F338246

General Info

Members Datasets Scaffolds Average Seq Length
225 130 450 249

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0119934|Ga0501076_0119934_993_1781
Length 262
Sequence MGEGREMSGIALAMHQFRFDQKTFWRNPASVFFTVLLPVIFLLIFATIFGDDRIEELGGVETTTYYVPAIIALAVVSATLQSLAISLTVDRENGLLKRTRGTPLPSSVFIGGRVGNSIVVSVLMLIVLAALGRVLYGVEIPWERLPAVLVTLSVGAAAFSCLGIAITAAIPSEDAAAPITNVAVLPLYFLSGIFIPESEIPSGVLHVADAFPIRHFFEAFFTAWDPATVGAGFEWGHLAVVGLWGLAGLAIAIRTFRWTPRA

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
81 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
84 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
126 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
127 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.78
Nodule 0
Rhizoplane 10.67
Rhizosphere 75.11
Stem 0
Stem Tuber 0
Unclassified 4.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0119934 3300049592 Bacteria 2130
2 Ga0070682_100000045 3300005337 Bacteria 131960
3 Ga0070661_100000023 3300005344 Bacteria 123104
4 Ga0070668_100030126 3300005347 Bacteria 4125
5 Ga0070668_100346789 3300005347 Bacteria 1256
6 Ga0070668_100350138 3300005347 Bacteria 1250
7 Ga0070675_100000101 3300005354 Bacteria 50140
8 Ga0070673_100305733 3300005364 Bacteria 1401
9 Ga0070688_100000068 3300005365 Bacteria 50778
10 Ga0070667_100006419 3300005367 Bacteria 9773
11 Ga0070667_100055283 3300005367 Bacteria 3352
12 Ga0070706_100297210 3300005467 Bacteria 1507
13 Ga0070672_100000027 3300005543 Bacteria 67016
14 Ga0070686_100114323 3300005544 Bacteria 1844
15 Ga0070696_100294890 3300005546 Unclassified 1240
16 Ga0070665_100001955 3300005548 Bacteria 23184
17 Ga0070665_100096761 3300005548 Bacteria 2957
18 Ga0070665_100255424 3300005548 Bacteria 1753
19 Ga0070704_100171450 3300005549 Bacteria 1726
20 Ga0068856_100000577 3300005614 Bacteria 40018
21 Ga0068851_10018721 3300005834 Bacteria 3340
22 Ga0068862_100000973 3300005844 Bacteria 27530
23 Ga0081455_10031274 3300005937 Bacteria 4819
24 Ga0081455_10045334 3300005937 Bacteria 3826
25 Ga0081455_10049096 3300005937 Bacteria 3640
26 Ga0081455_10073189 3300005937 Bacteria 2834
27 Ga0081455_10104496 3300005937 Unclassified 2266
28 Ga0081538_10000066 3300005981 Bacteria 98455
29 Ga0081538_10000514 3300005981 Bacteria 43252
30 Ga0081538_10043255 3300005981 Bacteria 2831
31 Ga0081538_10154872 3300005981 Bacteria 1030
32 Ga0081540_1000306 3300005983 Bacteria 50547
33 Ga0081540_1048059 3300005983 Bacteria 2140
34 Ga0081539_10000791 3300005985 Bacteria 61600
35 Ga0081539_10065252 3300005985 Bacteria 1978
36 Ga0075365_10000574 3300006038 Bacteria 14263
37 Ga0075365_10000626 3300006038 Bacteria 13933
38 Ga0075365_10003597 3300006038 Bacteria 8022
39 Ga0075365_10041250 3300006038 Bacteria 3014
40 Ga0075365_10055947 3300006038 Bacteria 2621
41 Ga0075365_10079987 3300006038 Bacteria 2212
42 Ga0075365_10081521 3300006038 Bacteria 2192
43 Ga0075365_10178429 3300006038 Unclassified 1484
44 Ga0075365_10181076 3300006038 Archaea 1473
45 Ga0075368_10167069 3300006042 Unclassified 924
46 Ga0075363_100062184 3300006048 Bacteria 2013
47 Ga0075363_100101839 3300006048 Bacteria 1590
48 Ga0075363_100110094 3300006048 Bacteria 1530
49 Ga0075364_10009625 3300006051 Bacteria 5805
50 Ga0075364_10026157 3300006051 Bacteria 3721
51 Ga0075364_10089754 3300006051 Bacteria 2038
52 Ga0068871_100104650 3300006358 Bacteria 2374
53 Ga0075428_100025755 3300006844 Bacteria 6515
54 Ga0075430_100040828 3300006846 Bacteria 3926
55 Ga0075430_100053070 3300006846 Bacteria 3414
56 Ga0075430_100123711 3300006846 Bacteria 2156
57 Ga0075431_100000075 3300006847 Bacteria 57994
58 Ga0075431_100559848 3300006847 Bacteria 1130
59 Ga0075433_10324032 3300006852 Bacteria 1363
60 Ga0075434_100003025 3300006871 Bacteria 14950
61 Ga0075434_100146529 3300006871 Bacteria 2381
62 Ga0075434_100411091 3300006871 Bacteria 1374
63 Ga0075434_100737671 3300006871 Bacteria 1002
64 Ga0075429_100249927 3300006880 Bacteria 1553
65 Ga0068865_100079380 3300006881 Bacteria 2351
66 Ga0075435_100178966 3300007076 Bacteria 1792
67 Ga0111539_10175534 3300009094 Bacteria 2503
68 Ga0111539_10380423 3300009094 Bacteria 1644
69 Ga0111539_10951713 3300009094 Bacteria 998
70 Ga0105245_10010304 3300009098 Bacteria 8141
71 Ga0105245_10111031 3300009098 Bacteria 2550
72 Ga0105245_10310983 3300009098 Bacteria 1549
73 Ga0114129_10115628 3300009147 Bacteria 3697
74 Ga0114129_10130095 3300009147 Bacteria 3459
75 Ga0114129_10131402 3300009147 Bacteria 3438
76 Ga0105243_10081497 3300009148 Bacteria 2642
77 Ga0105243_10116023 3300009148 Bacteria 2249
78 Ga0105243_10576179 3300009148 Bacteria 1080
79 Ga0105242_10036499 3300009176 Bacteria 3943
80 Ga0105242_10483393 3300009176 Bacteria 1174
81 Ga0105249_10031507 3300009553 Bacteria 4796
82 Ga0105249_10047360 3300009553 Bacteria 3917
83 Ga0105239_10104990 3300010375 Bacteria 3128
84 Ga0105239_10147040 3300010375 Bacteria 2629
85 Ga0105239_10772283 3300010375 Bacteria 1100
86 Ga0105239_10920587 3300010375 Unclassified 1004
87 Ga0157378_10120979 3300013297 Bacteria 2413
88 Ga0157372_10000129 3300013307 Bacteria 82491
89 Ga0157372_10312545 3300013307 Bacteria 1829
90 Ga0157379_10145927 3300014968 Bacteria 2134
91 Ga0207656_10014832 3300025321 Bacteria 3010
92 Ga0207642_10129411 3300025899 Bacteria 1315
93 Ga0207680_10029541 3300025903 Bacteria 3081
94 Ga0207685_10154993 3300025905 Bacteria 1040
95 Ga0207693_10001560 3300025915 Bacteria 20234
96 Ga0207659_10000010 3300025926 Bacteria 286639
97 Ga0207687_10010033 3300025927 Bacteria 6195
98 Ga0207709_10019446 3300025935 Bacteria 3819
99 Ga0207709_10375604 3300025935 Bacteria 1080
100 Ga0207704_10230659 3300025938 Bacteria 1376
101 Ga0207691_10000136 3300025940 Bacteria 67179
102 Ga0207651_10485807 3300025960 Bacteria 1065
103 Ga0207712_10131295 3300025961 Bacteria 1909
104 Ga0207668_10021187 3300025972 Bacteria 4142
105 Ga0207668_10116099 3300025972 Bacteria 2018
106 Ga0207668_10144035 3300025972 Bacteria 1836
107 Ga0207668_10750985 3300025972 Bacteria 861
108 Ga0207658_10024563 3300025986 Bacteria 4217
109 Ga0207658_10063476 3300025986 Bacteria 2768
110 Ga0207677_10000879 3300026023 Bacteria 16958
111 Ga0207703_10225423 3300026035 Bacteria 1678
112 Ga0207702_10000060 3300026078 Bacteria 125473
113 Ga0207702_10077928 3300026078 Bacteria 2868
114 Ga0207675_100493740 3300026118 Bacteria 1218
115 Ga0207428_10032729 3300027907 Bacteria 4275
116 Ga0268266_10007839 3300028379 Bacteria 9568
117 Ga0268266_10183580 3300028379 Bacteria 1906
118 Ga0268265_10001017 3300028380 Bacteria 25271
119 Ga0268264_10076667 3300028381 Bacteria 2845
120 Ga0316576_10006661 3300031727 Bacteria 7213
121 Ga0307416_100007499 3300032002 Bacteria 6945
122 Ga0307415_100085089 3300032126 Bacteria 2271
123 Ga0307415_100130501 3300032126 Bacteria 1901
124 Ga0316574_0208359 3300035398 Bacteria 1255
125 Ga0316574_0246582 3300035398 Unclassified 1141
126 Ga0395899_0003392 3300037312 Bacteria 12645
127 Ga0395900_0011756 3300037418 Bacteria 8950
128 Ga0395900_0611119 3300037418 Unclassified 1030
129 Ga0395898_0052149 3300037466 Bacteria 3996
130 Ga0395898_0097483 3300037466 Bacteria 2824
131 Ga0395898_0141784 3300037466 Bacteria 2301
132 Ga0395905_0018217 3300037471 Bacteria 6665
133 Ga0395905_0406909 3300037471 Bacteria 1256
134 Ga0395901_0006703 3300038443 Bacteria 11639
135 Ga0395901_0108908 3300038443 Bacteria 2908
136 Ga0395901_0181861 3300038443 Bacteria 2205
137 Ga0395901_0426521 3300038443 Bacteria 1359
138 Ga0451853_1485105 3300041512 Bacteria 1849
139 Ga0466957_0186670 3300044842 Bacteria 1356
140 Ga0466958_0050321 3300045836 Bacteria 2523
141 Ga0495582_0136781 3300046473 Unclassified 1387
142 Ga0495662_0006939 3300046476 Bacteria 5628
143 Ga0495625_0000696 3300046660 Bacteria 47763
144 Ga0495676_0015159 3300047321 Bacteria 6876
145 Ga0496100_0016098 3300048903 Bacteria 4382
146 Ga0496101_0017334 3300048904 Bacteria 4886
147 Ga0496101_0534575 3300048904 Bacteria 927
148 Ga0496102_0016289 3300048905 Bacteria 6492
149 Ga0496103_0006735 3300048906 Bacteria 6856
150 Ga0496104_0008212 3300048907 Bacteria 9268
151 Ga0496105_0011752 3300048908 Bacteria 6928
152 Ga0496107_0004673 3300048910 Bacteria 9294
153 Ga0496108_0000062 3300048911 Bacteria 122391
154 Ga0496108_0456338 3300048911 Bacteria 1116
155 Ga0496109_0000007 3300048912 Bacteria 247554
156 Ga0496109_0000129 3300048912 Bacteria 77469
157 Ga0496109_0290406 3300048912 Bacteria 1541
158 Ga0496110_0000062 3300048913 Bacteria 53333
159 Ga0496110_0256851 3300048913 Bacteria 1591
160 Ga0496111_0000010 3300048914 Bacteria 92600
161 Ga0496111_0021211 3300048914 Bacteria 4533
162 Ga0496111_0105615 3300048914 Bacteria 2073
163 Ga0496112_0156517 3300048915 Bacteria 2246
164 Ga0496112_0290765 3300048915 Bacteria 1580
165 Ga0496113_0101760 3300048916 Bacteria 2227
166 Ga0496114_0025626 3300048917 Bacteria 4821
167 Ga0496114_0050677 3300048917 Bacteria 3456
168 Ga0496115_0016383 3300048918 Bacteria 5644
169 Ga0501034_0056569 3300049571 Bacteria 3946
170 Ga0501034_0101323 3300049571 Bacteria 2873
171 Ga0501038_0364351 3300049574 Bacteria 1124
172 Ga0501038_0417224 3300049574 Unclassified 1036
173 Ga0501039_0316133 3300049575 Bacteria 1228
174 Ga0501040_0538015 3300049576 Bacteria 843
175 Ga0501046_0124961 3300049580 Bacteria 1955
176 Ga0501047_0180307 3300049581 Bacteria 1979
177 Ga0501068_0346129 3300049584 Bacteria 955
178 Ga0501070_0275613 3300049586 Unclassified 1373
179 Ga0501071_0044540 3300049587 Bacteria 3183
180 Ga0501071_0444075 3300049587 Bacteria 993
181 Ga0501072_0006920 3300049588 Bacteria 8609
182 Ga0501074_0349095 3300049590 Bacteria 1050
183 Ga0501076_0042007 3300049592 Bacteria 3600
184 Ga0501077_0016408 3300049593 Bacteria 4666
185 Ga0501077_0213665 3300049593 Bacteria 1226
186 Ga0501079_0011890 3300049741 Bacteria 6642
187 Ga0501079_0364071 3300049741 Bacteria 1133
188 Ga0501081_0009467 3300049743 Bacteria 6351
189 Ga0501044_0146210 3300049823 Bacteria 2349
190 Ga0501045_0171195 3300049824 Bacteria 1617
191 nmdc:mga03n38_39216_c1 3300050490 Bacteria 2053
192 nmdc:mga03n38_70292_c1 3300050490 Bacteria 1618
193 nmdc:mga00v17_112406_c1 3300050491 Bacteria 1728
194 nmdc:mga00v17_214869_c1 3300050491 Bacteria 1245
195 nmdc:mga00v17_22822_c1 3300050491 Bacteria 3615
196 nmdc:mga00v17_4336_c1 3300050491 Bacteria 5249
197 nmdc:mga0yw44_232897_c1 3300050492 Bacteria 1223
198 nmdc:mga0yw44_242732_c1 3300050492 Bacteria 1198
199 nmdc:mga0yw44_32592_c1 3300050492 Bacteria 3037
200 nmdc:mga0yw44_59162_c1 3300050492 Bacteria 2343
201 nmdc:mga0yw44_659140_c1 3300050492 Unclassified 711
202 nmdc:mga0yw44_96487_c1 3300050492 Bacteria 1877
203 nmdc:mga05p37_266049_c1 3300050507 Bacteria 2050
204 nmdc:mga05p37_30818_c1 3300050507 Bacteria 6546
205 nmdc:mga09592_330755_c1 3300050508 Bacteria 1319
206 nmdc:mga09592_340043_c1 3300050508 Bacteria 1299
207 nmdc:mga0qj67_41983_c1 3300050509 Bacteria 3599
208 nmdc:mga06r32_244_c1 3300050510 Bacteria 44802
209 nmdc:mga06r32_485921_c1 3300050510 Bacteria 1213
210 nmdc:mga08y16_220843_c1 3300050511 Bacteria 1962
211 nmdc:mga0n895_111354_c1 3300050512 Bacteria 2754
212 nmdc:mga0n895_186689_c1 3300050512 Bacteria 2104
213 nmdc:mga0n895_7227_c1 3300050512 Bacteria 9509
214 Ga0495612_0009748 3300053078 Bacteria 3890
215 Ga0495619_0000031 3300053085 Bacteria 145508
216 Ga0495619_0002472 3300053085 Bacteria 12091
217 Ga0495619_0056926 3300053085 Bacteria 2593
218 Ga0500644_0072043 3300053088 Bacteria 1248
219 Ga0500641_0028294 3300053096 Bacteria 2188
220 Ga0500554_009284 3300053102 Bacteria 2349
221 Ga0501084_0174109 3300054114 Bacteria 1816
222 Ga0501082_0025729 3300060353 Bacteria 5071
223 Ga0530510_0014022 3300061734 Bacteria 5649
224 Ga0530510_0062394 3300061734 Bacteria 2698
225 Ga0530510_0496626 3300061734 Bacteria 925
226 Ga0501076_0119934
227 Ga0070682_100000045
228 Ga0070661_100000023
229 Ga0070668_100030126
230 Ga0070668_100346789
231 Ga0070668_100350138
232 Ga0070675_100000101
233 Ga0070673_100305733
234 Ga0070688_100000068
235 Ga0070667_100006419
236 Ga0070667_100055283
237 Ga0070706_100297210
238 Ga0070672_100000027
239 Ga0070686_100114323
240 Ga0070696_100294890
241 Ga0070665_100001955
242 Ga0070665_100096761
243 Ga0070665_100255424
244 Ga0070704_100171450
245 Ga0068856_100000577
246 Ga0068851_10018721
247 Ga0068862_100000973
248 Ga0081455_10031274
249 Ga0081455_10045334
250 Ga0081455_10049096
251 Ga0081455_10073189
252 Ga0081455_10104496
253 Ga0081538_10000066
254 Ga0081538_10000514
255 Ga0081538_10043255
256 Ga0081538_10154872
257 Ga0081540_1000306
258 Ga0081540_1048059
259 Ga0081539_10000791
260 Ga0081539_10065252
261 Ga0075365_10000574
262 Ga0075365_10000626
263 Ga0075365_10003597
264 Ga0075365_10041250
265 Ga0075365_10055947
266 Ga0075365_10079987
267 Ga0075365_10081521
268 Ga0075365_10178429
269 Ga0075365_10181076
270 Ga0075368_10167069
271 Ga0075363_100062184
272 Ga0075363_100101839
273 Ga0075363_100110094
274 Ga0075364_10009625
275 Ga0075364_10026157
276 Ga0075364_10089754
277 Ga0068871_100104650
278 Ga0075428_100025755
279 Ga0075430_100040828
280 Ga0075430_100053070
281 Ga0075430_100123711
282 Ga0075431_100000075
283 Ga0075431_100559848
284 Ga0075433_10324032
285 Ga0075434_100003025
286 Ga0075434_100146529
287 Ga0075434_100411091
288 Ga0075434_100737671
289 Ga0075429_100249927
290 Ga0068865_100079380
291 Ga0075435_100178966
292 Ga0111539_10175534
293 Ga0111539_10380423
294 Ga0111539_10951713
295 Ga0105245_10010304
296 Ga0105245_10111031
297 Ga0105245_10310983
298 Ga0114129_10115628
299 Ga0114129_10130095
300 Ga0114129_10131402
301 Ga0105243_10081497
302 Ga0105243_10116023
303 Ga0105243_10576179
304 Ga0105242_10036499
305 Ga0105242_10483393
306 Ga0105249_10031507
307 Ga0105249_10047360
308 Ga0105239_10104990
309 Ga0105239_10147040
310 Ga0105239_10772283
311 Ga0105239_10920587
312 Ga0157378_10120979
313 Ga0157372_10000129
314 Ga0157372_10312545
315 Ga0157379_10145927
316 Ga0207656_10014832
317 Ga0207642_10129411
318 Ga0207680_10029541
319 Ga0207685_10154993
320 Ga0207693_10001560
321 Ga0207659_10000010
322 Ga0207687_10010033
323 Ga0207709_10019446
324 Ga0207709_10375604
325 Ga0207704_10230659
326 Ga0207691_10000136
327 Ga0207651_10485807
328 Ga0207712_10131295
329 Ga0207668_10021187
330 Ga0207668_10116099
331 Ga0207668_10144035
332 Ga0207668_10750985
333 Ga0207658_10024563
334 Ga0207658_10063476
335 Ga0207677_10000879
336 Ga0207703_10225423
337 Ga0207702_10000060
338 Ga0207702_10077928
339 Ga0207675_100493740
340 Ga0207428_10032729
341 Ga0268266_10007839
342 Ga0268266_10183580
343 Ga0268265_10001017
344 Ga0268264_10076667
345 Ga0316576_10006661
346 Ga0307416_100007499
347 Ga0307415_100085089
348 Ga0307415_100130501
349 Ga0316574_0208359
350 Ga0316574_0246582
351 Ga0395899_0003392
352 Ga0395900_0011756
353 Ga0395900_0611119
354 Ga0395898_0052149
355 Ga0395898_0097483
356 Ga0395898_0141784
357 Ga0395905_0018217
358 Ga0395905_0406909
359 Ga0395901_0006703
360 Ga0395901_0108908
361 Ga0395901_0181861
362 Ga0395901_0426521
363 Ga0451853_1485105
364 Ga0466957_0186670
365 Ga0466958_0050321
366 Ga0495582_0136781
367 Ga0495662_0006939
368 Ga0495625_0000696
369 Ga0495676_0015159
370 Ga0496100_0016098
371 Ga0496101_0017334
372 Ga0496101_0534575
373 Ga0496102_0016289
374 Ga0496103_0006735
375 Ga0496104_0008212
376 Ga0496105_0011752
377 Ga0496107_0004673
378 Ga0496108_0000062
379 Ga0496108_0456338
380 Ga0496109_0000007
381 Ga0496109_0000129
382 Ga0496109_0290406
383 Ga0496110_0000062
384 Ga0496110_0256851
385 Ga0496111_0000010
386 Ga0496111_0021211
387 Ga0496111_0105615
388 Ga0496112_0156517
389 Ga0496112_0290765
390 Ga0496113_0101760
391 Ga0496114_0025626
392 Ga0496114_0050677
393 Ga0496115_0016383
394 Ga0501034_0056569
395 Ga0501034_0101323
396 Ga0501038_0364351
397 Ga0501038_0417224
398 Ga0501039_0316133
399 Ga0501040_0538015
400 Ga0501046_0124961
401 Ga0501047_0180307
402 Ga0501068_0346129
403 Ga0501070_0275613
404 Ga0501071_0044540
405 Ga0501071_0444075
406 Ga0501072_0006920
407 Ga0501074_0349095
408 Ga0501076_0042007
409 Ga0501077_0016408
410 Ga0501077_0213665
411 Ga0501079_0011890
412 Ga0501079_0364071
413 Ga0501081_0009467
414 Ga0501044_0146210
415 Ga0501045_0171195
416 nmdc:mga03n38_39216_c1
417 nmdc:mga03n38_70292_c1
418 nmdc:mga00v17_112406_c1
419 nmdc:mga00v17_214869_c1
420 nmdc:mga00v17_22822_c1
421 nmdc:mga00v17_4336_c1
422 nmdc:mga0yw44_232897_c1
423 nmdc:mga0yw44_242732_c1
424 nmdc:mga0yw44_32592_c1
425 nmdc:mga0yw44_59162_c1
426 nmdc:mga0yw44_659140_c1
427 nmdc:mga0yw44_96487_c1
428 nmdc:mga05p37_266049_c1
429 nmdc:mga05p37_30818_c1
430 nmdc:mga09592_330755_c1
431 nmdc:mga09592_340043_c1
432 nmdc:mga0qj67_41983_c1
433 nmdc:mga06r32_244_c1
434 nmdc:mga06r32_485921_c1
435 nmdc:mga08y16_220843_c1
436 nmdc:mga0n895_111354_c1
437 nmdc:mga0n895_186689_c1
438 nmdc:mga0n895_7227_c1
439 Ga0495612_0009748
440 Ga0495619_0000031
441 Ga0495619_0002472
442 Ga0495619_0056926
443 Ga0500644_0072043
444 Ga0500641_0028294
445 Ga0500554_009284
446 Ga0501084_0174109
447 Ga0501082_0025729
448 Ga0530510_0014022
449 Ga0530510_0062394
450 Ga0530510_0496626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

12

223

0.9

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

54

254

0.87

PF03379

CcmB

CcmB protein

16

207

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.705 4 249
8wbx-assembly1.cif.gz_B cryo-em structure of the abcg25 bound to aba 0.6904 3 250
8i3d-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 0.6827 3 250
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.6809 1 249
7r8d-assembly1.cif.gz_B the structure of human abcg1 e242q with cholesterol 0.6787 2 251
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8082 58 248 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7896 57 250 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7397 58 247 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6178 58 248 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6137 57 250 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A4V3C9Q5-F1-model_v4 Transport permease protein 0.9712 1 256 GO:0043190
GO:0140359
AF-A0A838I2Q2-F1-model_v4 Transport permease protein 0.9684 4 255 GO:0043190
GO:0140359
AF-A0A4V3C9Q5-F1-model_v4 Transport permease protein 0.9675 1 256 GO:0043190
GO:0140359
AF-A0A5B8U5D1-F1-model_v4 Transport permease protein 0.96 2 250 GO:0043190
GO:0140359
AF-A0A5N9B1J8-F1-model_v4 Transport permease protein 0.9579 1 253 GO:0043190
GO:0140359

Map