F338226

General Info

Members Datasets Scaffolds Average Seq Length
225 158 450 128

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0089640|Ga0501042_0089640_1022_1504
Length 160
Sequence VLSAAQRRTAHWRFPTAGGSDRYPSLDGAPVSGIAIITEACIDTKDRACVDVCPVQCIYEFDPAGNVLFSEVEAGGGVENTHQPNPDAIAIFGDSLLYVNTEECTSCTACYQPDVCPVGAIYSEEHVPDGAGSVAYNGTDPNKGHDHTFFIQLSRDVFAD

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
95 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
96 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
100 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
101 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
102 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
103 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
104 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
105 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
108 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
109 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
111 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 10.67
Rhizosphere 85.78
Stem 0
Stem Tuber 0
Unclassified 16.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0089640 3300049578 Bacteria 2207
2 Ga0065715_10922784 3300005293 Bacteria 568
3 Ga0070676_10226983 3300005328 Unclassified 1236
4 Ga0070683_102320394 3300005329 Bacteria 515
5 Ga0068869_101045377 3300005334 Unclassified 713
6 Ga0068868_101748539 3300005338 Unclassified 587
7 Ga0070689_100907455 3300005340 Bacteria 780
8 Ga0070689_101111775 3300005340 Bacteria 707
9 Ga0070661_100966986 3300005344 Bacteria 705
10 Ga0070692_10587309 3300005345 Bacteria 735
11 Ga0070668_100474992 3300005347 Bacteria 1079
12 Ga0070675_100227823 3300005354 Bacteria 1625
13 Ga0070675_100257959 3300005354 Unclassified 1527
14 Ga0070674_100173448 3300005356 Bacteria 1646
15 Ga0070674_100550378 3300005356 Bacteria 968
16 Ga0070708_100645352 3300005445 Unclassified 998
17 Ga0070678_100277386 3300005456 Bacteria 1416
18 Ga0070681_10070241 3300005458 Bacteria 3468
19 Ga0070681_10390897 3300005458 Bacteria 1302
20 Ga0068867_100746161 3300005459 Bacteria 868
21 Ga0070685_10179758 3300005466 Bacteria 1361
22 Ga0070698_101841472 3300005471 Bacteria 558
23 Ga0070684_101658542 3300005535 Bacteria 603
24 Ga0070665_100229537 3300005548 Bacteria 1856
25 Ga0068856_100574172 3300005614 Bacteria 1149
26 Ga0070702_100094783 3300005615 Bacteria 1818
27 Ga0068859_100158627 3300005617 Bacteria 2341
28 Ga0068864_100750579 3300005618 Unclassified 956
29 Ga0068861_100037856 3300005719 Bacteria 3587
30 Ga0068863_100497479 3300005841 Bacteria 1200
31 Ga0068858_100135256 3300005842 Bacteria 2313
32 Ga0068862_101234150 3300005844 Bacteria 747
33 Ga0075365_10668175 3300006038 Bacteria 734
34 Ga0070712_101474866 3300006175 Bacteria 594
35 Ga0068871_100251025 3300006358 Bacteria 1541
36 Ga0075428_100000001 3300006844 Bacteria 772630
37 Ga0075431_100257912 3300006847 Bacteria 1770
38 Ga0075434_100640542 3300006871 Unclassified 1081
39 Ga0068865_101255561 3300006881 Unclassified 657
40 Ga0097620_100158636 3300006931 Bacteria 2341
41 Ga0097620_101844399 3300006931 Bacteria 668
42 Ga0111539_10219150 3300009094 Bacteria 2216
43 Ga0111539_11071426 3300009094 Bacteria 937
44 Ga0111539_11488815 3300009094 Unclassified 785
45 Ga0105245_11306278 3300009098 Bacteria 774
46 Ga0105245_11416237 3300009098 Bacteria 745
47 Ga0105247_10216999 3300009101 Bacteria 1293
48 Ga0114129_10375504 3300009147 Bacteria 1878
49 Ga0114129_11549731 3300009147 Bacteria 813
50 Ga0114129_11652569 3300009147 Bacteria 783
51 Ga0114129_12429102 3300009147 Unclassified 627
52 Ga0105243_10195438 3300009148 Bacteria 1770
53 Ga0105243_10280687 3300009148 Bacteria 1500
54 Ga0105243_10819352 3300009148 Bacteria 919
55 Ga0105242_10302774 3300009176 Bacteria 1460
56 Ga0105242_10840414 3300009176 Bacteria 913
57 Ga0105242_11436306 3300009176 Bacteria 718
58 Ga0105248_10372970 3300009177 Bacteria 1607
59 Ga0105249_10166256 3300009553 Bacteria 2136
60 Ga0105249_10271538 3300009553 Bacteria 1690
61 Ga0105239_10575822 3300010375 Bacteria 1283
62 Ga0105246_10323373 3300011119 Bacteria 1254
63 Ga0105246_11335915 3300011119 Unclassified 666
64 Ga0105246_11353389 3300011119 Unclassified 662
65 Ga0105246_12153819 3300011119 Bacteria 541
66 Ga0105246_12447351 3300011119 Bacteria 513
67 Ga0105246_12489943 3300011119 Unclassified 509
68 Ga0157369_10254863 3300013105 Bacteria 1831
69 Ga0157378_11886181 3300013297 Unclassified 646
70 Ga0163162_11280061 3300013306 Bacteria 833
71 Ga0163162_11328869 3300013306 Bacteria 817
72 Ga0157375_10350022 3300013308 Bacteria 1643
73 Ga0157375_10917537 3300013308 Bacteria 1019
74 Ga0157375_13517226 3300013308 Unclassified 521
75 Ga0163163_10078145 3300014325 Bacteria 3305
76 Ga0163163_10318121 3300014325 Bacteria 1610
77 Ga0163163_10489161 3300014325 Bacteria 1292
78 Ga0163163_10808927 3300014325 Bacteria 1001
79 Ga0163163_11200038 3300014325 Bacteria 821
80 Ga0163163_13120774 3300014325 Bacteria 517
81 Ga0157380_10139189 3300014326 Unclassified 2082
82 Ga0157380_10184008 3300014326 Bacteria 1838
83 Ga0157380_10408156 3300014326 Bacteria 1291
84 Ga0157380_11116728 3300014326 Unclassified 828
85 Ga0157380_11687776 3300014326 Bacteria 691
86 Ga0157379_10306876 3300014968 Bacteria 1447
87 Ga0157379_11142473 3300014968 Bacteria 747
88 Ga0157376_10983876 3300014969 Bacteria 865
89 Ga0157376_11471205 3300014969 Bacteria 714
90 Ga0163161_10127071 3300017792 Unclassified 1921
91 Ga0206356_11043273 3300020070 Unclassified 562
92 Ga0207713_1125779 3300025735 Bacteria 854
93 Ga0207710_10087474 3300025900 Bacteria 1453
94 Ga0207688_10218176 3300025901 Bacteria 1148
95 Ga0207688_10792915 3300025901 Bacteria 600
96 Ga0207707_10071859 3300025912 Bacteria 3016
97 Ga0207707_10257892 3300025912 Bacteria 1513
98 Ga0207660_10657559 3300025917 Bacteria 854
99 Ga0207649_10900851 3300025920 Unclassified 693
100 Ga0207652_11777193 3300025921 Bacteria 521
101 Ga0207646_10832340 3300025922 Bacteria 821
102 Ga0207681_10361815 3300025923 Bacteria 1164
103 Ga0207650_10565842 3300025925 Bacteria 954
104 Ga0207659_10385453 3300025926 Bacteria 1169
105 Ga0207687_11598531 3300025927 Bacteria 559
106 Ga0207686_10255378 3300025934 Bacteria 1283
107 Ga0207686_11251369 3300025934 Bacteria 608
108 Ga0207709_10481664 3300025935 Bacteria 965
109 Ga0207669_10491982 3300025937 Bacteria 980
110 Ga0207669_11069896 3300025937 Unclassified 680
111 Ga0207669_11506782 3300025937 Bacteria 574
112 Ga0207704_11587740 3300025938 Bacteria 562
113 Ga0207691_10535177 3300025940 Bacteria 994
114 Ga0207691_10609550 3300025940 Bacteria 924
115 Ga0207711_10815036 3300025941 Bacteria 869
116 Ga0207651_10271609 3300025960 Unclassified 1397
117 Ga0207668_10417097 3300025972 Bacteria 1139
118 Ga0207640_11254736 3300025981 Bacteria 660
119 Ga0207677_11470916 3300026023 Bacteria 629
120 Ga0207703_10012395 3300026035 Bacteria 6643
121 Ga0207703_10290073 3300026035 Bacteria 1489
122 Ga0207678_10994461 3300026067 Bacteria 742
123 Ga0207708_11608028 3300026075 Bacteria 571
124 Ga0207702_10569595 3300026078 Bacteria 1109
125 Ga0207641_11276541 3300026088 Unclassified 735
126 Ga0207675_100038522 3300026118 Bacteria 4461
127 Ga0207683_10275538 3300026121 Bacteria 1537
128 Ga0207683_11129665 3300026121 Bacteria 727
129 Ga0268266_10090595 3300028379 Bacteria 2681
130 Ga0268265_10105615 3300028380 Bacteria 2286
131 Ga0265320_10410465 3300031240 Unclassified 598
132 Ga0307411_12181978 3300032005 Bacteria 519
133 Ga0373957_0506913 3300035120 Bacteria 526
134 Ga0373946_0288490 3300035171 Bacteria 809
135 Ga0373933_0470413 3300035724 Unclassified 823
136 Ga0373937_1608930 3300036401 Bacteria 597
137 Ga0439438_101466 3300041405 Bacteria 698
138 Ga0439439_0054167 3300041406 Bacteria 1056
139 Ga0439461_0044430 3300041410 Unclassified 969
140 Ga0439465_0067481 3300041413 Bacteria 1194
141 Ga0451793_0920251 3300041452 Unclassified 811
142 Ga0451795_0034391 3300041456 Unclassified 627
143 Ga0451802_1504801 3300041460 Unclassified 808
144 Ga0451804_0340349 3300041463 Bacteria 524
145 Ga0451807_1343784 3300041486 Bacteria 583
146 Ga0451807_1623587 3300041486 Bacteria 555
147 Ga0451833_0901279 3300041491 Bacteria 1028
148 Ga0451851_0480919 3300041507 Unclassified 741
149 Ga0451843_0710597 3300041509 Bacteria 604
150 Ga0451853_1180536 3300041512 Bacteria 624
151 Ga0451853_4104193 3300041512 Unclassified 621
152 Ga0439452_013571 3300042010 Bacteria 2284
153 Ga0439462_0130050 3300042015 Bacteria 703
154 Ga0450923_054636 3300042125 Bacteria 863
155 Ga0439434_0004679 3300042435 Bacteria 4011
156 Ga0439434_0138280 3300042435 Unclassified 802
157 Ga0439464_0298352 3300042439 Unclassified 526
158 Ga0451577_0001344 3300042876 Bacteria 33309
159 Ga0451577_0809163 3300042876 Bacteria 846
160 Ga0453684_0012872 3300044712 Bacteria 13704
161 Ga0453684_1923585 3300044712 Bacteria 598
162 Ga0495641_0054479 3300046461 Bacteria 1817
163 Ga0495651_0471844 3300046462 Bacteria 808
164 Ga0495653_0253093 3300046463 Bacteria 1168
165 Ga0495584_0308018 3300046491 Bacteria 804
166 Ga0495667_0734326 3300046559 Unclassified 611
167 Ga0495676_0375492 3300047321 Unclassified 947
168 Ga0496101_0311154 3300048904 Bacteria 1235
169 Ga0496102_0269864 3300048905 Bacteria 1604
170 Ga0496102_1166743 3300048905 Bacteria 690
171 Ga0496104_0095510 3300048907 Bacteria 2844
172 Ga0496104_0482536 3300048907 Bacteria 1151
173 Ga0496105_0987631 3300048908 Bacteria 630
174 Ga0496106_0439154 3300048909 Bacteria 1049
175 Ga0496108_0669765 3300048911 Bacteria 901
176 Ga0496109_0209984 3300048912 Bacteria 1831
177 Ga0496109_1041467 3300048912 Bacteria 756
178 Ga0496110_0128088 3300048913 Unclassified 2291
179 Ga0496111_0009825 3300048914 Bacteria 6394
180 Ga0496111_0270107 3300048914 Bacteria 1261
181 Ga0496111_0334067 3300048914 Bacteria 1122
182 Ga0496112_0360758 3300048915 Bacteria 1395
183 Ga0496112_0752090 3300048915 Bacteria 901
184 Ga0496114_0646418 3300048917 Bacteria 930
185 Ga0496114_0800945 3300048917 Bacteria 821
186 Ga0501031_0379625 3300049568 Bacteria 914
187 Ga0501031_0581562 3300049568 Bacteria 721
188 Ga0501032_0662375 3300049569 Bacteria 663
189 Ga0501037_0573019 3300049573 Bacteria 760
190 Ga0501039_0601711 3300049575 Bacteria 862
191 Ga0501039_0660055 3300049575 Bacteria 819
192 Ga0501040_0455819 3300049576 Bacteria 921
193 Ga0501041_0162803 3300049577 Bacteria 1395
194 Ga0501041_0475814 3300049577 Bacteria 794
195 Ga0501042_0852261 3300049578 Unclassified 663
196 Ga0501043_1001147 3300049579 Bacteria 595
197 Ga0501046_0052786 3300049580 Bacteria 3203
198 Ga0501048_0376432 3300049582 Bacteria 1014
199 Ga0501068_1079499 3300049584 Bacteria 531
200 Ga0501069_0732646 3300049585 Bacteria 597
201 Ga0501071_0096853 3300049587 Bacteria 2172
202 Ga0501071_0283431 3300049587 Bacteria 1254
203 Ga0501072_0160410 3300049588 Bacteria 1794
204 Ga0501072_0769029 3300049588 Bacteria 755
205 Ga0501074_0239495 3300049590 Bacteria 1291
206 Ga0501074_0606969 3300049590 Bacteria 774
207 Ga0501075_0256051 3300049591 Bacteria 1334
208 Ga0501075_0556956 3300049591 Bacteria 875
209 Ga0501076_0414314 3300049592 Bacteria 1108
210 Ga0501076_1213849 3300049592 Bacteria 621
211 Ga0501079_0903172 3300049741 Bacteria 696
212 Ga0501080_0133503 3300049742 Bacteria 2298
213 Ga0501081_0312588 3300049743 Bacteria 1154
214 Ga0501045_0051875 3300049824 Bacteria 2994
215 nmdc:mga0k408_820565_c1 3300050493 Bacteria 541
216 nmdc:mga0qj67_465571_c1 3300050509 Bacteria 1018
217 nmdc:mga06r32_1756617_c1 3300050510 Unclassified 556
218 nmdc:mga06r32_247438_c1 3300050510 Bacteria 1770
219 nmdc:mga08y16_1201660_c1 3300050511 Bacteria 729
220 nmdc:mga08y16_176048_c1 3300050511 Bacteria 2221
221 nmdc:mga08x19_231241_c1 3300050514 Bacteria 1272
222 Ga0500568_0000024 3300053139 Bacteria 170368
223 Ga0501084_0119898 3300054114 Bacteria 2212
224 Ga0501084_0728180 3300054114 Bacteria 836
225 Ga0530510_0064418 3300061734 Bacteria 2655
226 Ga0501042_0089640
227 Ga0065715_10922784
228 Ga0070676_10226983
229 Ga0070683_102320394
230 Ga0068869_101045377
231 Ga0068868_101748539
232 Ga0070689_100907455
233 Ga0070689_101111775
234 Ga0070661_100966986
235 Ga0070692_10587309
236 Ga0070668_100474992
237 Ga0070675_100227823
238 Ga0070675_100257959
239 Ga0070674_100173448
240 Ga0070674_100550378
241 Ga0070708_100645352
242 Ga0070678_100277386
243 Ga0070681_10070241
244 Ga0070681_10390897
245 Ga0068867_100746161
246 Ga0070685_10179758
247 Ga0070698_101841472
248 Ga0070684_101658542
249 Ga0070665_100229537
250 Ga0068856_100574172
251 Ga0070702_100094783
252 Ga0068859_100158627
253 Ga0068864_100750579
254 Ga0068861_100037856
255 Ga0068863_100497479
256 Ga0068858_100135256
257 Ga0068862_101234150
258 Ga0075365_10668175
259 Ga0070712_101474866
260 Ga0068871_100251025
261 Ga0075428_100000001
262 Ga0075431_100257912
263 Ga0075434_100640542
264 Ga0068865_101255561
265 Ga0097620_100158636
266 Ga0097620_101844399
267 Ga0111539_10219150
268 Ga0111539_11071426
269 Ga0111539_11488815
270 Ga0105245_11306278
271 Ga0105245_11416237
272 Ga0105247_10216999
273 Ga0114129_10375504
274 Ga0114129_11549731
275 Ga0114129_11652569
276 Ga0114129_12429102
277 Ga0105243_10195438
278 Ga0105243_10280687
279 Ga0105243_10819352
280 Ga0105242_10302774
281 Ga0105242_10840414
282 Ga0105242_11436306
283 Ga0105248_10372970
284 Ga0105249_10166256
285 Ga0105249_10271538
286 Ga0105239_10575822
287 Ga0105246_10323373
288 Ga0105246_11335915
289 Ga0105246_11353389
290 Ga0105246_12153819
291 Ga0105246_12447351
292 Ga0105246_12489943
293 Ga0157369_10254863
294 Ga0157378_11886181
295 Ga0163162_11280061
296 Ga0163162_11328869
297 Ga0157375_10350022
298 Ga0157375_10917537
299 Ga0157375_13517226
300 Ga0163163_10078145
301 Ga0163163_10318121
302 Ga0163163_10489161
303 Ga0163163_10808927
304 Ga0163163_11200038
305 Ga0163163_13120774
306 Ga0157380_10139189
307 Ga0157380_10184008
308 Ga0157380_10408156
309 Ga0157380_11116728
310 Ga0157380_11687776
311 Ga0157379_10306876
312 Ga0157379_11142473
313 Ga0157376_10983876
314 Ga0157376_11471205
315 Ga0163161_10127071
316 Ga0206356_11043273
317 Ga0207713_1125779
318 Ga0207710_10087474
319 Ga0207688_10218176
320 Ga0207688_10792915
321 Ga0207707_10071859
322 Ga0207707_10257892
323 Ga0207660_10657559
324 Ga0207649_10900851
325 Ga0207652_11777193
326 Ga0207646_10832340
327 Ga0207681_10361815
328 Ga0207650_10565842
329 Ga0207659_10385453
330 Ga0207687_11598531
331 Ga0207686_10255378
332 Ga0207686_11251369
333 Ga0207709_10481664
334 Ga0207669_10491982
335 Ga0207669_11069896
336 Ga0207669_11506782
337 Ga0207704_11587740
338 Ga0207691_10535177
339 Ga0207691_10609550
340 Ga0207711_10815036
341 Ga0207651_10271609
342 Ga0207668_10417097
343 Ga0207640_11254736
344 Ga0207677_11470916
345 Ga0207703_10012395
346 Ga0207703_10290073
347 Ga0207678_10994461
348 Ga0207708_11608028
349 Ga0207702_10569595
350 Ga0207641_11276541
351 Ga0207675_100038522
352 Ga0207683_10275538
353 Ga0207683_11129665
354 Ga0268266_10090595
355 Ga0268265_10105615
356 Ga0265320_10410465
357 Ga0307411_12181978
358 Ga0373957_0506913
359 Ga0373946_0288490
360 Ga0373933_0470413
361 Ga0373937_1608930
362 Ga0439438_101466
363 Ga0439439_0054167
364 Ga0439461_0044430
365 Ga0439465_0067481
366 Ga0451793_0920251
367 Ga0451795_0034391
368 Ga0451802_1504801
369 Ga0451804_0340349
370 Ga0451807_1343784
371 Ga0451807_1623587
372 Ga0451833_0901279
373 Ga0451851_0480919
374 Ga0451843_0710597
375 Ga0451853_1180536
376 Ga0451853_4104193
377 Ga0439452_013571
378 Ga0439462_0130050
379 Ga0450923_054636
380 Ga0439434_0004679
381 Ga0439434_0138280
382 Ga0439464_0298352
383 Ga0451577_0001344
384 Ga0451577_0809163
385 Ga0453684_0012872
386 Ga0453684_1923585
387 Ga0495641_0054479
388 Ga0495651_0471844
389 Ga0495653_0253093
390 Ga0495584_0308018
391 Ga0495667_0734326
392 Ga0495676_0375492
393 Ga0496101_0311154
394 Ga0496102_0269864
395 Ga0496102_1166743
396 Ga0496104_0095510
397 Ga0496104_0482536
398 Ga0496105_0987631
399 Ga0496106_0439154
400 Ga0496108_0669765
401 Ga0496109_0209984
402 Ga0496109_1041467
403 Ga0496110_0128088
404 Ga0496111_0009825
405 Ga0496111_0270107
406 Ga0496111_0334067
407 Ga0496112_0360758
408 Ga0496112_0752090
409 Ga0496114_0646418
410 Ga0496114_0800945
411 Ga0501031_0379625
412 Ga0501031_0581562
413 Ga0501032_0662375
414 Ga0501037_0573019
415 Ga0501039_0601711
416 Ga0501039_0660055
417 Ga0501040_0455819
418 Ga0501041_0162803
419 Ga0501041_0475814
420 Ga0501042_0852261
421 Ga0501043_1001147
422 Ga0501046_0052786
423 Ga0501048_0376432
424 Ga0501068_1079499
425 Ga0501069_0732646
426 Ga0501071_0096853
427 Ga0501071_0283431
428 Ga0501072_0160410
429 Ga0501072_0769029
430 Ga0501074_0239495
431 Ga0501074_0606969
432 Ga0501075_0256051
433 Ga0501075_0556956
434 Ga0501076_0414314
435 Ga0501076_1213849
436 Ga0501079_0903172
437 Ga0501080_0133503
438 Ga0501081_0312588
439 Ga0501045_0051875
440 nmdc:mga0k408_820565_c1
441 nmdc:mga0qj67_465571_c1
442 nmdc:mga06r32_1756617_c1
443 nmdc:mga06r32_247438_c1
444 nmdc:mga08y16_1201660_c1
445 nmdc:mga08y16_176048_c1
446 nmdc:mga08x19_231241_c1
447 Ga0500568_0000024
448 Ga0501084_0119898
449 Ga0501084_0728180
450 Ga0530510_0064418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map