007076 Bacteria 2909
63 Ga0105240_10001676 3300009093 Bacteria 37586
64 Ga0105240_10531001 3300009093 Bacteria 1304
65 Ga0111539_10339505 3300009094 Bacteria 1749
66 Ga0111539_10445546 3300009094 Bacteria 1508
67 Ga0105245_10251248 3300009098 Bacteria 1718
68 Ga0105247_10002912 3300009101 Bacteria 11391
69 Ga0114129_10073543 3300009147 Bacteria 4762
70 Ga0114129_10422586 3300009147 Bacteria 1753
71 Ga0105243_10072216 3300009148 Bacteria 2793
72 Ga0105241_10062088 3300009174 Bacteria 2880
73 Ga0105241_10308497 3300009174 Bacteria 1360
74 Ga0105242_10043492 3300009176 Bacteria 3633
75 Ga0105242_10088116 3300009176 Bacteria 2607
76 Ga0105248_10053715 3300009177 Bacteria 4520
77 Ga0105248_10131281 3300009177 Bacteria 2826
78 Ga0105248_10218897 3300009177 Bacteria 2144
79 Ga0105248_10236976 3300009177 Bacteria 2054
80 Ga0105246_10130471 3300011119 Bacteria 1876
81 Ga0105246_10288051 3300011119 Bacteria 1320
82 Ga0157370_10003161 3300013104 Bacteria 19488
83 Ga0157374_10037668 3300013296 Bacteria 4440
84 Ga0163162_10271196 3300013306 Bacteria 1829
85 Ga0157375_10006070 3300013308 Bacteria 10538
86 Ga0163163_10017128 3300014325 Bacteria 6750
87 Ga0163163_10020277 3300014325 Bacteria 6257
88 Ga0163163_10109779 3300014325 Bacteria 2786
89 Ga0157380_10516690 3300014326 Bacteria 1164
90 Ga0157379_10011151 3300014968 Bacteria 7835
91 Ga0157379_10018099 3300014968 Bacteria 6208
92 Ga0157379_10139691 3300014968 Bacteria 2184
93 Ga0157376_10333999 3300014969 Bacteria 1445
94 Ga0163161_10013122 3300017792 Bacteria 5759
95 Ga0213876_10202305 3300021384 Bacteria 1056
96 Ga0207697_10051140 3300025315 Bacteria 1707
97 Ga0207653_10007242 3300025885 Bacteria 3460
98 Ga0207688_10266340 3300025901 Bacteria 1041
99 Ga0207680_10033087 3300025903 Bacteria 2946
100 Ga0207699_10054993 3300025906 Bacteria 2367
101 Ga0207699_10333093 3300025906 Bacteria 1068
102 Ga0207684_10004424 3300025910 Bacteria 13237
103 Ga0207684_10015802 3300025910 Bacteria 6492
104 Ga0207684_10058713 3300025910 Bacteria 3265
105 Ga0207684_10093786 3300025910 Bacteria 2560
106 Ga0207684_10183912 3300025910 Bacteria 1802
107 Ga0207654_10319891 3300025911 Bacteria 1060
108 Ga0207654_10429534 3300025911 Bacteria 923
109 Ga0207707_10064044 3300025912 Bacteria 3200
110 Ga0207695_10002354 3300025913 Bacteria 28096
111 Ga0207693_10006092 3300025915 Bacteria 9989
112 Ga0207663_11077383 3300025916 Bacteria 646
113 Ga0207660_10099670 3300025917 Bacteria 2168
114 Ga0207662_10248715 3300025918 Bacteria 1166
115 Ga0207652_10477496 3300025921 Bacteria 1123
116 Ga0207646_10001256 3300025922 Bacteria 31771
117 Ga0207646_10121433 3300025922 Bacteria 2347
118 Ga0207646_10273677 3300025922 Bacteria 1526
119 Ga0207646_10497677 3300025922 Bacteria 1098
120 Ga0207681_10060387 3300025923 Bacteria 2602
121 Ga0207687_10192119 3300025927 Bacteria 1590
122 Ga0207700_10012981 3300025928 Bacteria 5398
123 Ga0207700_10076828 3300025928 Bacteria 2592
124 Ga0207700_10332358 3300025928 Bacteria 1319
125 Ga0207700_10580783 3300025928 Unclassified 996
126 Ga0207644_10023851 3300025931 Bacteria 4195
127 Ga0207644_10544858 3300025931 Bacteria 960
128 Ga0207706_10071155 3300025933 Bacteria 3059
129 Ga0207709_10054508 3300025935 Bacteria 2466
130 Ga0207669_10116736 3300025937 Bacteria 1802
131 Ga0207704_10031022 3300025938 Bacteria 3004
132 Ga0207691_10314384 3300025940 Bacteria 1344
133 Ga0207711_10049639 3300025941 Bacteria 3592
134 Ga0207711_10199226 3300025941 Bacteria 1827
135 Ga0207711_10573366 3300025941 Bacteria 1053
136 Ga0207689_10073036 3300025942 Bacteria 2818
137 Ga0207689_10216446 3300025942 Bacteria 1583
138 Ga0207667_10046598 3300025949 Bacteria 4591
139 Ga0207651_10448931 3300025960 Bacteria 1106
140 Ga0207640_10007410 3300025981 Bacteria 6054
141 Ga0207658_10135746 3300025986 Bacteria 1983
142 Ga0207703_10031220 3300026035 Bacteria 4211
143 Ga0207703_10323207 3300026035 Bacteria 1413
144 Ga0207639_10033909 3300026041 Bacteria 3770
145 Ga0207639_10181032 3300026041 Bacteria 1793
146 Ga0207708_10016006 3300026075 Bacteria 5631
147 Ga0207702_10022667 3300026078 Bacteria 5207
148 Ga0207641_10079647 3300026088 Bacteria 2840
149 Ga0207641_10110417 3300026088 Bacteria 2437
150 Ga0207676_10315638 3300026095 Bacteria 1433
151 Ga0207676_10348381 3300026095 Bacteria 1369
152 Ga0207698_10279884 3300026142 Bacteria 1542
153 Ga0207428_10510006 3300027907 Bacteria 873
154 Ga0268265_10301537 3300028380 Bacteria 1443
155 Ga0268264_10004474 3300028381 Bacteria 11925
156 Ga0268264_10062935 3300028381 Bacteria 3117
157 Ga0265316_10002427 3300031344 Bacteria 19369
158 Ga0265314_10001871 3300031711 Bacteria 22565
159 Ga0307416_100963896 3300032002 Bacteria 955
160 Ga0373934_0004587 3300035086 Bacteria 5105
161 Ga0373923_0024323 3300035111 Bacteria 2390
162 Ga0373953_0010834 3300035117 Bacteria 3184
163 Ga0373953_0051419 3300035117 Bacteria 1666
164 Ga0373954_0006650 3300035118 Bacteria 5046
165 Ga0373955_0013045 3300035172 Bacteria 4007
166 Ga0373935_0211151 3300035692 Bacteria 1345
167 Ga0373933_0058030 3300035724 Bacteria 2327
168 Ga0373937_0024666 3300036401 Bacteria 5426
169 Ga0373937_0258958 3300036401 Bacteria 1640
170 Ga0373937_1200159 3300036401 Bacteria 707
171 Ga0395905_0940746 3300037471 Bacteria 767
172 Ga0436364_0782790 3300037853 Bacteria 4560
173 Ga0436364_0901285 3300037853 Bacteria 2833
174 Ga0436365_1042841 3300039437 Bacteria 1451
175 Ga0436361_0811412 3300039447 Bacteria 4729
176 Ga0436362_0605859 3300039453 Bacteria 1148
177 Ga0439446_0016419 3300042156 Unclassified 2062
178 Ga0495580_0069639 3300046472 Bacteria 2458
179 Ga0495652_0254764 3300046529 Bacteria 1299
180 Ga0495586_0077540 3300046535 Bacteria 1822
181 Ga0495587_0003483 3300046536 Bacteria 10483
182 Ga0495587_0395721 3300046536 Bacteria 768
183 Ga0495645_0077528 3300046543 Bacteria 2389
184 Ga0495667_0059351 3300046559 Bacteria 2511
185 Ga0495635_0290470 3300046663 Bacteria 1097
186 Ga0495599_0241242 3300046678 Bacteria 1102
187 Ga0495658_0107886 3300046683 Bacteria 1671
188 Ga0495600_0050799 3300046809 Bacteria 2706
189 Ga0495684_0043065 3300047471 Bacteria 3456
190 Ga0496100_0642342 3300048903 Bacteria 826
191 Ga0496101_0074274 3300048904 Bacteria 2500
192 Ga0496102_0119394 3300048905 Bacteria 2462
193 Ga0496102_0124711 3300048905 Bacteria 2407
194 Ga0496103_0206982 3300048906 Bacteria 1262
195 Ga0496104_0004247 3300048907 Bacteria 12444
196 Ga0496108_0051939 3300048911 Bacteria 3434
197 Ga0496110_0034903 3300048913 Bacteria 4360
198 Ga0496112_0180856 3300048915 Bacteria 2073
199 Ga0496114_0002088 3300048917 Bacteria 15192
200 Ga0496114_0072513 3300048917 Bacteria 2896
201 Ga0496114_1170387 3300048917 Bacteria 655
202 Ga0496119_0242319 3300048922 Bacteria 913
203 Ga0496121_0039228 3300048924 Bacteria 4178
204 Ga0496125_0046008 3300048928 Bacteria 3666
205 Ga0496126_0064290 3300048929 Bacteria 3288
206 Ga0501043_0049498 3300049579 Bacteria 3304
207 Ga0501047_0007387 3300049581 Bacteria 10336
208 Ga0501048_0204778 3300049582 Unclassified 1399
209 Ga0501067_0112797 3300049583 Bacteria 1512
210 Ga0501070_0148001 3300049586 Bacteria 1938
211 Ga0501073_0069187 3300049589 Bacteria 2460
212 Ga0501074_0192000 3300049590 Unclassified 1456
213 Ga0501035_0010475 3300049822 Bacteria 8592
214 Ga0501044_0001670 3300049823 Bacteria 26059
215 Ga0501044_0004495 3300049823 Bacteria 15597
216 nmdc:mga05p37_51145_c1 3300050507 Bacteria 5082
217 nmdc:mga08y16_193003_c1 3300050511 Bacteria 2112
218 nmdc:mga08y16_483472_c1 3300050511 Bacteria 1260
219 nmdc:mga0n895_191300_c1 3300050512 Bacteria 2077
220 nmdc:mga0n895_66266_c1 3300050512 Bacteria 3576
221 nmdc:mga0rr50_138258_c1 3300050513 Bacteria 1957
222 nmdc:mga08x19_848829_c1 3300050514 Bacteria 649
223 nmdc:mga0a205_284786_c1 3300050515 Bacteria 1528
224 nmdc:mga0a205_40498_c1 3300050515 Bacteria 4485
225 nmdc:mga0a205_425131_c1 3300050515 Bacteria 1190
226 Ga0495595_0133490 3300053084 Bacteria 1215
227 Ga0500583_0131870 3300053092 Bacteria 1240
228 Ga0070668_100177328
229 SwM_104063
230 Ga0068869_100134309
231 Ga0070666_10035824
232 Ga0070680_100129305
233 Ga0070671_100658126
234 Ga0070673_100495150
235 Ga0070703_10007183
236 Ga0070709_10107490
237 Ga0070714_100354158
238 Ga0070713_100120194
239 Ga0070705_100056053
240 Ga0070700_100009715
241 Ga0070708_100075327
242 Ga0070708_100300151
243 Ga0070708_100755537
244 Ga0070681_10081160
245 Ga0070681_10446052
246 Ga0068867_101321683
247 Ga0070706_100022427
248 Ga0070706_100127320
249 Ga0070706_100171746
250 Ga0070707_100318097
251 Ga0070707_100360896
252 Ga0070698_100042183
253 Ga0070698_100102281
254 Ga0070698_100308788
255 Ga0070699_100042504
256 Ga0070679_101115727
257 Ga0070697_100013062
258 Ga0070697_100060215
259 Ga0068853_100636028
260 Ga0070672_100313176
261 Ga0070686_100001182
262 Ga0070695_100246442
263 Ga0070696_100180339
264 Ga0070693_100000041
265 Ga0070693_100291297
266 Ga0070704_100012379
267 Ga0068854_100003545
268 Ga0068852_100209420
269 Ga0068859_100138829
270 Ga0068864_100225496
271 Ga0068863_100020528
272 Ga0068858_100089249
273 Ga0068858_100274767
274 Ga0068860_100000612
275 Ga0068860_100074408
276 Ga0068860_100253386
277 Ga0081455_10420624
278 Ga0070712_100199035
279 Ga0097621_100201189
280 Ga0068871_100046325
281 Ga0075431_101277008
282 Ga0075433_10126767
283 Ga0075433_10130385
284 Ga0075434_100197921
285 Ga0075434_101166727
286 Ga0068865_100014987
287 Ga0075436_100736073
288 Ga0097620_100138823
289 Ga0075435_100067656
290 Ga0105240_10001676
291 Ga0105240_10531001
292 Ga0111539_10339505
293 Ga0111539_10445546
294 Ga0105245_10251248
295 Ga0105247_10002912
296 Ga0114129_10073543
297 Ga0114129_10422586
298 Ga0105243_10072216
299 Ga0105241_10062088
300 Ga0105241_10308497
301 Ga0105242_10043492
302 Ga0105242_10088116
303 Ga0105248_10053715
304 Ga0105248_10131281
305 Ga0105248_10218897
306 Ga0105248_10236976
307 Ga0105246_10130471
308 Ga0105246_10288051
309 Ga0157370_10003161
310 Ga0157374_10037668
311 Ga0163162_10271196
312 Ga0157375_10006070
313 Ga0163163_10017128
314 Ga0163163_10020277
315 Ga0163163_10109779
316 Ga0157380_10516690
317 Ga0157379_10011151
318 Ga0157379_10018099
319 Ga0157379_10139691
320 Ga0157376_10333999
321 Ga0163161_10013122
322 Ga0213876_10202305
323 Ga0207697_10051140
324 Ga0207653_10007242
325 Ga0207688_10266340
326 Ga0207680_10033087
327 Ga0207699_10054993
328 Ga0207699_10333093
329 Ga0207684_10004424
330 Ga0207684_10015802
331 Ga0207684_10058713
332 Ga0207684_10093786
333 Ga0207684_10183912
334 Ga0207654_10319891
335 Ga0207654_10429534
336 Ga0207707_10064044
337 Ga0207695_10002354
338 Ga0207693_10006092
339 Ga0207663_11077383
340 Ga0207660_10099670
341 Ga0207662_10248715
342 Ga0207652_10477496
343 Ga0207646_10001256
344 Ga0207646_10121433
345 Ga0207646_10273677
346 Ga0207646_10497677
347 Ga0207681_10060387
348 Ga0207687_10192119
349 Ga0207700_10012981
350 Ga0207700_10076828
351 Ga0207700_10332358
352 Ga0207700_10580783
353 Ga0207644_10023851
354 Ga0207644_10544858
355 Ga0207706_10071155
356 Ga0207709_10054508
357 Ga0207669_10116736
358 Ga0207704_10031022
359 Ga0207691_10314384
360 Ga0207711_10049639
361 Ga0207711_10199226
362 Ga0207711_10573366
363 Ga0207689_10073036
364 Ga0207689_10216446
365 Ga0207667_10046598
366 Ga0207651_10448931
367 Ga0207640_10007410
368 Ga0207658_10135746
369 Ga0207703_10031220
370 Ga0207703_10323207
371 Ga0207639_10033909
372 Ga0207639_10181032
373 Ga0207708_10016006
374 Ga0207702_10022667
375 Ga0207641_10079647
376 Ga0207641_10110417
377 Ga0207676_10315638
378 Ga0207676_10348381
379 Ga0207698_10279884
380 Ga0207428_10510006
381 Ga0268265_10301537
382 Ga0268264_10004474
383 Ga0268264_10062935
384 Ga0265316_10002427
385 Ga0265314_10001871
386 Ga0307416_100963896
387 Ga0373934_0004587
388 Ga0373923_0024323
389 Ga0373953_0010834
390 Ga0373953_0051419
391 Ga0373954_0006650
392 Ga0373955_0013045
393 Ga0373935_0211151
394 Ga0373933_0058030
395 Ga0373937_0024666
396 Ga0373937_0258958
397 Ga0373937_1200159
398 Ga0395905_0940746
399 Ga0436364_0782790
400 Ga0436364_0901285
401 Ga0436365_1042841
402 Ga0436361_0811412
403 Ga0436362_0605859
404 Ga0439446_0016419
405 Ga0495580_0069639
406 Ga0495652_0254764
407 Ga0495586_0077540
408 Ga0495587_0003483
409 Ga0495587_0395721
410 Ga0495645_0077528
411 Ga0495667_0059351
412 Ga0495635_0290470
413 Ga0495599_0241242
414 Ga0495658_0107886
415 Ga0495600_0050799
416 Ga0495684_0043065
417 Ga0496100_0642342
418 Ga0496101_0074274
419 Ga0496102_0119394
420 Ga0496102_0124711
421 Ga0496103_0206982
422 Ga0496104_0004247
423 Ga0496108_0051939
424 Ga0496110_0034903
425 Ga0496112_0180856
426 Ga0496114_0002088
427 Ga0496114_0072513
428 Ga0496114_1170387
429 Ga0496119_0242319
430 Ga0496121_0039228
431 Ga0496125_0046008
432 Ga0496126_0064290
433 Ga0501043_0049498
434 Ga0501047_0007387
435 Ga0501048_0204778
436 Ga0501067_0112797
437 Ga0501070_0148001
438 Ga0501073_0069187
439 Ga0501074_0192000
440 Ga0501035_0010475
441 Ga0501044_0001670
442 Ga0501044_0004495
443 nmdc:mga05p37_51145_c1
444 nmdc:mga08y16_193003_c1
445 nmdc:mga08y16_483472_c1
446 nmdc:mga0n895_191300_c1
447 nmdc:mga0n895_66266_c1
448 nmdc:mga0rr50_138258_c1
449 nmdc:mga08x19_848829_c1
450 nmdc:mga0a205_284786_c1
451 nmdc:mga0a205_40498_c1
452 nmdc:mga0a205_425131_c1
453 Ga0495595_0133490
454 Ga0500583_0131870

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

73

186

0.81

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

63

176

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8501 25 150
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8349 25 155
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8341 25 148
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8242 25 154
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8151 25 149
ID Description Score Start End Superfamily
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8229 22 148 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8209 27 151 3.30.530.20
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8039 27 154 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8023 25 146 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7947 25 144 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A3N5H1A8-F1-model_v4 SRPBCC family protein 0.9816 4 177
AF-A0A2V8FPE0-F1-model_v4 Polyketide cyclase 0.9708 1 147
AF-A0A2N7VIV1-F1-model_v4 Polyketide cyclase 0.9665 1 177
AF-A0A2V9UXS0-F1-model_v4 Polyketide cyclase 0.966 3 189
AF-A0A2V9XQP2-F1-model_v4 Polyketide cyclase 0.9657 1 180

Map