F339163

General Info

Members Datasets Scaffolds Average Seq Length
226 164 452 157

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0136956|Ga0495651_0136956_923_1483
Length 186
Sequence MLGGDVDRDRHRTLHVRHATGITTRSEGALTMPTLAAGDRAPAFTLTDQHGKKVKLSDFKGRNVVLYFYPKADTPGCTTQSCALRDAEPDLSGLDAAVLGVSPDTPEKQAKFDEKYGLGFTLLADTEHEVAEKYGVWGEKVNYGRKYMGIIRSAFVIDAKGKIAAAFYKVSPKDTVPKSTKVLETL

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
82 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
83 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
84 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
89 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
93 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
94 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
95 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
96 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
97 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 3.54
Rhizosphere 93.36
Stem 0
Stem Tuber 0
Unclassified 7.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0136956 3300046462 Bacteria 1780
2 JGI25406J46586_10092441 3300003203 Bacteria 911
3 Ga0070690_100127655 3300005330 Bacteria 1714
4 Ga0070680_100525347 3300005336 Bacteria 1013
5 Ga0070689_100253554 3300005340 Bacteria 1452
6 Ga0070667_101066848 3300005367 Bacteria 755
7 Ga0070714_100317412 3300005435 Bacteria 1456
8 Ga0070708_100279885 3300005445 Unclassified 1570
9 Ga0070681_10017781 3300005458 Bacteria 7104
10 Ga0070681_10116774 3300005458 Bacteria 2605
11 Ga0070681_10518796 3300005458 Bacteria 1105
12 Ga0068867_100208879 3300005459 Bacteria 1567
13 Ga0068867_100766967 3300005459 Bacteria 857
14 Ga0068867_101783205 3300005459 Bacteria 578
15 Ga0070685_10517534 3300005466 Unclassified 847
16 Ga0070706_100604500 3300005467 Unclassified 1019
17 Ga0070707_100728712 3300005468 Bacteria 955
18 Ga0070699_100475655 3300005518 Unclassified 1134
19 Ga0070699_101002177 3300005518 Bacteria 766
20 Ga0070679_100845722 3300005530 Bacteria 858
21 Ga0070697_100395073 3300005536 Unclassified 1199
22 Ga0070672_100546698 3300005543 Bacteria 1005
23 Ga0070672_100821212 3300005543 Bacteria 819
24 Ga0070672_101727287 3300005543 Unclassified 562
25 Ga0070686_100446979 3300005544 Bacteria 993
26 Ga0070695_100035028 3300005545 Unclassified 3151
27 Ga0070696_100240190 3300005546 Unclassified 1366
28 Ga0070704_100022816 3300005549 Bacteria 4077
29 Ga0068855_100084512 3300005563 Bacteria 3674
30 Ga0068859_101423316 3300005617 Bacteria 765
31 Ga0068861_100343997 3300005719 Bacteria 1306
32 Ga0081455_10035862 3300005937 Bacteria 4424
33 Ga0081539_10014373 3300005985 Bacteria 5860
34 Ga0070717_10701014 3300006028 Bacteria 920
35 Ga0075364_10172537 3300006051 Bacteria 1462
36 Ga0097621_101033093 3300006237 Bacteria 770
37 Ga0075428_100155365 3300006844 Bacteria 2485
38 Ga0075430_100105612 3300006846 Bacteria 2350
39 Ga0075430_100130507 3300006846 Bacteria 2094
40 Ga0075430_100145873 3300006846 Archaea 1971
41 Ga0075430_100206242 3300006846 Unclassified 1631
42 Ga0075431_100022113 3300006847 Bacteria 6504
43 Ga0075434_100573560 3300006871 Bacteria 1148
44 Ga0068865_100901772 3300006881 Bacteria 769
45 Ga0075436_100285987 3300006914 Bacteria 1179
46 Ga0097620_101423393 3300006931 Bacteria 765
47 Ga0111539_10143558 3300009094 Bacteria 2794
48 Ga0105245_10420295 3300009098 Bacteria 1340
49 Ga0114129_13051947 3300009147 Unclassified 549
50 Ga0105242_10527752 3300009176 Bacteria 1128
51 Ga0105248_10507189 3300009177 Bacteria 1360
52 Ga0105239_10503719 3300010375 Bacteria 1377
53 Ga0105239_11495607 3300010375 Unclassified 780
54 Ga0105246_11184117 3300011119 Bacteria 702
55 Ga0157374_10625028 3300013296 Bacteria 1088
56 Ga0157374_10968248 3300013296 Bacteria 870
57 Ga0157378_11479103 3300013297 Bacteria 723
58 Ga0163162_11746778 3300013306 Bacteria 711
59 Ga0163162_11967271 3300013306 Bacteria 670
60 Ga0157372_11156117 3300013307 Bacteria 895
61 Ga0157375_11564870 3300013308 Bacteria 779
62 Ga0157376_10445882 3300014969 Bacteria 1261
63 Ga0157376_10896204 3300014969 Bacteria 905
64 Ga0163161_10298608 3300017792 Bacteria 1268
65 Ga0207653_10034669 3300025885 Bacteria 1640
66 Ga0207688_10425091 3300025901 Bacteria 826
67 Ga0207643_10604968 3300025908 Bacteria 706
68 Ga0207643_11127563 3300025908 Bacteria 506
69 Ga0207684_10524764 3300025910 Unclassified 1014
70 Ga0207707_10001958 3300025912 Bacteria 18719
71 Ga0207707_10319362 3300025912 Unclassified 1341
72 Ga0207664_11541926 3300025929 Bacteria 586
73 Ga0207644_10870198 3300025931 Bacteria 755
74 Ga0207704_10848045 3300025938 Bacteria 766
75 Ga0207691_10631545 3300025940 Bacteria 906
76 Ga0207679_10383319 3300025945 Bacteria 1233
77 Ga0207667_10102581 3300025949 Bacteria 2951
78 Ga0207712_10506698 3300025961 Bacteria 1032
79 Ga0207668_10162737 3300025972 Bacteria 1741
80 Ga0207668_11146183 3300025972 Bacteria 698
81 Ga0207658_10987138 3300025986 Bacteria 768
82 Ga0207677_10050770 3300026023 Bacteria 2807
83 Ga0207648_10414847 3300026089 Bacteria 1222
84 Ga0207676_11367804 3300026095 Bacteria 704
85 Ga0207683_10368341 3300026121 Bacteria 1320
86 Ga0209974_10126042 3300027876 Bacteria 910
87 Ga0207428_10115891 3300027907 Bacteria 2058
88 Ga0265338_10002961 3300028800 Bacteria 24647
89 Ga0265320_10197606 3300031240 Bacteria 898
90 Ga0265327_10007812 3300031251 Bacteria 8144
91 Ga0265327_10010703 3300031251 Bacteria 6409
92 Ga0265327_10012492 3300031251 Bacteria 5723
93 Ga0265327_10119684 3300031251 Bacteria 1249
94 Ga0316576_10267442 3300031727 Bacteria 1282
95 Ga0316578_10165325 3300031728 Bacteria 1333
96 Ga0316578_10250862 3300031728 Bacteria 1062
97 Ga0316577_10051440 3300031733 Bacteria 2298
98 Ga0316577_10392349 3300031733 Bacteria 788
99 Ga0307413_10100798 3300031824 Bacteria 1908
100 Ga0307406_10929608 3300031901 Bacteria 742
101 Ga0307409_100479349 3300031995 Bacteria 1207
102 Ga0307411_10051920 3300032005 Bacteria 2678
103 Ga0316580_10213626 3300032139 Bacteria 595
104 Ga0316212_1016142 3300033547 Bacteria 1054
105 Ga0316216_1002497 3300033548 Bacteria 1311
106 Ga0373941_0344248 3300035115 Bacteria 605
107 Ga0373954_0477177 3300035118 Bacteria 618
108 Ga0316574_0006955 3300035398 Bacteria 6161
109 Ga0316574_0049474 3300035398 Bacteria 2614
110 Ga0373937_0169310 3300036401 Bacteria 2049
111 Ga0373937_1209309 3300036401 Bacteria 704
112 Ga0310112_027872 3300036458 Bacteria 779
113 Ga0372808_017154 3300036459 Bacteria 1039
114 Ga0316582_0200430 3300036647 Bacteria 1361
115 Ga0316582_0737070 3300036647 Bacteria 676
116 Ga0316584_0002410 3300036712 Bacteria 11821
117 Ga0316584_0069453 3300036712 Bacteria 2641
118 Ga0316584_0131469 3300036712 Bacteria 1869
119 Ga0316584_0437188 3300036712 Bacteria 927
120 Ga0316581_0019821 3300037588 Bacteria 1965
121 Ga0316581_0131932 3300037588 Unclassified 770
122 Ga0439439_0060474 3300041406 Bacteria 1005
123 Ga0439453_0004020 3300041408 Bacteria 2161
124 Ga0451789_0758935 3300041443 Bacteria 740
125 Ga0451837_1047332 3300041494 Bacteria 559
126 Ga0451843_0729748 3300041509 Bacteria 724
127 Ga0466966_0105589 3300044684 Bacteria 1739
128 Ga0466963_0062069 3300044694 Bacteria 2500
129 Ga0466968_0305370 3300044735 Bacteria 766
130 Ga0466970_0043005 3300044765 Bacteria 2403
131 Ga0466957_0087894 3300044842 Bacteria 1944
132 Ga0466959_1119405 3300045049 Bacteria 523
133 Ga0466958_0610713 3300045836 Bacteria 709
134 Ga0466958_0757218 3300045836 Bacteria 633
135 Ga0466967_0281516 3300045976 Bacteria 1596
136 Ga0466967_0367471 3300045976 Bacteria 1395
137 Ga0495592_0007747 3300046454 Bacteria 8048
138 Ga0495590_0244670 3300046457 Bacteria 666
139 Ga0495651_0011022 3300046462 Bacteria 6956
140 Ga0495653_0106408 3300046463 Bacteria 2023
141 Ga0495582_0195120 3300046473 Bacteria 1156
142 Ga0495582_0217169 3300046473 Bacteria 1094
143 Ga0495664_0779563 3300046477 Bacteria 563
144 Ga0495596_0439703 3300046500 Unclassified 509
145 Ga0495608_0036954 3300046511 Bacteria 3285
146 Ga0495608_0092466 3300046511 Bacteria 1955
147 Ga0495618_0010003 3300046514 Bacteria 5736
148 Ga0495618_0199949 3300046514 Bacteria 1265
149 Ga0495628_0129575 3300046516 Bacteria 1930
150 Ga0495628_0360949 3300046516 Bacteria 1067
151 Ga0495628_0564363 3300046516 Bacteria 816
152 Ga0495666_0030106 3300046526 Bacteria 2666
153 Ga0495652_0168775 3300046529 Bacteria 1691
154 Ga0495640_0197708 3300046533 Bacteria 1275
155 Ga0495640_0213624 3300046533 Bacteria 1219
156 Ga0495586_0181401 3300046535 Bacteria 1191
157 Ga0495645_0390088 3300046543 Bacteria 889
158 Ga0495667_0002736 3300046559 Bacteria 11779
159 Ga0495667_0061561 3300046559 Bacteria 2461
160 Ga0495667_0368385 3300046559 Bacteria 907
161 Ga0495634_0168782 3300046642 Bacteria 1376
162 Ga0495611_0413860 3300046648 Bacteria 616
163 Ga0495635_0235206 3300046663 Bacteria 1237
164 Ga0495657_0009173 3300046675 Bacteria 7513
165 Ga0495657_0009657 3300046675 Bacteria 7301
166 Ga0495657_0226381 3300046675 Bacteria 1132
167 Ga0495599_0355381 3300046678 Bacteria 878
168 Ga0495623_0009997 3300046679 Bacteria 6147
169 Ga0495647_0277877 3300046681 Bacteria 751
170 Ga0495658_0005174 3300046683 Bacteria 6412
171 Ga0495658_0459258 3300046683 Bacteria 814
172 Ga0495600_0370046 3300046809 Bacteria 895
173 Ga0495604_0096104 3300047317 Bacteria 2187
174 Ga0495674_0688957 3300047319 Bacteria 803
175 Ga0495674_0704685 3300047319 Bacteria 792
176 Ga0495672_0177509 3300047320 Bacteria 1081
177 Ga0495680_0029454 3300047322 Bacteria 4496
178 Ga0495680_0171126 3300047322 Bacteria 1572
179 Ga0495675_0058108 3300047444 Bacteria 2453
180 Ga0495684_0241477 3300047471 Bacteria 1317
181 Ga0495602_0356672 3300048088 Bacteria 1054
182 Ga0495602_0438780 3300048088 Bacteria 924
183 Ga0495626_0231057 3300048091 Bacteria 748
184 Ga0496104_0165791 3300048907 Bacteria 2119
185 Ga0496105_0908896 3300048908 Bacteria 663
186 Ga0496108_1182706 3300048911 Bacteria 647
187 Ga0496109_0054663 3300048912 Bacteria 3642
188 Ga0496109_0453788 3300048912 Bacteria 1211
189 Ga0496109_1439615 3300048912 Unclassified 624
190 Ga0496111_0478373 3300048914 Bacteria 918
191 Ga0501034_0000731 3300049571 Bacteria 49750
192 Ga0501034_0024241 3300049571 Bacteria 6171
193 Ga0501034_0062807 3300049571 Bacteria 3729
194 Ga0501034_0234652 3300049571 Bacteria 1782
195 Ga0501034_0252220 3300049571 Bacteria 1709
196 Ga0501036_0021795 3300049572 Bacteria 5386
197 Ga0501039_0161876 3300049575 Bacteria 1759
198 Ga0501042_0254846 3300049578 Bacteria 1266
199 Ga0501043_0037689 3300049579 Bacteria 3802
200 Ga0501046_0389996 3300049580 Bacteria 1007
201 Ga0501047_0007326 3300049581 Bacteria 10379
202 Ga0501047_0539756 3300049581 Bacteria 991
203 Ga0501048_0355269 3300049582 Bacteria 1045
204 Ga0501068_0229237 3300049584 Bacteria 1181
205 Ga0501069_0883248 3300049585 Bacteria 544
206 Ga0501070_0010290 3300049586 Bacteria 7909
207 Ga0501071_0198831 3300049587 Bacteria 1505
208 Ga0501074_0776784 3300049590 Bacteria 675
209 Ga0501080_0103358 3300049742 Bacteria 2642
210 Ga0501035_0799209 3300049822 Bacteria 754
211 nmdc:mga0qj67_301273_c1 3300050509 Bacteria 1299
212 nmdc:mga0qj67_443424_c1 3300050509 Archaea 1046
213 nmdc:mga0qj67_502566_c1 3300050509 Bacteria 975
214 nmdc:mga0qj67_62952_c1 3300050509 Bacteria 2949
215 nmdc:mga0qj67_77248_c1 3300050509 Unclassified 2664
216 nmdc:mga0rr50_737880_c1 3300050513 Bacteria 840
217 Ga0495601_0041092 3300053077 Bacteria 2898
218 Ga0495601_0337325 3300053077 Bacteria 981
219 Ga0495595_0011769 3300053084 Bacteria 3665
220 Ga0495595_0048921 3300053084 Bacteria 1954
221 Ga0495619_0036569 3300053085 Bacteria 3198
222 Ga0495619_0163439 3300053085 Bacteria 1538
223 Ga0495619_0528369 3300053085 Bacteria 810
224 Ga0501084_0582406 3300054114 Bacteria 946
225 Ga0501082_0139408 3300060353 Bacteria 2105
226 Ga0501082_0266185 3300060353 Bacteria 1492
227 Ga0495651_0136956
228 JGI25406J46586_10092441
229 Ga0070690_100127655
230 Ga0070680_100525347
231 Ga0070689_100253554
232 Ga0070667_101066848
233 Ga0070714_100317412
234 Ga0070708_100279885
235 Ga0070681_10017781
236 Ga0070681_10116774
237 Ga0070681_10518796
238 Ga0068867_100208879
239 Ga0068867_100766967
240 Ga0068867_101783205
241 Ga0070685_10517534
242 Ga0070706_100604500
243 Ga0070707_100728712
244 Ga0070699_100475655
245 Ga0070699_101002177
246 Ga0070679_100845722
247 Ga0070697_100395073
248 Ga0070672_100546698
249 Ga0070672_100821212
250 Ga0070672_101727287
251 Ga0070686_100446979
252 Ga0070695_100035028
253 Ga0070696_100240190
254 Ga0070704_100022816
255 Ga0068855_100084512
256 Ga0068859_101423316
257 Ga0068861_100343997
258 Ga0081455_10035862
259 Ga0081539_10014373
260 Ga0070717_10701014
261 Ga0075364_10172537
262 Ga0097621_101033093
263 Ga0075428_100155365
264 Ga0075430_100105612
265 Ga0075430_100130507
266 Ga0075430_100145873
267 Ga0075430_100206242
268 Ga0075431_100022113
269 Ga0075434_100573560
270 Ga0068865_100901772
271 Ga0075436_100285987
272 Ga0097620_101423393
273 Ga0111539_10143558
274 Ga0105245_10420295
275 Ga0114129_13051947
276 Ga0105242_10527752
277 Ga0105248_10507189
278 Ga0105239_10503719
279 Ga0105239_11495607
280 Ga0105246_11184117
281 Ga0157374_10625028
282 Ga0157374_10968248
283 Ga0157378_11479103
284 Ga0163162_11746778
285 Ga0163162_11967271
286 Ga0157372_11156117
287 Ga0157375_11564870
288 Ga0157376_10445882
289 Ga0157376_10896204
290 Ga0163161_10298608
291 Ga0207653_10034669
292 Ga0207688_10425091
293 Ga0207643_10604968
294 Ga0207643_11127563
295 Ga0207684_10524764
296 Ga0207707_10001958
297 Ga0207707_10319362
298 Ga0207664_11541926
299 Ga0207644_10870198
300 Ga0207704_10848045
301 Ga0207691_10631545
302 Ga0207679_10383319
303 Ga0207667_10102581
304 Ga0207712_10506698
305 Ga0207668_10162737
306 Ga0207668_11146183
307 Ga0207658_10987138
308 Ga0207677_10050770
309 Ga0207648_10414847
310 Ga0207676_11367804
311 Ga0207683_10368341
312 Ga0209974_10126042
313 Ga0207428_10115891
314 Ga0265338_10002961
315 Ga0265320_10197606
316 Ga0265327_10007812
317 Ga0265327_10010703
318 Ga0265327_10012492
319 Ga0265327_10119684
320 Ga0316576_10267442
321 Ga0316578_10165325
322 Ga0316578_10250862
323 Ga0316577_10051440
324 Ga0316577_10392349
325 Ga0307413_10100798
326 Ga0307406_10929608
327 Ga0307409_100479349
328 Ga0307411_10051920
329 Ga0316580_10213626
330 Ga0316212_1016142
331 Ga0316216_1002497
332 Ga0373941_0344248
333 Ga0373954_0477177
334 Ga0316574_0006955
335 Ga0316574_0049474
336 Ga0373937_0169310
337 Ga0373937_1209309
338 Ga0310112_027872
339 Ga0372808_017154
340 Ga0316582_0200430
341 Ga0316582_0737070
342 Ga0316584_0002410
343 Ga0316584_0069453
344 Ga0316584_0131469
345 Ga0316584_0437188
346 Ga0316581_0019821
347 Ga0316581_0131932
348 Ga0439439_0060474
349 Ga0439453_0004020
350 Ga0451789_0758935
351 Ga0451837_1047332
352 Ga0451843_0729748
353 Ga0466966_0105589
354 Ga0466963_0062069
355 Ga0466968_0305370
356 Ga0466970_0043005
357 Ga0466957_0087894
358 Ga0466959_1119405
359 Ga0466958_0610713
360 Ga0466958_0757218
361 Ga0466967_0281516
362 Ga0466967_0367471
363 Ga0495592_0007747
364 Ga0495590_0244670
365 Ga0495651_0011022
366 Ga0495653_0106408
367 Ga0495582_0195120
368 Ga0495582_0217169
369 Ga0495664_0779563
370 Ga0495596_0439703
371 Ga0495608_0036954
372 Ga0495608_0092466
373 Ga0495618_0010003
374 Ga0495618_0199949
375 Ga0495628_0129575
376 Ga0495628_0360949
377 Ga0495628_0564363
378 Ga0495666_0030106
379 Ga0495652_0168775
380 Ga0495640_0197708
381 Ga0495640_0213624
382 Ga0495586_0181401
383 Ga0495645_0390088
384 Ga0495667_0002736
385 Ga0495667_0061561
386 Ga0495667_0368385
387 Ga0495634_0168782
388 Ga0495611_0413860
389 Ga0495635_0235206
390 Ga0495657_0009173
391 Ga0495657_0009657
392 Ga0495657_0226381
393 Ga0495599_0355381
394 Ga0495623_0009997
395 Ga0495647_0277877
396 Ga0495658_0005174
397 Ga0495658_0459258
398 Ga0495600_0370046
399 Ga0495604_0096104
400 Ga0495674_0688957
401 Ga0495674_0704685
402 Ga0495672_0177509
403 Ga0495680_0029454
404 Ga0495680_0171126
405 Ga0495675_0058108
406 Ga0495684_0241477
407 Ga0495602_0356672
408 Ga0495602_0438780
409 Ga0495626_0231057
410 Ga0496104_0165791
411 Ga0496105_0908896
412 Ga0496108_1182706
413 Ga0496109_0054663
414 Ga0496109_0453788
415 Ga0496109_1439615
416 Ga0496111_0478373
417 Ga0501034_0000731
418 Ga0501034_0024241
419 Ga0501034_0062807
420 Ga0501034_0234652
421 Ga0501034_0252220
422 Ga0501036_0021795
423 Ga0501039_0161876
424 Ga0501042_0254846
425 Ga0501043_0037689
426 Ga0501046_0389996
427 Ga0501047_0007326
428 Ga0501047_0539756
429 Ga0501048_0355269
430 Ga0501068_0229237
431 Ga0501069_0883248
432 Ga0501070_0010290
433 Ga0501071_0198831
434 Ga0501074_0776784
435 Ga0501080_0103358
436 Ga0501035_0799209
437 nmdc:mga0qj67_301273_c1
438 nmdc:mga0qj67_443424_c1
439 nmdc:mga0qj67_502566_c1
440 nmdc:mga0qj67_62952_c1
441 nmdc:mga0qj67_77248_c1
442 nmdc:mga0rr50_737880_c1
443 Ga0495601_0041092
444 Ga0495601_0337325
445 Ga0495595_0011769
446 Ga0495595_0048921
447 Ga0495619_0036569
448 Ga0495619_0163439
449 Ga0495619_0528369
450 Ga0501084_0582406
451 Ga0501082_0139408
452 Ga0501082_0266185

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

37

166

0.99

PF08534

Redoxin

Redoxin

36

183

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9486 4 154
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9294 6 154
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9288 6 154
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9285 5 154
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9252 5 154
ID Description Score Start End Superfamily
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9746 6 152 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.972 4 154 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9555 6 152 3.40.30.10
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9534 3 134 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9533 4 154 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6G3HNR1-F1-model_v4 deleted 0.9951 1 98
AF-A0A3N5YXX7-F1-model_v4 deleted 0.9915 2 104
AF-A0A0J0V0J8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9881 2 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A511SYM8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9878 1 153 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A432TGI5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9869 1 93 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map