F338759

General Info

Members Datasets Scaffolds Average Seq Length
226 170 452 405

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100041453|Ga0075434_1000414534
Length 445
Sequence MAKPHRCGCLSQKIGYTPGQHIDTQGEAPGGAARLGMAETTVGAVARPQSSFQDVLVVSFGHALTHWYPATFYLLLPLIGRDLGLSYAQVGSILTCQFAAGAIANIPGGLLVDTVGRKGLLMAISLSWIGIPYLVMGVSHVYWMMLACAMLVGIGNNLWHPTAIPWLANRFPRRKGLVMSIHGMGGNVGDALAPLVIGALLATYSWRSVVLMNVLPGIVMAVFILIYVSRASDTEPPAARKAPAMSGAERLHSLGLLVKNRAFVTLAIGSGFRSMTQSALLTFLPLYLAHEMGYSPGWIGACMFALQAAGFAAAPIAGHLSDSVGRRQVIMSSMAMTAVVIVVMAFAGGTPWFVALVAVLGFFLFAVRAVLQAWMLDATPPGMGGSAIGLLFSTQAAGAAIGPISAGLVADHFGLMAAFYFTAGTIVLANLLVFATPATLMKRDL

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
72 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
73 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
165 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
169 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
170 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.44
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 5.75
Rhizosphere 90.27
Stem 0
Stem Tuber 0
Unclassified 3.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100041453 3300006871 Bacteria 4561
2 JGI25153J46596_10006763 3300003215 Bacteria 5750
3 Ga0065707_10128113 3300005295 Bacteria 1971
4 Ga0070658_10105443 3300005327 Bacteria 2332
5 Ga0070690_100005286 3300005330 Bacteria 7238
6 Ga0070677_10067291 3300005333 Bacteria 1496
7 Ga0070680_100010353 3300005336 Bacteria 7189
8 Ga0070689_100011784 3300005340 Bacteria 6274
9 Ga0070671_100027552 3300005355 Bacteria 4677
10 Ga0070674_100046858 3300005356 Bacteria 2960
11 Ga0070713_100050847 3300005436 Bacteria 3425
12 Ga0070678_100224819 3300005456 Bacteria 1562
13 Ga0070681_10015902 3300005458 Bacteria 7502
14 Ga0070681_10018567 3300005458 Bacteria 6952
15 Ga0070699_100070494 3300005518 Bacteria 3039
16 Ga0070679_100031149 3300005530 Bacteria 5269
17 Ga0070679_100181703 3300005530 Bacteria 2075
18 Ga0070697_100026075 3300005536 Bacteria 4664
19 Ga0070696_100000434 3300005546 Bacteria 26295
20 Ga0070696_100070794 3300005546 Bacteria 2454
21 Ga0070693_100003959 3300005547 Bacteria 6952
22 Ga0070665_100111272 3300005548 Bacteria 2741
23 Ga0070664_100021736 3300005564 Bacteria 5292
24 Ga0068864_100015570 3300005618 Bacteria 6326
25 Ga0081540_1000175 3300005983 Bacteria 67078
26 Ga0081540_1016846 3300005983 Bacteria 4551
27 Ga0081539_10000784 3300005985 Bacteria 61876
28 Ga0070717_10217756 3300006028 Bacteria 1677
29 Ga0070716_100058850 3300006173 Bacteria 2213
30 Ga0070712_100031655 3300006175 Bacteria 3565
31 Ga0075428_100087530 3300006844 Bacteria 3398
32 Ga0075433_10049685 3300006852 Bacteria 3649
33 Ga0075434_100185402 3300006871 Bacteria 2101
34 Ga0075436_100000262 3300006914 Bacteria 32984
35 Ga0111539_10060114 3300009094 Bacteria 4504
36 Ga0114129_10099373 3300009147 Bacteria 4027
37 Ga0105243_10052719 3300009148 Bacteria 3223
38 Ga0105242_10019513 3300009176 Bacteria 5313
39 Ga0105242_10021508 3300009176 Bacteria 5066
40 Ga0105248_10021063 3300009177 Bacteria 7224
41 Ga0105238_10111681 3300009551 Bacteria 2713
42 Ga0105249_10156982 3300009553 Bacteria 2195
43 Ga0157378_10024801 3300013297 Bacteria 5281
44 Ga0163162_10026946 3300013306 Bacteria 5683
45 Ga0163162_10174738 3300013306 Bacteria 2273
46 Ga0163162_10195144 3300013306 Bacteria 2153
47 Ga0157380_10059826 3300014326 Bacteria 3042
48 Ga0157377_10106244 3300014745 Bacteria 1681
49 Ga0209758_1003698 3300025297 Bacteria 13571
50 Ga0207697_10071715 3300025315 Bacteria 1452
51 Ga0207707_10003497 3300025912 Bacteria 13902
52 Ga0207707_10098924 3300025912 Bacteria 2549
53 Ga0207693_10022367 3300025915 Bacteria 5024
54 Ga0207660_10004230 3300025917 Bacteria 9352
55 Ga0207649_10033303 3300025920 Bacteria 3078
56 Ga0207652_10130747 3300025921 Bacteria 2239
57 Ga0207681_10009625 3300025923 Bacteria 5908
58 Ga0207686_10009577 3300025934 Bacteria 5257
59 Ga0207686_10243025 3300025934 Bacteria 1311
60 Ga0207670_10007530 3300025936 Bacteria 6081
61 Ga0207670_10008658 3300025936 Bacteria 5758
62 Ga0207669_10018082 3300025937 Bacteria 3633
63 Ga0207665_10174173 3300025939 Bacteria 1555
64 Ga0207689_10162859 3300025942 Bacteria 1838
65 Ga0207679_10132410 3300025945 Bacteria 2002
66 Ga0207703_10261853 3300026035 Bacteria 1563
67 Ga0207676_10010202 3300026095 Bacteria 6683
68 Ga0207674_10096227 3300026116 Bacteria 2946
69 Ga0207675_100049768 3300026118 Bacteria 3910
70 Ga0207683_10019168 3300026121 Bacteria 5841
71 Ga0209588_1031570 3300027671 Bacteria 1695
72 Ga0265357_1000615 3300028023 Bacteria 2199
73 Ga0268266_10063307 3300028379 Bacteria 3193
74 Ga0265338_10004716 3300028800 Bacteria 18249
75 Ga0265760_10032937 3300031090 Bacteria 1531
76 Ga0265332_10055247 3300031238 Bacteria 1702
77 Ga0265325_10005599 3300031241 Bacteria 7736
78 Ga0265339_10000101 3300031249 Bacteria 69843
79 Ga0265339_10014143 3300031249 Bacteria 4816
80 Ga0307408_100087227 3300031548 Bacteria 2347
81 Ga0265313_10000548 3300031595 Bacteria 39188
82 Ga0265342_10000989 3300031712 Bacteria 27995
83 Ga0373926_0001766 3300035083 Bacteria 6711
84 Ga0373929_0020439 3300035085 Bacteria 1335
85 Ga0373940_0025233 3300035088 Bacteria 1547
86 Ga0373936_0013216 3300035113 Bacteria 3149
87 Ga0373936_0046895 3300035113 Unclassified 1742
88 Ga0373939_0022119 3300035114 Bacteria 1749
89 Ga0373954_0002495 3300035118 Bacteria 7723
90 Ga0373943_0002893 3300035170 Bacteria 7794
91 Ga0373946_0047231 3300035171 Unclassified 1788
92 Ga0373955_0058397 3300035172 Unclassified 2123
93 Ga0373931_0001370 3300035691 Bacteria 10416
94 Ga0373931_0002382 3300035691 Bacteria 8319
95 Ga0373931_0018983 3300035691 Bacteria 3426
96 Ga0373935_0008229 3300035692 Bacteria 6243
97 Ga0373927_0006897 3300035695 Bacteria 7718
98 Ga0373927_0062515 3300035695 Unclassified 2407
99 Ga0373947_0007678 3300035725 Bacteria 6231
100 Ga0373937_0200433 3300036401 Bacteria 1876
101 Ga0373925_0004967 3300037068 Bacteria 9989
102 Ga0373925_0015169 3300037068 Bacteria 5571
103 Ga0373925_0016014 3300037068 Bacteria 5429
104 Ga0373925_0087350 3300037068 Bacteria 2380
105 Ga0373925_0243322 3300037068 Bacteria 1441
106 Ga0436364_0096203 3300037853 Bacteria 3509
107 Ga0436364_1543736 3300037853 Bacteria 2628
108 Ga0436365_1873022 3300039437 Bacteria 2477
109 Ga0466966_0059629 3300044684 Bacteria 2410
110 Ga0466957_0031717 3300044842 Bacteria 3159
111 Ga0451576_0005377 3300045051 Bacteria 16094
112 Ga0451576_0125236 3300045051 Bacteria 2677
113 Ga0495592_0002566 3300046454 Bacteria 12841
114 Ga0495592_0022552 3300046454 Bacteria 4789
115 Ga0495629_0080647 3300046459 Bacteria 2272
116 Ga0495653_0143980 3300046463 Unclassified 1673
117 Ga0495580_0021239 3300046472 Bacteria 4792
118 Ga0495662_0000833 3300046476 Bacteria 14971
119 Ga0495662_0012796 3300046476 Bacteria 4091
120 Ga0495664_0000260 3300046477 Bacteria 25657
121 Ga0495608_0064901 3300046511 Bacteria 2392
122 Ga0495628_0005289 3300046516 Bacteria 11319
123 Ga0495628_0080559 3300046516 Bacteria 2530
124 Ga0495628_0113236 3300046516 Bacteria 2085
125 Ga0495628_0254925 3300046516 Unclassified 1309
126 Ga0495630_0000776 3300046517 Bacteria 22428
127 Ga0495630_0023570 3300046517 Bacteria 4550
128 Ga0495630_0035705 3300046517 Bacteria 3714
129 Ga0495666_0022994 3300046526 Bacteria 3085
130 Ga0495652_0011004 3300046529 Bacteria 8199
131 Ga0495665_0018660 3300046531 Bacteria 3725
132 Ga0495640_0001275 3300046533 Bacteria 19760
133 Ga0495640_0011625 3300046533 Bacteria 6763
134 Ga0495586_0009349 3300046535 Bacteria 5214
135 Ga0495645_0000858 3300046543 Bacteria 20726
136 Ga0495645_0004741 3300046543 Bacteria 9295
137 Ga0495634_0009614 3300046642 Bacteria 7123
138 Ga0495634_0017585 3300046642 Bacteria 5099
139 Ga0495635_0045910 3300046663 Plasmid 3013
140 Ga0495599_0001807 3300046678 Bacteria 12416
141 Ga0495669_0054816 3300046684 Bacteria 1795
142 Ga0495613_0006500 3300046689 Bacteria 8735
143 Ga0495624_0010908 3300046690 Bacteria 6264
144 Ga0495624_0165386 3300046690 Unclassified 1350
145 Ga0495581_0087287 3300047315 Bacteria 1808
146 Ga0495674_0000957 3300047319 Bacteria 27612
147 Ga0495674_0167679 3300047319 Bacteria 1834
148 Ga0495674_0251485 3300047319 Bacteria 1454
149 Ga0495676_0036686 3300047321 Bacteria 4090
150 Ga0495680_0009272 3300047322 Bacteria 8865
151 Ga0495684_0002623 3300047471 Bacteria 14276
152 Ga0495684_0007957 3300047471 Bacteria 8195
153 Ga0495593_0010240 3300047673 Bacteria 5421
154 Ga0496102_0155982 3300048905 Bacteria 2146
155 Ga0496104_0003323 3300048907 Bacteria 13881
156 Ga0496104_0044923 3300048907 Bacteria 4152
157 Ga0496104_0204096 3300048907 Bacteria 1888
158 Ga0496105_0004464 3300048908 Bacteria 10540
159 Ga0496105_0213775 3300048908 Bacteria 1571
160 Ga0496107_0131538 3300048910 Bacteria 1847
161 Ga0496109_0302938 3300048912 Unclassified 1507
162 Ga0496110_0024374 3300048913 Bacteria 5156
163 Ga0496111_0008747 3300048914 Bacteria 6720
164 Ga0496112_0275818 3300048915 Bacteria 1629
165 Ga0496113_0089382 3300048916 Bacteria 2371
166 Ga0496114_0069508 3300048917 Bacteria 2957
167 Ga0501031_0082071 3300049568 Bacteria 2102
168 Ga0501032_0019024 3300049569 Bacteria 4805
169 Ga0501033_0022177 3300049570 Bacteria 4791
170 Ga0501034_0023787 3300049571 Bacteria 6239
171 Ga0501034_0053164 3300049571 Bacteria 4080
172 Ga0501034_0152567 3300049571 Bacteria 2286
173 Ga0501034_0162993 3300049571 Bacteria 2199
174 Ga0501037_0029987 3300049573 Bacteria 4018
175 Ga0501038_0042430 3300049574 Bacteria 3961
176 Ga0501038_0141762 3300049574 Bacteria 1966
177 Ga0501040_0002840 3300049576 Bacteria 11184
178 Ga0501042_0228758 3300049578 Bacteria 1341
179 Ga0501043_0139884 3300049579 Bacteria 1896
180 Ga0501046_0014006 3300049580 Bacteria 6773
181 Ga0501047_0044705 3300049581 Bacteria 4280
182 Ga0501048_0015283 3300049582 Bacteria 5668
183 Ga0501048_0048965 3300049582 Bacteria 3013
184 Ga0501067_0024235 3300049583 Bacteria 3365
185 Ga0501067_0125892 3300049583 Unclassified 1426
186 Ga0501068_0011550 3300049584 Bacteria 4987
187 Ga0501069_0007879 3300049585 Bacteria 5591
188 Ga0501070_0009918 3300049586 Bacteria 8052
189 Ga0501070_0052289 3300049586 Bacteria 3390
190 Ga0501071_0057278 3300049587 Bacteria 2816
191 Ga0501072_0076649 3300049588 Bacteria 2645
192 Ga0501072_0088113 3300049588 Bacteria 2463
193 Ga0501073_0092120 3300049589 Bacteria 2106
194 Ga0501074_0020648 3300049590 Bacteria 4786
195 Ga0501075_0082024 3300049591 Bacteria 2442
196 Ga0501076_0000718 3300049592 Bacteria 21378
197 Ga0501076_0047620 3300049592 Bacteria 3390
198 Ga0501079_0008196 3300049741 Bacteria 7919
199 Ga0501080_0025170 3300049742 Bacteria 5523
200 Ga0501080_0102898 3300049742 Bacteria 2649
201 Ga0501081_0001411 3300049743 Bacteria 14690
202 Ga0501035_0036080 3300049822 Bacteria 4482
203 Ga0501044_0001147 3300049823 Bacteria 31381
204 Ga0501044_0011064 3300049823 Bacteria 9787
205 Ga0501044_0183289 3300049823 Bacteria 2059
206 Ga0501045_0062186 3300049824 Bacteria 2739
207 nmdc:mga0k408_643_c1 3300050493 Bacteria 19219
208 nmdc:mga08y16_125929_c1 3300050511 Bacteria 2665
209 nmdc:mga08y16_50588_c1 3300050511 Bacteria 4348
210 nmdc:mga0rr50_65732_c1 3300050513 Bacteria 2748
211 nmdc:mga08x19_13853_c1 3300050514 Bacteria 4885
212 nmdc:mga08x19_54748_c1 3300050514 Bacteria 2569
213 nmdc:mga08x19_73643_c1 3300050514 Bacteria 2230
214 Ga0495601_0015574 3300053077 Bacteria 4596
215 Ga0495601_0073544 3300053077 Bacteria 2185
216 Ga0495612_0012761 3300053078 Bacteria 3386
217 Ga0495595_0041659 3300053084 Bacteria 2102
218 Ga0495619_0003435 3300053085 Bacteria 10224
219 Ga0495619_0038782 3300053085 Bacteria 3108
220 Ga0500652_064299 3300053131 Bacteria 1515
221 Ga0500590_001674 3300053148 Bacteria 9274
222 Ga0501084_0038333 3300054114 Bacteria 4007
223 Ga0501082_0050462 3300060353 Bacteria 3588
224 Ga0530510_0003565 3300061734 Bacteria 10727
225 2904583615 2904578770 Bacteria 5302906
226 2919124466 2919119836 Bacteria 5208557
227 Ga0075434_100041453
228 JGI25153J46596_10006763
229 Ga0065707_10128113
230 Ga0070658_10105443
231 Ga0070690_100005286
232 Ga0070677_10067291
233 Ga0070680_100010353
234 Ga0070689_100011784
235 Ga0070671_100027552
236 Ga0070674_100046858
237 Ga0070713_100050847
238 Ga0070678_100224819
239 Ga0070681_10015902
240 Ga0070681_10018567
241 Ga0070699_100070494
242 Ga0070679_100031149
243 Ga0070679_100181703
244 Ga0070697_100026075
245 Ga0070696_100000434
246 Ga0070696_100070794
247 Ga0070693_100003959
248 Ga0070665_100111272
249 Ga0070664_100021736
250 Ga0068864_100015570
251 Ga0081540_1000175
252 Ga0081540_1016846
253 Ga0081539_10000784
254 Ga0070717_10217756
255 Ga0070716_100058850
256 Ga0070712_100031655
257 Ga0075428_100087530
258 Ga0075433_10049685
259 Ga0075434_100185402
260 Ga0075436_100000262
261 Ga0111539_10060114
262 Ga0114129_10099373
263 Ga0105243_10052719
264 Ga0105242_10019513
265 Ga0105242_10021508
266 Ga0105248_10021063
267 Ga0105238_10111681
268 Ga0105249_10156982
269 Ga0157378_10024801
270 Ga0163162_10026946
271 Ga0163162_10174738
272 Ga0163162_10195144
273 Ga0157380_10059826
274 Ga0157377_10106244
275 Ga0209758_1003698
276 Ga0207697_10071715
277 Ga0207707_10003497
278 Ga0207707_10098924
279 Ga0207693_10022367
280 Ga0207660_10004230
281 Ga0207649_10033303
282 Ga0207652_10130747
283 Ga0207681_10009625
284 Ga0207686_10009577
285 Ga0207686_10243025
286 Ga0207670_10007530
287 Ga0207670_10008658
288 Ga0207669_10018082
289 Ga0207665_10174173
290 Ga0207689_10162859
291 Ga0207679_10132410
292 Ga0207703_10261853
293 Ga0207676_10010202
294 Ga0207674_10096227
295 Ga0207675_100049768
296 Ga0207683_10019168
297 Ga0209588_1031570
298 Ga0265357_1000615
299 Ga0268266_10063307
300 Ga0265338_10004716
301 Ga0265760_10032937
302 Ga0265332_10055247
303 Ga0265325_10005599
304 Ga0265339_10000101
305 Ga0265339_10014143
306 Ga0307408_100087227
307 Ga0265313_10000548
308 Ga0265342_10000989
309 Ga0373926_0001766
310 Ga0373929_0020439
311 Ga0373940_0025233
312 Ga0373936_0013216
313 Ga0373936_0046895
314 Ga0373939_0022119
315 Ga0373954_0002495
316 Ga0373943_0002893
317 Ga0373946_0047231
318 Ga0373955_0058397
319 Ga0373931_0001370
320 Ga0373931_0002382
321 Ga0373931_0018983
322 Ga0373935_0008229
323 Ga0373927_0006897
324 Ga0373927_0062515
325 Ga0373947_0007678
326 Ga0373937_0200433
327 Ga0373925_0004967
328 Ga0373925_0015169
329 Ga0373925_0016014
330 Ga0373925_0087350
331 Ga0373925_0243322
332 Ga0436364_0096203
333 Ga0436364_1543736
334 Ga0436365_1873022
335 Ga0466966_0059629
336 Ga0466957_0031717
337 Ga0451576_0005377
338 Ga0451576_0125236
339 Ga0495592_0002566
340 Ga0495592_0022552
341 Ga0495629_0080647
342 Ga0495653_0143980
343 Ga0495580_0021239
344 Ga0495662_0000833
345 Ga0495662_0012796
346 Ga0495664_0000260
347 Ga0495608_0064901
348 Ga0495628_0005289
349 Ga0495628_0080559
350 Ga0495628_0113236
351 Ga0495628_0254925
352 Ga0495630_0000776
353 Ga0495630_0023570
354 Ga0495630_0035705
355 Ga0495666_0022994
356 Ga0495652_0011004
357 Ga0495665_0018660
358 Ga0495640_0001275
359 Ga0495640_0011625
360 Ga0495586_0009349
361 Ga0495645_0000858
362 Ga0495645_0004741
363 Ga0495634_0009614
364 Ga0495634_0017585
365 Ga0495635_0045910
366 Ga0495599_0001807
367 Ga0495669_0054816
368 Ga0495613_0006500
369 Ga0495624_0010908
370 Ga0495624_0165386
371 Ga0495581_0087287
372 Ga0495674_0000957
373 Ga0495674_0167679
374 Ga0495674_0251485
375 Ga0495676_0036686
376 Ga0495680_0009272
377 Ga0495684_0002623
378 Ga0495684_0007957
379 Ga0495593_0010240
380 Ga0496102_0155982
381 Ga0496104_0003323
382 Ga0496104_0044923
383 Ga0496104_0204096
384 Ga0496105_0004464
385 Ga0496105_0213775
386 Ga0496107_0131538
387 Ga0496109_0302938
388 Ga0496110_0024374
389 Ga0496111_0008747
390 Ga0496112_0275818
391 Ga0496113_0089382
392 Ga0496114_0069508
393 Ga0501031_0082071
394 Ga0501032_0019024
395 Ga0501033_0022177
396 Ga0501034_0023787
397 Ga0501034_0053164
398 Ga0501034_0152567
399 Ga0501034_0162993
400 Ga0501037_0029987
401 Ga0501038_0042430
402 Ga0501038_0141762
403 Ga0501040_0002840
404 Ga0501042_0228758
405 Ga0501043_0139884
406 Ga0501046_0014006
407 Ga0501047_0044705
408 Ga0501048_0015283
409 Ga0501048_0048965
410 Ga0501067_0024235
411 Ga0501067_0125892
412 Ga0501068_0011550
413 Ga0501069_0007879
414 Ga0501070_0009918
415 Ga0501070_0052289
416 Ga0501071_0057278
417 Ga0501072_0076649
418 Ga0501072_0088113
419 Ga0501073_0092120
420 Ga0501074_0020648
421 Ga0501075_0082024
422 Ga0501076_0000718
423 Ga0501076_0047620
424 Ga0501079_0008196
425 Ga0501080_0025170
426 Ga0501080_0102898
427 Ga0501081_0001411
428 Ga0501035_0036080
429 Ga0501044_0001147
430 Ga0501044_0011064
431 Ga0501044_0183289
432 Ga0501045_0062186
433 nmdc:mga0k408_643_c1
434 nmdc:mga08y16_125929_c1
435 nmdc:mga08y16_50588_c1
436 nmdc:mga0rr50_65732_c1
437 nmdc:mga08x19_13853_c1
438 nmdc:mga08x19_54748_c1
439 nmdc:mga08x19_73643_c1
440 Ga0495601_0015574
441 Ga0495601_0073544
442 Ga0495612_0012761
443 Ga0495595_0041659
444 Ga0495619_0003435
445 Ga0495619_0038782
446 Ga0500652_064299
447 Ga0500590_001674
448 Ga0501084_0038333
449 Ga0501082_0050462
450 Ga0530510_0003565
451 2904583615
452 2919124466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

266

444

0.94

PF12832

MFS_1_like

MFS_1 like family

70

421

0.86

PF07690

MFS_1

Major Facilitator Superfamily

56

313

0.85

PF13347

MFS_2

MFS/sugar transport protein

176

441

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wdo-assembly1.cif.gz_A structure of e. coli yajr transporter 0.8324 17 391
8dl7-assembly1.cif.gz_A cryo-em structure of human ferroportin/slc40 bound to minihepcidin pr73 in nanodisc 0.8096 18 399
5ayn-assembly1.cif.gz_A crystal structure of a bacterial homologue of iron transporter ferroportin in outward-facing state 0.799 18 391
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.7983 17 394
6gv1-assembly1.cif.gz_A crystal structure of e.coli multidrug/h+ antiporter mdfa in outward open conformation with bound fab fragment 0.7952 14 391
ID Description Score Start End Superfamily
af_P09836_19_223_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9477 19 188 1.20.1250.20
af_P0AA80_9_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.935 16 189 1.20.1250.20
af_K7ML12_100_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9341 16 190 1.20.1250.20
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9315 16 188 1.20.1250.20
af_A0A1D8PSE5_44_249_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9305 19 189 1.20.1250.20
ID Description Score Start End GO Terms
AF-S0ARK1-F1-model_v4 Resistance protein NorA 0.9324 17 191 GO:0005886
GO:0022857
AF-A0A2E9XNC2-F1-model_v4 MFS transporter 0.9236 16 191 GO:0005886
GO:0046943
AF-A0A6V8NNU3-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9227 18 189 GO:0016020
GO:0022857
AF-A0A6V8HGI4-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.913 19 191 GO:0016020
GO:0022857
AF-A0A2W5BUW7-F1-model_v4 deleted 0.9124 25 188

Map