F338594

General Info

Members Datasets Scaffolds Average Seq Length
226 134 452 220

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100151198|Ga0070713_1001511982
Length 228
Sequence MKFGIVRFPGSCDDIDALRAAERVGEAELLWHADRDLRGVDAVVVPGGFSYGDYLRAGAIARFAPVMEEVAEFAREGGLVLGICNGFQVLCEAKLLPGALLPNVSLRFVFRQVELEVVRSDSAFTCTCDVGPPAQRLSIPVKHTTGRFYAPDDELDRLEAMGQVLLRYAPGHNPNGSLRDIAGVRNERGNVFGLMPHPEHAVDPLMGGTDGLKIFESIKAHVADGVLV

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
78 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
79 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.98
Rhizosphere 87.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100151198 3300005436 Bacteria 2065
2 JGI25406J46586_10026633 3300003203 Bacteria 2226
3 Ga0070683_100724829 3300005329 Bacteria 952
4 Ga0068868_100017017 3300005338 Bacteria 5409
5 Ga0070692_10308963 3300005345 Bacteria 968
6 Ga0070659_100062781 3300005366 Bacteria 2937
7 Ga0070714_100273854 3300005435 Bacteria 1566
8 Ga0070714_100737175 3300005435 Bacteria 952
9 Ga0070713_100437726 3300005436 Bacteria 1226
10 Ga0070663_100058343 3300005455 Bacteria 2772
11 Ga0070679_100144838 3300005530 Bacteria 2354
12 Ga0070665_100000791 3300005548 Bacteria 41601
13 Ga0070665_100364352 3300005548 Bacteria 1452
14 Ga0070664_100213766 3300005564 Bacteria 1724
15 Ga0068856_100009049 3300005614 Bacteria 9690
16 Ga0068856_100128732 3300005614 Bacteria 2535
17 Ga0070702_100344067 3300005615 Bacteria 1048
18 Ga0068864_100025010 3300005618 Bacteria 5026
19 Ga0068870_10377087 3300005840 Bacteria 917
20 Ga0081455_10256794 3300005937 Bacteria 1275
21 Ga0081538_10062437 3300005981 Bacteria 2125
22 Ga0081538_10078021 3300005981 Bacteria 1780
23 Ga0081538_10130649 3300005981 Bacteria 1181
24 Ga0081539_10005099 3300005985 Bacteria 13751
25 Ga0081539_10005211 3300005985 Bacteria 13472
26 Ga0081539_10062058 3300005985 Bacteria 2044
27 Ga0075432_10048268 3300006058 Bacteria 1498
28 Ga0070712_100075523 3300006175 Bacteria 2424
29 Ga0075428_100033486 3300006844 Bacteria 5673
30 Ga0075428_100049388 3300006844 Bacteria 4616
31 Ga0075430_100061310 3300006846 Bacteria 3161
32 Ga0075431_100025995 3300006847 Bacteria 6001
33 Ga0075433_10120748 3300006852 Bacteria 2327
34 Ga0075429_100167828 3300006880 Bacteria 1923
35 Ga0075429_100189006 3300006880 Bacteria 1805
36 Ga0075436_100015293 3300006914 Bacteria 5256
37 Ga0075435_100042070 3300007076 Bacteria 3654
38 Ga0111539_10016386 3300009094 Bacteria 9190
39 Ga0111539_10276761 3300009094 Bacteria 1953
40 Ga0105245_10009291 3300009098 Bacteria 8574
41 Ga0105245_10487220 3300009098 Bacteria 1247
42 Ga0105245_10852138 3300009098 Bacteria 951
43 Ga0114129_10009283 3300009147 Bacteria 14024
44 Ga0114129_10051104 3300009147 Bacteria 5804
45 Ga0114129_10102030 3300009147 Bacteria 3968
46 Ga0105243_10083161 3300009148 Bacteria 2618
47 Ga0105248_11194386 3300009177 Bacteria 860
48 Ga0105237_10539525 3300009545 Bacteria 1173
49 Ga0105237_11171488 3300009545 Bacteria 775
50 Ga0105239_11075436 3300010375 Bacteria 926
51 Ga0157369_10749750 3300013105 Bacteria 1004
52 Ga0163162_10288682 3300013306 Bacteria 1772
53 Ga0157372_10029490 3300013307 Bacteria 5992
54 Ga0157372_11258436 3300013307 Bacteria 854
55 Ga0157375_10010066 3300013308 Bacteria 8315
56 Ga0163163_10440872 3300014325 Bacteria 1362
57 Ga0157380_10415673 3300014326 Bacteria 1281
58 Ga0157376_10048300 3300014969 Bacteria 3518
59 Ga0213873_10025381 3300021358 Bacteria 1430
60 Ga0213873_10036596 3300021358 Bacteria 1247
61 Ga0213874_10045189 3300021377 Bacteria 1333
62 Ga0213876_10067306 3300021384 Bacteria 1891
63 Ga0213876_10104534 3300021384 Bacteria 1502
64 Ga0213876_10105214 3300021384 Bacteria 1497
65 Ga0213876_10146337 3300021384 Bacteria 1256
66 Ga0213876_10226703 3300021384 Bacteria 993
67 Ga0213875_10028446 3300021388 Bacteria 2654
68 Ga0207688_10001454 3300025901 Bacteria 12404
69 Ga0207699_10115154 3300025906 Bacteria 1730
70 Ga0207705_10549414 3300025909 Bacteria 898
71 Ga0207707_10472908 3300025912 Bacteria 1071
72 Ga0207693_10026290 3300025915 Bacteria 4607
73 Ga0207657_10078771 3300025919 Bacteria 2774
74 Ga0207657_10603408 3300025919 Bacteria 856
75 Ga0207652_10115793 3300025921 Bacteria 2381
76 Ga0207681_10402608 3300025923 Bacteria 1106
77 Ga0207687_10421844 3300025927 Bacteria 1101
78 Ga0207700_10188308 3300025928 Bacteria 1733
79 Ga0207664_10242268 3300025929 Bacteria 1571
80 Ga0207664_10707815 3300025929 Bacteria 906
81 Ga0207690_10080601 3300025932 Bacteria 2272
82 Ga0207690_10129630 3300025932 Bacteria 1844
83 Ga0207706_10003617 3300025933 Bacteria 14773
84 Ga0207706_10194032 3300025933 Bacteria 1782
85 Ga0207709_10191120 3300025935 Bacteria 1454
86 Ga0207691_10653078 3300025940 Bacteria 889
87 Ga0207689_10351727 3300025942 Bacteria 1225
88 Ga0207640_10495607 3300025981 Bacteria 1016
89 Ga0207678_10072146 3300026067 Bacteria 2959
90 Ga0207702_10007119 3300026078 Bacteria 9572
91 Ga0207702_10674986 3300026078 Bacteria 1017
92 Ga0207675_100002227 3300026118 Bacteria 19271
93 Ga0207675_100368063 3300026118 Bacteria 1411
94 Ga0207698_10102626 3300026142 Bacteria 2375
95 Ga0207428_10117430 3300027907 Bacteria 2042
96 Ga0307405_10007193 3300031731 Bacteria 5544
97 Ga0307405_10451754 3300031731 Bacteria 1019
98 Ga0307413_10081922 3300031824 Bacteria 2071
99 Ga0307413_10581967 3300031824 Bacteria 913
100 Ga0307410_10105512 3300031852 Bacteria 2028
101 Ga0307406_10047440 3300031901 Bacteria 2707
102 Ga0307406_10285431 3300031901 Bacteria 1261
103 Ga0307407_10127832 3300031903 Bacteria 1621
104 Ga0307409_100103584 3300031995 Bacteria 2367
105 Ga0307409_100191833 3300031995 Bacteria 1819
106 Ga0307416_100000355 3300032002 Bacteria 23746
107 Ga0307416_100014487 3300032002 Bacteria 5409
108 Ga0307416_100103069 3300032002 Bacteria 2490
109 Ga0307416_100333992 3300032002 Bacteria 1525
110 Ga0307416_100627488 3300032002 Bacteria 1157
111 Ga0307411_10839927 3300032005 Bacteria 812
112 Ga0307415_100000223 3300032126 Bacteria 24913
113 Ga0307415_100007659 3300032126 Bacteria 5925
114 Ga0307415_100203399 3300032126 Bacteria 1573
115 Ga0307415_100222792 3300032126 Bacteria 1513
116 Ga0307415_100340525 3300032126 Bacteria 1258
117 Ga0373932_0018736 3300035112 Bacteria 1794
118 Ga0373941_0023925 3300035115 Bacteria 1749
119 Ga0373961_0027813 3300035241 Bacteria 1555
120 Ga0395900_0003093 3300037418 Bacteria 18071
121 Ga0395900_0067779 3300037418 Bacteria 3666
122 Ga0395900_0258586 3300037418 Bacteria 1740
123 Ga0395900_0263021 3300037418 Bacteria 1722
124 Ga0395898_0001575 3300037466 Bacteria 31235
125 Ga0395898_0061740 3300037466 Bacteria 3641
126 Ga0395898_0437647 3300037466 Bacteria 1246
127 Ga0395905_0020528 3300037471 Bacteria 6257
128 Ga0436364_0475204 3300037853 Bacteria 11217
129 Ga0436364_1454815 3300037853 Bacteria 3857
130 Ga0395901_0006455 3300038443 Bacteria 11885
131 Ga0395901_0070397 3300038443 Bacteria 3644
132 Ga0395901_0307990 3300038443 Bacteria 1641
133 Ga0395901_0602251 3300038443 Bacteria 1108
134 Ga0436365_0340623 3300039437 Bacteria 3828
135 Ga0436365_0774149 3300039437 Bacteria 4916
136 Ga0436365_0791702 3300039437 Bacteria 16108
137 Ga0436365_1280724 3300039437 Bacteria 7614
138 Ga0436365_1515311 3300039437 Bacteria 3789
139 Ga0436365_1893368 3300039437 Bacteria 3043
140 Ga0436360_0637173 3300039438 Bacteria 1379
141 Ga0436360_0769576 3300039438 Bacteria 2417
142 Ga0436363_0293285 3300039450 Bacteria 3667
143 Ga0436363_0776253 3300039450 Bacteria 6130
144 Ga0436363_1305320 3300039450 Bacteria 1545
145 Ga0436363_1633882 3300039450 Bacteria 3903
146 Ga0436362_0783578 3300039453 Bacteria 4203
147 Ga0436362_1226039 3300039453 Bacteria 1678
148 Ga0466969_0004777 3300044656 Bacteria 7215
149 Ga0466966_0056809 3300044684 Bacteria 2475
150 Ga0466966_0061038 3300044684 Bacteria 2379
151 Ga0466966_0062476 3300044684 Bacteria 2348
152 Ga0466966_0072382 3300044684 Bacteria 2158
153 Ga0466966_0115143 3300044684 Bacteria 1655
154 Ga0466966_0194935 3300044684 Bacteria 1227
155 Ga0466961_0003340 3300044693 Bacteria 10017
156 Ga0466961_0041204 3300044693 Bacteria 2961
157 Ga0466963_0008777 3300044694 Bacteria 6071
158 Ga0466963_0021209 3300044694 Bacteria 4095
159 Ga0466963_0074118 3300044694 Bacteria 2295
160 Ga0466963_0353250 3300044694 Bacteria 1035
161 Ga0466971_0147254 3300044719 Bacteria 1098
162 Ga0466957_0049803 3300044842 Bacteria 2548
163 Ga0466957_0186874 3300044842 Bacteria 1355
164 Ga0466960_0221617 3300044901 Bacteria 1041
165 Ga0466960_0247847 3300044901 Bacteria 988
166 Ga0466959_0004790 3300045049 Bacteria 9130
167 Ga0466959_0008152 3300045049 Bacteria 7389
168 Ga0466959_0009194 3300045049 Bacteria 7018
169 Ga0466959_0098304 3300045049 Bacteria 2097
170 Ga0466959_0132745 3300045049 Bacteria 1764
171 Ga0466959_0192370 3300045049 Bacteria 1423
172 Ga0466959_0230539 3300045049 Bacteria 1282
173 Ga0466959_0299249 3300045049 Bacteria 1102
174 Ga0466958_0012531 3300045836 Bacteria 4807
175 Ga0466958_0040159 3300045836 Bacteria 2812
176 Ga0466958_0044153 3300045836 Bacteria 2686
177 Ga0466958_0044935 3300045836 Bacteria 2663
178 Ga0466958_0053775 3300045836 Bacteria 2441
179 Ga0466958_0108404 3300045836 Bacteria 1732
180 Ga0466958_0225394 3300045836 Bacteria 1196
181 Ga0466967_0003233 3300045976 Bacteria 10534
182 Ga0466967_0052522 3300045976 Bacteria 3578
183 Ga0466967_0063558 3300045976 Bacteria 3280
184 Ga0495653_0190519 3300046463 Bacteria 1400
185 Ga0495596_0045289 3300046500 Bacteria 1730
186 Ga0495643_0329283 3300046522 Bacteria 689
187 Ga0495609_0058353 3300046538 Bacteria 1707
188 Ga0495674_0470637 3300047319 Bacteria 1008
189 Ga0495602_0179636 3300048088 Bacteria 1634
190 Ga0496101_0256519 3300048904 Bacteria 1363
191 Ga0496104_0266157 3300048907 Bacteria 1627
192 Ga0496105_0694318 3300048908 Bacteria 782
193 Ga0496107_0359171 3300048910 Bacteria 1084
194 Ga0496108_0360171 3300048911 Bacteria 1269
195 Ga0496109_0015321 3300048912 Bacteria 6678
196 Ga0496109_0756119 3300048912 Bacteria 910
197 Ga0496113_0436098 3300048916 Bacteria 1052
198 Ga0496114_0123411 3300048917 Bacteria 2230
199 Ga0501041_0064548 3300049577 Bacteria 2242
200 Ga0501046_0174611 3300049580 Bacteria 1610
201 Ga0501071_0105138 3300049587 Bacteria 2084
202 Ga0501074_0206055 3300049590 Bacteria 1401
203 Ga0501075_0175715 3300049591 Bacteria 1634
204 Ga0501075_0205846 3300049591 Bacteria 1501
205 Ga0501076_0678832 3300049592 Bacteria 850
206 Ga0501079_0103915 3300049741 Bacteria 2204
207 Ga0501079_0745637 3300049741 Bacteria 771
208 Ga0501081_0107705 3300049743 Bacteria 1976
209 Ga0501045_0175282 3300049824 Bacteria 1597
210 nmdc:mga05p37_17901_c1 3300050507 Bacteria 8553
211 nmdc:mga05p37_413364_c1 3300050507 Bacteria 1572
212 nmdc:mga0qj67_315540_c1 3300050509 Bacteria 1266
213 nmdc:mga06r32_1029242_c1 3300050510 Bacteria 775
214 nmdc:mga08y16_135896_c1 3300050511 Bacteria 2555
215 nmdc:mga08y16_143237_c1 3300050511 Bacteria 2485
216 nmdc:mga0n895_91892_c1 3300050512 Bacteria 3038
217 nmdc:mga0rr50_36072_c1 3300050513 Bacteria 3557
218 nmdc:mga08x19_75493_c1 3300050514 Bacteria 2204
219 nmdc:mga0a205_350501_c1 3300050515 Bacteria 1344
220 Ga0495655_0045400 3300053083 Bacteria 1141
221 Ga0495619_0089039 3300053085 Bacteria 2088
222 Ga0501084_0491173 3300054114 Bacteria 1037
223 Ga0466962_0034519 3300061719 Bacteria 2421
224 Ga0466962_0138542 3300061719 Bacteria 1178
225 Ga0466962_0171043 3300061719 Bacteria 1058
226 Ga0530510_0401600 3300061734 Bacteria 1033
227 Ga0070713_100151198
228 JGI25406J46586_10026633
229 Ga0070683_100724829
230 Ga0068868_100017017
231 Ga0070692_10308963
232 Ga0070659_100062781
233 Ga0070714_100273854
234 Ga0070714_100737175
235 Ga0070713_100437726
236 Ga0070663_100058343
237 Ga0070679_100144838
238 Ga0070665_100000791
239 Ga0070665_100364352
240 Ga0070664_100213766
241 Ga0068856_100009049
242 Ga0068856_100128732
243 Ga0070702_100344067
244 Ga0068864_100025010
245 Ga0068870_10377087
246 Ga0081455_10256794
247 Ga0081538_10062437
248 Ga0081538_10078021
249 Ga0081538_10130649
250 Ga0081539_10005099
251 Ga0081539_10005211
252 Ga0081539_10062058
253 Ga0075432_10048268
254 Ga0070712_100075523
255 Ga0075428_100033486
256 Ga0075428_100049388
257 Ga0075430_100061310
258 Ga0075431_100025995
259 Ga0075433_10120748
260 Ga0075429_100167828
261 Ga0075429_100189006
262 Ga0075436_100015293
263 Ga0075435_100042070
264 Ga0111539_10016386
265 Ga0111539_10276761
266 Ga0105245_10009291
267 Ga0105245_10487220
268 Ga0105245_10852138
269 Ga0114129_10009283
270 Ga0114129_10051104
271 Ga0114129_10102030
272 Ga0105243_10083161
273 Ga0105248_11194386
274 Ga0105237_10539525
275 Ga0105237_11171488
276 Ga0105239_11075436
277 Ga0157369_10749750
278 Ga0163162_10288682
279 Ga0157372_10029490
280 Ga0157372_11258436
281 Ga0157375_10010066
282 Ga0163163_10440872
283 Ga0157380_10415673
284 Ga0157376_10048300
285 Ga0213873_10025381
286 Ga0213873_10036596
287 Ga0213874_10045189
288 Ga0213876_10067306
289 Ga0213876_10104534
290 Ga0213876_10105214
291 Ga0213876_10146337
292 Ga0213876_10226703
293 Ga0213875_10028446
294 Ga0207688_10001454
295 Ga0207699_10115154
296 Ga0207705_10549414
297 Ga0207707_10472908
298 Ga0207693_10026290
299 Ga0207657_10078771
300 Ga0207657_10603408
301 Ga0207652_10115793
302 Ga0207681_10402608
303 Ga0207687_10421844
304 Ga0207700_10188308
305 Ga0207664_10242268
306 Ga0207664_10707815
307 Ga0207690_10080601
308 Ga0207690_10129630
309 Ga0207706_10003617
310 Ga0207706_10194032
311 Ga0207709_10191120
312 Ga0207691_10653078
313 Ga0207689_10351727
314 Ga0207640_10495607
315 Ga0207678_10072146
316 Ga0207702_10007119
317 Ga0207702_10674986
318 Ga0207675_100002227
319 Ga0207675_100368063
320 Ga0207698_10102626
321 Ga0207428_10117430
322 Ga0307405_10007193
323 Ga0307405_10451754
324 Ga0307413_10081922
325 Ga0307413_10581967
326 Ga0307410_10105512
327 Ga0307406_10047440
328 Ga0307406_10285431
329 Ga0307407_10127832
330 Ga0307409_100103584
331 Ga0307409_100191833
332 Ga0307416_100000355
333 Ga0307416_100014487
334 Ga0307416_100103069
335 Ga0307416_100333992
336 Ga0307416_100627488
337 Ga0307411_10839927
338 Ga0307415_100000223
339 Ga0307415_100007659
340 Ga0307415_100203399
341 Ga0307415_100222792
342 Ga0307415_100340525
343 Ga0373932_0018736
344 Ga0373941_0023925
345 Ga0373961_0027813
346 Ga0395900_0003093
347 Ga0395900_0067779
348 Ga0395900_0258586
349 Ga0395900_0263021
350 Ga0395898_0001575
351 Ga0395898_0061740
352 Ga0395898_0437647
353 Ga0395905_0020528
354 Ga0436364_0475204
355 Ga0436364_1454815
356 Ga0395901_0006455
357 Ga0395901_0070397
358 Ga0395901_0307990
359 Ga0395901_0602251
360 Ga0436365_0340623
361 Ga0436365_0774149
362 Ga0436365_0791702
363 Ga0436365_1280724
364 Ga0436365_1515311
365 Ga0436365_1893368
366 Ga0436360_0637173
367 Ga0436360_0769576
368 Ga0436363_0293285
369 Ga0436363_0776253
370 Ga0436363_1305320
371 Ga0436363_1633882
372 Ga0436362_0783578
373 Ga0436362_1226039
374 Ga0466969_0004777
375 Ga0466966_0056809
376 Ga0466966_0061038
377 Ga0466966_0062476
378 Ga0466966_0072382
379 Ga0466966_0115143
380 Ga0466966_0194935
381 Ga0466961_0003340
382 Ga0466961_0041204
383 Ga0466963_0008777
384 Ga0466963_0021209
385 Ga0466963_0074118
386 Ga0466963_0353250
387 Ga0466971_0147254
388 Ga0466957_0049803
389 Ga0466957_0186874
390 Ga0466960_0221617
391 Ga0466960_0247847
392 Ga0466959_0004790
393 Ga0466959_0008152
394 Ga0466959_0009194
395 Ga0466959_0098304
396 Ga0466959_0132745
397 Ga0466959_0192370
398 Ga0466959_0230539
399 Ga0466959_0299249
400 Ga0466958_0012531
401 Ga0466958_0040159
402 Ga0466958_0044153
403 Ga0466958_0044935
404 Ga0466958_0053775
405 Ga0466958_0108404
406 Ga0466958_0225394
407 Ga0466967_0003233
408 Ga0466967_0052522
409 Ga0466967_0063558
410 Ga0495653_0190519
411 Ga0495596_0045289
412 Ga0495643_0329283
413 Ga0495609_0058353
414 Ga0495674_0470637
415 Ga0495602_0179636
416 Ga0496101_0256519
417 Ga0496104_0266157
418 Ga0496105_0694318
419 Ga0496107_0359171
420 Ga0496108_0360171
421 Ga0496109_0015321
422 Ga0496109_0756119
423 Ga0496113_0436098
424 Ga0496114_0123411
425 Ga0501041_0064548
426 Ga0501046_0174611
427 Ga0501071_0105138
428 Ga0501074_0206055
429 Ga0501075_0175715
430 Ga0501075_0205846
431 Ga0501076_0678832
432 Ga0501079_0103915
433 Ga0501079_0745637
434 Ga0501081_0107705
435 Ga0501045_0175282
436 nmdc:mga05p37_17901_c1
437 nmdc:mga05p37_413364_c1
438 nmdc:mga0qj67_315540_c1
439 nmdc:mga06r32_1029242_c1
440 nmdc:mga08y16_135896_c1
441 nmdc:mga08y16_143237_c1
442 nmdc:mga0n895_91892_c1
443 nmdc:mga0rr50_36072_c1
444 nmdc:mga08x19_75493_c1
445 nmdc:mga0a205_350501_c1
446 Ga0495655_0045400
447 Ga0495619_0089039
448 Ga0501084_0491173
449 Ga0466962_0034519
450 Ga0466962_0138542
451 Ga0466962_0171043
452 Ga0530510_0401600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

28

104

0.89

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

1

211

0.87

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

5

98

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9101 2 214
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.8774 2 214
7dw7-assembly1.cif.gz_A crystal structure of n1051a mutant of formylglycinamidine synthetase 0.8726 2 213
6jta-assembly1.cif.gz_A crystal structure of d464a l465a mutant of fgam synthetase 0.8724 2 213
6lyk-assembly1.cif.gz_A crystal structure of r1263a mutant of formylglycinamidine synthetase 0.8722 2 213
ID Description Score Start End Superfamily
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.93 2 214 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9256 1 214 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9241 1 214 3.40.50.880
3d54L00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9097 2 214 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9013 2 214 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7V9PNY6-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (Glutaminase PurQ) (EC 3.5.1.2) (Phosphoribosylformylglycinamidine synthase subunit I) 0.9504 1 214 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A7V3P922-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9464 115 214 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A7C1QIL9-F1-model_v4 Phosphoribosylformylglycinamidine synthase I (EC 6.3.5.3) 0.9439 74 214 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A7W0LZ05-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (Glutaminase PurQ) (EC 3.5.1.2) (Phosphoribosylformylglycinamidine synthase subunit I) 0.9425 1 214 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A7V9P6S3-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9418 72 214 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787

Map