F339250

General Info

Members Datasets Scaffolds Average Seq Length
226 143 142 442

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0079930|Ga0496110_0079930_132_1493
Length 453
Sequence MKEIESKELQSWKDKYPLLNKLISTEEVFWINPNVEKFQTGIKKSPLTQEDVRDAEERLKRFAPYIAKVFPETKGTNGIIESPLVRIPAMKQSLEQDHQQPILGELLLKCDSHLPISGSIKARGGIYEILKHAEELAFQHQLLTIQDDYSILDSDRFRTLFSKYSIAVGSTGNLGLSIGIISAKLGFNVSVHMSADAKQWKKDLLRSKNVNVIEYEADYSKAVEEGRIQADSDPTCYFVDDENSHDLFLGYAVAASRLKKQLEELEIIVDENHPLFVYLPCGVGGGPGGVAFGLKLMYQDHIHCFFAEPTHSPCMLLGLMTGLHDKVSVQDVGIDNVTDADGLAVGKPSGFVGKTMEPFLSGNYTVSDEQLYKLLKELVDTEGIHLEPSALAGMIGPSKLCKEGIDYLQKHHLTEKMSNGTHIIWGTGGSMVPEEMMKQYYQKGLKIALEKQK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
3 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
4 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
5 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
6 2643221729 Bacillus sp. Root11 Isolate Unclassified
7 2643221730 Bacillus sp. Root131 Isolate Unclassified
8 2643221731 Bacillus sp. Root147 Isolate Unclassified
9 2643221732 Bacillus sp. Root239 Isolate Unclassified
10 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
11 2684622632 Bacillus cereus 905 Isolate Unclassified
12 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
13 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
14 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
15 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
16 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
17 2738541358 Bacillus sp. OV752 Isolate Unclassified
18 2738543006 Bacillus sp. OK077 Isolate Unclassified
19 2738543010 Bacillus sp. YR335 Isolate Unclassified
20 2738543017 Bacillus sp. OV186 Isolate Unclassified
21 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
22 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
23 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
24 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
25 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
26 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
27 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
28 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
29 2842682962 Bacillus sp. R-72492 Isolate Unclassified
30 2842882022 Bacillus sp. R-71893 Isolate Unclassified
31 2849139964 Bacillus sp. R-71875 Isolate Unclassified
32 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
33 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
34 2857581216 Bacillus sp. R-71922 Isolate Unclassified
35 2857586860 Bacillus sp. R-71935 Isolate Unclassified
36 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
37 2860837431 Bacillus sp. WR11 Isolate Unclassified
38 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
39 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
40 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
41 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
42 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
43 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
44 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
45 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
46 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
47 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
48 2919720352 Priestia megaterium 4340 Isolate Unclassified
49 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
50 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
51 2929004312 Priestia megaterium 1104 Isolate Unclassified
52 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
53 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
54 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
55 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
56 2938917290 Bacillus sp. CR71 Isolate Unclassified
57 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
58 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
59 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
60 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
61 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
62 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
63 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
64 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
65 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
66 2965761152 Bacillus sp. COPE52 Isolate Unclassified
67 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
68 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
69 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
70 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
71 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
72 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
73 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
74 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
75 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
76 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
77 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
78 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
99 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
101 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
102 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
108 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
127 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
135 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
136 8022653035 Bacillus sp. Rc4 Isolate Unclassified
137 8022792930 Bacillus sp. Xin Isolate Rhizosphere
138 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
139 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
140 8023438354 Bacillus sp. BH2 Isolate Unclassified
141 8023444577 Bacillus sp. BH32 Isolate Unclassified
142 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
143 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 62.39
Metatranscriptomes 0.44
Isolates 37.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.7
Nodule 1.77
Rhizoplane 10.18
Rhizosphere 38.05
Stem 0
Stem Tuber 0.44
Unclassified 31.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3417257 2162886007 Bacteria 4309
2 JGI25151J46595_10000375 3300003187 Bacteria 46716
3 JGI25151J46595_10001327 3300003187 Bacteria 17307
4 JGI25151J46595_10002476 3300003187 Bacteria 11058
5 JGI25151J46595_10002980 3300003187 Bacteria 9663
6 JGI25151J46595_10007420 3300003187 Bacteria 5377
7 JGI25151J46595_10008156 3300003187 Bacteria 5065
8 JGI25151J46595_10010586 3300003187 Bacteria 4274
9 JGI25151J46595_10012263 3300003187 Bacteria 3904
10 JGI25151J46595_10014359 3300003187 Bacteria 3530
11 JGI25151J46595_10028969 3300003187 Bacteria 2199
12 JGI25151J46595_10036645 3300003187 Bacteria 1848
13 JGI25151J46595_10041947 3300003187 Bacteria 1655
14 rootH1_10000833 3300003316 Bacteria 28864
15 rootL2_10206520 3300003322 Bacteria 8221
16 Ga0006562J51391_1013371 3300003578 Bacteria 1490
17 Ga0055532_1000030 3300003758 Bacteria 232738
18 Ga0055532_1003181 3300003758 Bacteria 2942
19 Ga0055528_1011126 3300003790 Bacteria 3602
20 Ga0058692_1000025 3300003856 Bacteria 217356
21 Ga0058692_1016916 3300003856 Bacteria 1609
22 Ga0075364_10006449 3300006051 Bacteria 6892
23 Ga0079104_1000122 3300006946 Bacteria 111219
24 Ga0105251_10001409 3300009011 Bacteria 20711
25 Ga0105244_10000036 3300009036 Bacteria 166889
26 Ga0105244_10000887 3300009036 Bacteria 25375
27 Ga0105244_10005053 3300009036 Bacteria 8875
28 Ga0105244_10005478 3300009036 Bacteria 8430
29 Ga0105250_10000139 3300009092 Bacteria 63069
30 Ga0105250_10000681 3300009092 Bacteria 21336
31 Ga0105250_10004378 3300009092 Bacteria 6504
32 Ga0105250_10006697 3300009092 Bacteria 5008
33 Ga0105250_10015610 3300009092 Bacteria 3109
34 Ga0105250_10023597 3300009092 Bacteria 2479
35 Ga0105250_10026740 3300009092 Bacteria 2325
36 Ga0105250_10030463 3300009092 Bacteria 2169
37 Ga0105246_10012584 3300011119 Bacteria 5284
38 Ga0105246_10039487 3300011119 Bacteria 3180
39 Ga0157371_10046728 3300013102 Bacteria 3079
40 Ga0157371_10046834 3300013102 Bacteria 3074
41 Ga0157374_10013092 3300013296 Bacteria 7234
42 Ga0157372_10034387 3300013307 Bacteria 5571
43 Ga0157377_10063088 3300014745 Bacteria 2122
44 Ga0213876_10000049 3300021384 Bacteria 145629
45 Ga0209147_100065 3300025229 Bacteria 232777
46 Ga0209147_100730 3300025229 Bacteria 16424
47 Ga0209147_100887 3300025229 Bacteria 13751
48 Ga0209147_100888 3300025229 Bacteria 13736
49 Ga0209673_1002475 3300025273 Bacteria 12773
50 Ga0209130_1000918 3300025284 Bacteria 23704
51 Ga0209130_1003452 3300025284 Bacteria 6696
52 Ga0209676_1001154 3300025292 Bacteria 28863
53 Ga0209025_1000164 3300025294 Bacteria 165351
54 Ga0209025_1000236 3300025294 Bacteria 129742
55 Ga0209025_1000621 3300025294 Bacteria 62957
56 Ga0209025_1001042 3300025294 Bacteria 40725
57 Ga0209025_1001465 3300025294 Bacteria 30804
58 Ga0209025_1001920 3300025294 Bacteria 24098
59 Ga0209025_1001978 3300025294 Bacteria 23531
60 Ga0209025_1002823 3300025294 Bacteria 17485
61 Ga0209025_1003399 3300025294 Bacteria 15142
62 Ga0209025_1003432 3300025294 Bacteria 15026
63 Ga0209025_1004829 3300025294 Bacteria 11389
64 Ga0209025_1007923 3300025294 Bacteria 7776
65 Ga0209025_1009120 3300025294 Bacteria 6981
66 Ga0209025_1009231 3300025294 Bacteria 6914
67 Ga0209025_1033803 3300025294 Bacteria 2353
68 Ga0207696_1000199 3300025711 Bacteria 92674
69 Ga0207696_1000894 3300025711 Bacteria 18496
70 Ga0207696_1001027 3300025711 Bacteria 16668
71 Ga0207696_1001771 3300025711 Bacteria 11138
72 Ga0207696_1003163 3300025711 Bacteria 7644
73 Ga0207696_1003843 3300025711 Bacteria 6667
74 Ga0207696_1011360 3300025711 Bacteria 3212
75 Ga0207655_1000067 3300025728 Bacteria 245484
76 Ga0207655_1000099 3300025728 Bacteria 188494
77 Ga0207655_1001522 3300025728 Bacteria 21106
78 Ga0207655_1001658 3300025728 Bacteria 19719
79 Ga0207655_1010298 3300025728 Bacteria 5679
80 Ga0207655_1015807 3300025728 Bacteria 4169
81 Ga0207713_1001515 3300025735 Bacteria 18324
82 Ga0207713_1008565 3300025735 Bacteria 5869
83 Ga0207713_1027703 3300025735 Bacteria 2569
84 Ga0209281_1000031 3300027111 Bacteria 422772
85 Ga0209281_1014392 3300027111 Bacteria 1676
86 Ga0209371_1000036 3300027312 Bacteria 367250
87 Ga0237817_10170 3300030083 Bacteria 18615
88 Ga0237817_10341 3300030083 Bacteria 8753
89 Ga0268256_1000040 3300030500 Bacteria 348002
90 Ga0237819_00070 3300038705 Bacteria 37316
91 Ga0436365_0245969 3300039437 Bacteria 378821
92 Ga0439438_000694 3300041405 Bacteria 15028
93 Ga0439438_019468 3300041405 Bacteria 1918
94 Ga0451576_0041030 3300045051 Bacteria 4894
95 Ga0466967_0083946 3300045976 Bacteria 2881
96 Ga0466967_0132321 3300045976 Bacteria 2317
97 Ga0495627_005002 3300046453 Bacteria 5435
98 Ga0495654_0018948 3300046530 Bacteria 3601
99 Ga0495625_0006984 3300046660 Bacteria 9953
100 Ga0495679_000016 3300047446 Bacteria 282024
101 Ga0496100_0006322 3300048903 Bacteria 6454
102 Ga0496100_0033771 3300048903 Bacteria 3203
103 Ga0496101_0001956 3300048904 Bacteria 12480
104 Ga0496101_0008637 3300048904 Bacteria 6659
105 Ga0496102_0005070 3300048905 Bacteria 11152
106 Ga0496102_0026697 3300048905 Bacteria 5153
107 Ga0496103_0001604 3300048906 Bacteria 14862
108 Ga0496104_0019734 3300048907 Bacteria 6172
109 Ga0496105_0021147 3300048908 Bacteria 5262
110 Ga0496105_0183260 3300048908 Bacteria 1714
111 Ga0496106_0000428 3300048909 Bacteria 29919
112 Ga0496107_0000189 3300048910 Bacteria 31975
113 Ga0496108_0000470 3300048911 Bacteria 32280
114 Ga0496109_0049211 3300048912 Bacteria 3836
115 Ga0496110_0003973 3300048913 Bacteria 11385
116 Ga0496110_0079930 3300048913 Bacteria 2912
117 Ga0496111_0017147 3300048914 Bacteria 5001
118 Ga0496111_0026275 3300048914 Bacteria 4110
119 Ga0496112_0007976 3300048915 Bacteria 9443
120 Ga0496112_0053156 3300048915 Bacteria 3977
121 Ga0496112_0086872 3300048915 Bacteria 3094
122 Ga0496116_0007236 3300048919 Bacteria 9894
123 Ga0496116_0011484 3300048919 Bacteria 7321
124 Ga0496116_0031080 3300048919 Bacteria 3829
125 Ga0496118_0009380 3300048921 Bacteria 9900
126 Ga0496119_0000942 3300048922 Bacteria 37503
127 Ga0496119_0044346 3300048922 Bacteria 2801
128 Ga0496120_0002455 3300048923 Bacteria 18688
129 Ga0496122_0000441 3300048925 Bacteria 87041
130 Ga0496122_0008403 3300048925 Bacteria 11151
131 Ga0496122_0017755 3300048925 Bacteria 6624
132 Ga0496122_0029272 3300048925 Bacteria 4649
133 Ga0496123_0000342 3300048926 Bacteria 87798
134 Ga0496123_0002887 3300048926 Bacteria 20137
135 Ga0496123_0043702 3300048926 Bacteria 3074
136 Ga0496124_0022700 3300048927 Bacteria 5746
137 Ga0496125_0000287 3300048928 Bacteria 99911
138 Ga0496125_0003491 3300048928 Bacteria 18994
139 Ga0496125_0005258 3300048928 Bacteria 14494
140 Ga0496126_0001327 3300048929 Bacteria 39329
141 Ga0496126_0005864 3300048929 Bacteria 13856
142 nmdc:mga00v17_23533_c1 3300050491 Bacteria 3563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2711768088 2712199399 383
2 3300045976 Ga0466967_0132321 Ga0466967_0132321_658_1929 409
3 3300003316 rootH1_10000833 rootH1_1000083325 411
4 3300003322 rootL2_10206520 rootL2_102065206 411
5 3300003578 Ga0006562J51391_1013371 Ga0006562J51391_10133711 411
6 3300003758 Ga0055532_1003181 Ga0055532_10031812 417
7 3300009036 Ga0105244_10005053 Ga0105244_100050536 417
8 3300025229 Ga0209147_100730 Ga0209147_10073015 417
9 3300025294 Ga0209025_1001465 Ga0209025_100146524 417
10 3300025728 Ga0207655_1001522 Ga0207655_100152215 417
11 3300003790 Ga0055528_1011126 Ga0055528_10111264 418
12 3300011119 Ga0105246_10039487 Ga0105246_100394872 418
13 3300025273 Ga0209673_1002475 Ga0209673_100247518 418
14 3300025294 Ga0209025_1002823 Ga0209025_100282313 418
15 3300025711 Ga0207696_1003163 Ga0207696_10031635 418
16 3300048903 Ga0496100_0006322 Ga0496100_0006322_1908_3263 418
17 3300048904 Ga0496101_0008637 Ga0496101_0008637_3192_4547 418
18 3300048905 Ga0496102_0026697 Ga0496102_0026697_3344_4699 418
19 3300048908 Ga0496105_0021147 Ga0496105_0021147_3559_4914 418
20 3300048909 Ga0496106_0000428 Ga0496106_0000428_7150_8505 418
21 3300048910 Ga0496107_0000189 Ga0496107_0000189_21718_23073 418
22 3300048911 Ga0496108_0000470 Ga0496108_0000470_8258_9613 418
23 3300048912 Ga0496109_0049211 Ga0496109_0049211_2379_3734 418
24 3300048914 Ga0496111_0017147 Ga0496111_0017147_3192_4547 418
25 3300048915 Ga0496112_0007976 Ga0496112_0007976_5710_7065 418
26 3300048919 Ga0496116_0007236 Ga0496116_0007236_5302_6657 418
27 3300048922 Ga0496119_0044346 Ga0496119_0044346_105_1460 418
28 3300048926 Ga0496123_0043702 Ga0496123_0043702_1516_2871 418
29 3300048928 Ga0496125_0003491 Ga0496125_0003491_7751_9106 418
30 3300048929 Ga0496126_0005864 Ga0496126_0005864_8243_9598 418
31 3300014745 Ga0157377_10063088 Ga0157377_100630881 419
32 iso_pu_bacteria 8002745576 8002747793 420
33 iso_pu_bacteria 2900051742 2900053833 421
34 iso_pu_bacteria 2884086401 2884086482 422
35 iso_pu_bacteria 2939573065 2939577015 422
36 iso_pu_bacteria 2852673933 2852676508 423
37 iso_pu_bacteria 2928510474 2928513195 423
38 iso_pu_bacteria 2816332186 2816864594 424
39 iso_pu_bacteria 2842682962 2842683423 424
40 iso_pu_bacteria 2849139964 2849144095 424
41 iso_pu_bacteria 2857581216 2857581335 424
42 iso_pu_bacteria 2891670763 2891674230 424
43 3300003856 Ga0058692_1016916 Ga0058692_10169161 425
44 3300013102 Ga0157371_10046728 Ga0157371_100467282 425
45 3300013307 Ga0157372_10034387 Ga0157372_100343872 425
46 3300041405 Ga0439438_019468 Ga0439438_019468_64_1386 425
47 iso_pu_bacteria 2643221729 2644704234 425
48 iso_pu_bacteria 2643221730 2644708928 425
49 iso_pu_bacteria 2684622632 2685149659 425
50 iso_pu_bacteria 2695420987 2698323518 425
51 iso_pu_bacteria 2718218445 2721505034 425
52 iso_pu_bacteria 2738543017 2739271298 425
53 iso_pu_bacteria 2818991443 2819579192 425
54 iso_pu_bacteria 2857586860 2857589986 425
55 iso_pu_bacteria 2881644220 2881647044 425
56 iso_pu_bacteria 2929233124 2929234931 425
57 iso_pu_bacteria 2938917290 2938919107 425
58 iso_pu_bacteria 2947426588 2947428477 425
59 iso_pu_bacteria 8022621104 8022622922 425
60 iso_pu_bacteria 8023444577 8023448197 425
61 3300003187 JGI25151J46595_10036645 JGI25151J46595_100366452 426
62 3300006946 Ga0079104_1000122 Ga0079104_100012277 426
63 3300009036 Ga0105244_10000036 Ga0105244_1000003622 426
64 3300009092 Ga0105250_10000139 Ga0105250_1000013943 426
65 3300025294 Ga0209025_1033803 Ga0209025_10338031 426
66 3300025711 Ga0207696_1000199 Ga0207696_100019943 426
67 3300025728 Ga0207655_1000099 Ga0207655_1000099142 426
68 3300027111 Ga0209281_1000031 Ga0209281_100003145 426
69 3300048925 Ga0496122_0029272 Ga0496122_0029272_2383_3705 426
70 3300048927 Ga0496124_0022700 Ga0496124_0022700_1041_2363 426
71 3300048928 Ga0496125_0000287 Ga0496125_0000287_74281_75603 426
72 iso_pu_bacteria 2609459761 2609910900 426
73 iso_pu_bacteria 2945874760 2945875267 426
74 iso_pu_bacteria 2965761152 2965762966 426
75 iso_pu_bacteria 2979083700 2979085396 426
76 iso_pu_bacteria 3001892409 3001892774 426
77 iso_pu_bacteria 8023438354 8023442207 426
78 3300025294 Ga0209025_1001920 Ga0209025_10019209 427
79 iso_pu_bacteria 2593339131 2595091110 427
80 iso_pu_bacteria 2703719227 2705993658 427
81 iso_pu_bacteria 2738541299 2738839721 427
82 iso_pu_bacteria 2738541358 2739158590 427
83 iso_pu_bacteria 2738543006 2739211072 427
84 iso_pu_bacteria 2757320391 2757566400 427
85 iso_pu_bacteria 2775507177 2777764298 427
86 iso_pu_bacteria 2775507192 2777836101 427
87 iso_pu_bacteria 2936340661 2936342242 427
88 iso_pu_bacteria 8022792930 8022794623 427
89 iso_pu_bacteria 8057733483 8057738300 427
90 3300009011 Ga0105251_10001409 Ga0105251_1000140918 428
91 3300009092 Ga0105250_10030463 Ga0105250_100304631 428
92 3300013102 Ga0157371_10046834 Ga0157371_100468344 428
93 3300025711 Ga0207696_1001771 Ga0207696_10017716 428
94 3300025711 Ga0207696_1003843 Ga0207696_10038435 428
95 3300025735 Ga0207713_1008565 Ga0207713_10085652 428
96 3300027111 Ga0209281_1014392 Ga0209281_10143922 428
97 3300041405 Ga0439438_000694 Ga0439438_000694_6228_7529 428
98 3300046453 Ga0495627_005002 Ga0495627_005002_404_1747 428
99 3300046530 Ga0495654_0018948 Ga0495654_0018948_1936_3264 428
100 3300046660 Ga0495625_0006984 Ga0495625_0006984_2798_4126 428
101 3300047446 Ga0495679_000016 Ga0495679_000016_25880_27208 428
102 3300048921 Ga0496118_0009380 Ga0496118_0009380_2170_3498 428
103 3300048922 Ga0496119_0000942 Ga0496119_0000942_21381_22709 428
104 3300048923 Ga0496120_0002455 Ga0496120_0002455_2175_3503 428
105 3300048929 Ga0496126_0001327 Ga0496126_0001327_14226_15512 428
106 iso_pu_bacteria 2512564013 2512638564 428
107 iso_pu_bacteria 2808606399 2809056008 428
108 iso_pu_bacteria 2857465823 2857467533 428
109 iso_pu_bacteria 2860837431 2860839999 428
110 iso_pu_bacteria 2936361878 2936365994 428
111 iso_pu_bacteria 2962290636 2962293272 428
112 iso_pu_bacteria 2969136845 2969139284 428
113 iso_pu_bacteria 2969770375 2969773436 428
114 iso_pu_bacteria 2980492589 2980495038 428
115 iso_pu_bacteria 8022653035 8022654164 428
116 3300009036 Ga0105244_10005478 Ga0105244_100054787 429
117 3300025229 Ga0209147_100888 Ga0209147_1008882 429
118 3300025294 Ga0209025_1009120 Ga0209025_10091207 429
119 3300025728 Ga0207655_1015807 Ga0207655_10158075 429
120 3300030083 Ga0237817_10341 Ga0237817_103419 429
121 3300038705 Ga0237819_00070 Ga0237819_00070_22906_24237 429
122 3300045051 Ga0451576_0041030 Ga0451576_0041030_305_1630 429
123 3300045976 Ga0466967_0083946 Ga0466967_0083946_1099_2430 429
124 3300048919 Ga0496116_0031080 Ga0496116_0031080_2461_3792 429
125 3300048925 Ga0496122_0017755 Ga0496122_0017755_941_2272 429
126 3300048926 Ga0496123_0002887 Ga0496123_0002887_10049_11380 429
127 iso_pu_bacteria 2791354903 2791924198 429
128 iso_pu_bacteria 2818991465 2819707655 429
129 iso_pu_bacteria 2919414237 2919418427 429
130 iso_pu_bacteria 2928093941 2928099270 429
131 iso_pu_bacteria 2929004312 2929010253 429
132 iso_pu_bacteria 2939568625 2939571927 429
133 iso_pu_bacteria 2939642701 2939646244 429
134 iso_pu_bacteria 2960319331 2960323717 429
135 3300003187 JGI25151J46595_10008156 JGI25151J46595_100081566 430
136 3300003187 JGI25151J46595_10012263 JGI25151J46595_100122633 430
137 3300003187 JGI25151J46595_10014359 JGI25151J46595_100143594 430
138 3300003856 Ga0058692_1000025 Ga0058692_100002521 430
139 3300009036 Ga0105244_10000887 Ga0105244_1000088723 430
140 3300009092 Ga0105250_10000681 Ga0105250_1000068123 430
141 3300009092 Ga0105250_10006697 Ga0105250_100066972 430
142 3300021384 Ga0213876_10000049 Ga0213876_10000049121 430
143 3300025294 Ga0209025_1000164 Ga0209025_1000164141 430
144 3300025711 Ga0207696_1000894 Ga0207696_10008942 430
145 3300025728 Ga0207655_1001658 Ga0207655_100165813 430
146 3300027312 Ga0209371_1000036 Ga0209371_100003621 430
147 3300030083 Ga0237817_10170 Ga0237817_101709 430
148 3300030500 Ga0268256_1000040 Ga0268256_1000040298 430
149 3300039437 Ga0436365_0245969 Ga0436365_0245969_308280_309614 430
150 3300048925 Ga0496122_0000441 Ga0496122_0000441_22149_23483 430
151 3300048926 Ga0496123_0000342 Ga0496123_0000342_63534_64868 430
152 3300003187 JGI25151J46595_10028969 JGI25151J46595_100289692 431
153 3300003187 JGI25151J46595_10041947 JGI25151J46595_100419471 431
154 3300003758 Ga0055532_1000030 Ga0055532_100003074 431
155 3300009092 Ga0105250_10015610 Ga0105250_100156102 431
156 3300025229 Ga0209147_100065 Ga0209147_10006574 431
157 3300025284 Ga0209130_1000918 Ga0209130_10009184 431
158 3300025294 Ga0209025_1007923 Ga0209025_10079235 431
159 3300025294 Ga0209025_1009231 Ga0209025_10092316 431
160 iso_pu_bacteria 2510917027 2511177397 431
161 iso_pu_bacteria 2915597211 2915601182 431
162 iso_pu_bacteria 2915606848 2915607431 431
163 3300048928 Ga0496125_0005258 Ga0496125_0005258_2056_3468 432
164 iso_pu_bacteria 2671180330 2672336103 432
165 iso_pu_bacteria 2738543010 2739232786 432
166 iso_pu_bacteria 2842882022 2842882292 432
167 iso_pu_bacteria 2857604169 2857605325 432
168 iso_pu_bacteria 2904524088 2904527048 432
169 iso_pu_bacteria 2919143609 2919144361 432
170 iso_pu_bacteria 2919517244 2919519557 432
171 iso_pu_bacteria 2928093941 2928095557 432
172 iso_pu_bacteria 2929206907 2929209589 432
173 iso_pu_bacteria 2956897341 2956898235 432
174 iso_pu_bacteria 8057582654 8057584433 432
175 2162886007 SwRhRL2b_contig_3417257 SwRhRL2b_0823.00002700 433
176 3300003187 JGI25151J46595_10000375 JGI25151J46595_1000037523 433
177 3300003187 JGI25151J46595_10001327 JGI25151J46595_1000132712 433
178 3300003187 JGI25151J46595_10002476 JGI25151J46595_100024762 433
179 3300003187 JGI25151J46595_10002980 JGI25151J46595_100029803 433
180 3300003187 JGI25151J46595_10007420 JGI25151J46595_100074205 433
181 3300003187 JGI25151J46595_10010586 JGI25151J46595_100105863 433
182 3300006051 Ga0075364_10006449 Ga0075364_100064496 433
183 3300009092 Ga0105250_10004378 Ga0105250_100043782 433
184 3300009092 Ga0105250_10023597 Ga0105250_100235973 433
185 3300009092 Ga0105250_10026740 Ga0105250_100267402 433
186 3300011119 Ga0105246_10012584 Ga0105246_100125844 433
187 3300013296 Ga0157374_10013092 Ga0157374_100130926 433
188 3300025229 Ga0209147_100887 Ga0209147_10088717 433
189 3300025284 Ga0209130_1003452 Ga0209130_10034523 433
190 3300025292 Ga0209676_1001154 Ga0209676_10011543 433
191 3300025294 Ga0209025_1000236 Ga0209025_100023670 433
192 3300025294 Ga0209025_1000621 Ga0209025_10006216 433
193 3300025294 Ga0209025_1001042 Ga0209025_100104231 433
194 3300025294 Ga0209025_1001978 Ga0209025_10019785 433
195 3300025294 Ga0209025_1003399 Ga0209025_10033999 433
196 3300025294 Ga0209025_1003432 Ga0209025_10034329 433
197 3300025294 Ga0209025_1004829 Ga0209025_100482910 433
198 3300025711 Ga0207696_1001027 Ga0207696_100102713 433
199 3300025711 Ga0207696_1011360 Ga0207696_10113601 433
200 3300025728 Ga0207655_1000067 Ga0207655_100006768 433
201 3300025728 Ga0207655_1010298 Ga0207655_10102984 433
202 3300025735 Ga0207713_1001515 Ga0207713_100151510 433
203 3300025735 Ga0207713_1027703 Ga0207713_10277033 433
204 3300048903 Ga0496100_0033771 Ga0496100_0033771_1157_2500 433
205 3300048904 Ga0496101_0001956 Ga0496101_0001956_3276_4619 433
206 3300048905 Ga0496102_0005070 Ga0496102_0005070_1948_3291 433
207 3300048906 Ga0496103_0001604 Ga0496103_0001604_785_2128 433
208 3300048907 Ga0496104_0019734 Ga0496104_0019734_3882_5225 433
209 3300048908 Ga0496105_0183260 Ga0496105_0183260_163_1506 433
210 3300048913 Ga0496110_0003973 Ga0496110_0003973_1054_2397 433
211 3300048913 Ga0496110_0079930 Ga0496110_0079930_132_1493 433
212 3300048914 Ga0496111_0026275 Ga0496111_0026275_1098_2441 433
213 3300048915 Ga0496112_0053156 Ga0496112_0053156_935_2278 433
214 3300048915 Ga0496112_0086872 Ga0496112_0086872_1684_3036 433
215 3300048919 Ga0496116_0011484 Ga0496116_0011484_450_1751 433
216 3300048925 Ga0496122_0008403 Ga0496122_0008403_1948_3291 433
217 3300050491 nmdc:mga00v17_23533_c1 nmdc:mga00v17_23533_c1_339_1640 433
218 iso_pu_bacteria 2643221731 2644718249 433
219 iso_pu_bacteria 2643221732 2644725129 433
220 iso_pu_bacteria 2818991465 2819707385 433
221 iso_pu_bacteria 2919720352 2919720688 433
222 iso_pu_bacteria 2929004312 2929008201 433
223 iso_pu_bacteria 2960319331 2960322732 433
224 iso_pu_bacteria 2960375949 2960377742 433
225 iso_pu_bacteria 8022893055 8022897013 433
226 iso_pu_bacteria 8022914991 8022918309 433

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

75

405

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ss9-assembly1.cif.gz_X crystal structure of holo d-serine dehydratase from escherichia coli at 1.97 a resolution 0.9821 12 428
3r0x-assembly1.cif.gz_A crystal structure of selenomethionine incorporated apo d-serine deaminase from salmonella tyhimurium 0.9721 4 425
3r0z-assembly1.cif.gz_A crystal structure of apo d-serine deaminase from salmonella typhimurium 0.9631 4 428
6aa9-assembly1.cif.gz_A t166a mutant of d-serine deaminase from salmonella typhimurium 0.9524 5 427
3ss9-assembly1.cif.gz_X crystal structure of holo d-serine dehydratase from escherichia coli at 1.97 a resolution 0.9483 12 428
ID Description Score Start End Superfamily
3r0xA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9461 116 238 3.40.50.1100
3ss7X01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.945 7 428 3.40.50.1100
3ss7X01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.939 7 428 3.40.50.1100
3r0xA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9387 116 238 3.40.50.1100
af_P09367_100_172_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9086 167 237 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A2X1LDP1-F1-model_v4 D-serine ammonia-lyase (EC 4.3.1.18) 1.003 275 366 GO:0008721
AF-A0A350TZA2-F1-model_v4 deleted 0.997 122 248
AF-A0A3P6KYF8-F1-model_v4 D-serine dehydratase (EC 4.3.1.18) (D-serine deaminase) (DSD) 0.9945 88 303 GO:0008721
GO:0009097
GO:0016836
GO:0030170
GO:0036088
AF-A0A2C9NU05-F1-model_v4 D-serine dehydratase (EC 4.3.1.18) (D-serine deaminase) (DSD) 0.9914 4 428 GO:0008721
GO:0009097
GO:0016836
GO:0030170
GO:0036088
AF-A0A718Y3E6-F1-model_v4 D-serine dehydratase (EC 4.3.1.18) (D-serine deaminase) (DSD) 0.9913 4 428 GO:0008721
GO:0009097
GO:0016836
GO:0030170
GO:0036088

Feature Viewer

pLDDT pTM Quality
92.36 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map