F338213

General Info

Members Datasets Scaffolds Average Seq Length
225 137 214 140

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0267594|Ga0501034_0267594_216_740
Length 166
Sequence LLQLNIEGVAKPFFALTESVASSTLVIYMKKKILVLCTGNSCRSQMAEGYLRLFAGDKAEVYSAGVEAHGVNPRAIATMKEDDVDISGHTSNNIDEYRNIDFDFVITVCDNARERCPFFPANAKKFHRNFSDPAKATGTDEEIKERFREVRQQIKDYCEKFVSDNL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
4 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
5 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
6 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
7 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
8 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
9 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
10 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
11 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
91 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
92 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
93 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
121 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
122 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
128 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
129 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
130 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
133 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
134 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
137 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 0
Isolates 4.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 0
Rhizoplane 0.44
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 6.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_12741 2124908027 Bacteria 601
2 SwRhRL2b_contig_3916980 2162886007 Bacteria 13112
3 JGI24737J22298_10004899 3300001990 Bacteria 4642
4 rootH1_10056401 3300003316 Bacteria 2404
5 rootH2_10150022 3300003320 Bacteria 3615
6 rootL2_10333522 3300003322 Bacteria 2317
7 Ga0065714_10002967 3300005288 Bacteria 11698
8 Ga0065714_10175910 3300005288 Bacteria 983
9 Ga0065704_10000436 3300005289 Bacteria 20960
10 Ga0065715_10093010 3300005293 Bacteria 4841
11 Ga0070658_10093506 3300005327 Bacteria 2480
12 Ga0070658_10352352 3300005327 Unclassified 1260
13 Ga0070658_10540276 3300005327 Bacteria 1008
14 Ga0070658_11292623 3300005327 Bacteria 634
15 Ga0070676_10851879 3300005328 Bacteria 676
16 Ga0070683_101680343 3300005329 Unclassified 611
17 Ga0070670_100987650 3300005331 Bacteria 765
18 Ga0070680_100350815 3300005336 Bacteria 1255
19 Ga0070682_100519132 3300005337 Bacteria 926
20 Ga0070660_100004045 3300005339 Bacteria 10122
21 Ga0070660_100169115 3300005339 Bacteria 1765
22 Ga0070660_100772030 3300005339 Bacteria 807
23 Ga0070661_100250963 3300005344 Bacteria 1365
24 Ga0070671_100790453 3300005355 Unclassified 826
25 Ga0070659_100014292 3300005366 Bacteria 5928
26 Ga0070659_100031035 3300005366 Bacteria 4137
27 Ga0070667_101800321 3300005367 Bacteria 576
28 Ga0070663_102141784 3300005455 Bacteria 504
29 Ga0070681_10048847 3300005458 Bacteria 4226
30 Ga0070681_11058724 3300005458 Bacteria 732
31 Ga0070679_100001418 3300005530 Bacteria 21198
32 Ga0070679_100010563 3300005530 Bacteria 8758
33 Ga0070679_100255412 3300005530 Unclassified 1708
34 Ga0070679_100724374 3300005530 Bacteria 937
35 Ga0070684_102118802 3300005535 Bacteria 531
36 Ga0068853_100948453 3300005539 Unclassified 827
37 Ga0068853_101650471 3300005539 Unclassified 621
38 Ga0068855_100048332 3300005563 Bacteria 5021
39 Ga0068857_100180065 3300005577 Bacteria 1923
40 Ga0068854_100260186 3300005578 Bacteria 1389
41 Ga0068854_100300035 3300005578 Bacteria 1299
42 Ga0068852_100169076 3300005616 Bacteria 2048
43 Ga0068852_100600728 3300005616 Bacteria 1104
44 Ga0068852_100673158 3300005616 Unclassified 1043
45 Ga0068864_100381821 3300005618 Unclassified 1335
46 Ga0081539_10493124 3300005985 Bacteria 507
47 Ga0075366_10330755 3300006195 Bacteria 934
48 Ga0068871_100171667 3300006358 Bacteria 1859
49 Ga0075433_10629144 3300006852 Bacteria 941
50 Ga0105240_10078706 3300009093 Bacteria 4059
51 Ga0105240_10183045 3300009093 Bacteria 2471
52 Ga0105241_10258931 3300009174 Bacteria 1478
53 Ga0105241_11738329 3300009174 Bacteria 607
54 Ga0105237_10066628 3300009545 Bacteria 3596
55 Ga0105239_10028969 3300010375 Bacteria 6086
56 Ga0105239_11049836 3300010375 Bacteria 937
57 Ga0105239_11940378 3300010375 Bacteria 683
58 Ga0157373_10000002 3300013100 Bacteria 750094
59 Ga0157373_10000698 3300013100 Bacteria 26281
60 Ga0157373_10065607 3300013100 Bacteria 2569
61 Ga0157373_10117527 3300013100 Bacteria 1869
62 Ga0157373_10214390 3300013100 Bacteria 1358
63 Ga0157373_10471830 3300013100 Bacteria 905
64 Ga0157371_10000079 3300013102 Bacteria 152295
65 Ga0157371_10000691 3300013102 Bacteria 39752
66 Ga0157371_10002456 3300013102 Bacteria 17666
67 Ga0157371_10002560 3300013102 Bacteria 17253
68 Ga0157371_10018706 3300013102 Bacteria 5119
69 Ga0157371_10025684 3300013102 Bacteria 4289
70 Ga0157371_10041465 3300013102 Bacteria 3284
71 Ga0157371_10072673 3300013102 Bacteria 2435
72 Ga0157371_10115853 3300013102 Bacteria 1903
73 Ga0157371_10751848 3300013102 Bacteria 732
74 Ga0157370_10000399 3300013104 Bacteria 54642
75 Ga0157370_10000770 3300013104 Bacteria 40150
76 Ga0157370_10017224 3300013104 Bacteria 7291
77 Ga0157370_10048667 3300013104 Unclassified 4061
78 Ga0157370_10171127 3300013104 Bacteria 2019
79 Ga0157370_10407993 3300013104 Bacteria 1250
80 Ga0157370_10625263 3300013104 Bacteria 985
81 Ga0157370_11465794 3300013104 Bacteria 614
82 Ga0157369_10008862 3300013105 Bacteria 11522
83 Ga0157369_10030928 3300013105 Bacteria 5900
84 Ga0157369_10057046 3300013105 Bacteria 4214
85 Ga0157369_10133696 3300013105 Bacteria 2627
86 Ga0157369_10527878 3300013105 Bacteria 1221
87 Ga0157369_10607307 3300013105 Bacteria 1129
88 Ga0157369_11786379 3300013105 Bacteria 624
89 Ga0157374_11221777 3300013296 Bacteria 773
90 Ga0157378_10078718 3300013297 Bacteria 2974
91 Ga0163162_10075859 3300013306 Bacteria 3423
92 Ga0157372_10000639 3300013307 Bacteria 38430
93 Ga0157372_10014553 3300013307 Bacteria 8416
94 Ga0157372_10060798 3300013307 Bacteria 4227
95 Ga0157372_10260854 3300013307 Bacteria 2012
96 Ga0157372_10485777 3300013307 Bacteria 1440
97 Ga0157372_10508782 3300013307 Bacteria 1404
98 Ga0157372_10913181 3300013307 Bacteria 1018
99 Ga0157375_10000220 3300013308 Bacteria 53557
100 Ga0157375_10094570 3300013308 Unclassified 3057
101 Ga0157375_10888258 3300013308 Bacteria 1036
102 Ga0163163_10725801 3300014325 Bacteria 1057
103 Ga0182006_1000999 3300015261 Bacteria 18510
104 Ga0182006_1016224 3300015261 Bacteria 3178
105 Ga0182006_1025695 3300015261 Bacteria 2417
106 Ga0182006_1040700 3300015261 Bacteria 1828
107 Ga0182006_1064189 3300015261 Bacteria 1377
108 Ga0207705_10024772 3300025909 Bacteria 4282
109 Ga0207705_10032752 3300025909 Bacteria 3714
110 Ga0207707_10887523 3300025912 Bacteria 738
111 Ga0207695_10178161 3300025913 Unclassified 2047
112 Ga0207695_10705553 3300025913 Bacteria 889
113 Ga0207671_10003362 3300025914 Bacteria 16046
114 Ga0207671_10594169 3300025914 Unclassified 882
115 Ga0207660_10128885 3300025917 Bacteria 1924
116 Ga0207660_10317038 3300025917 Bacteria 1244
117 Ga0207657_10011684 3300025919 Bacteria 8701
118 Ga0207657_10012983 3300025919 Bacteria 8187
119 Ga0207657_10047382 3300025919 Bacteria 3759
120 Ga0207649_10487465 3300025920 Bacteria 936
121 Ga0207652_10000029 3300025921 Bacteria 149054
122 Ga0207652_10010197 3300025921 Bacteria 7563
123 Ga0207652_10128581 3300025921 Bacteria 2258
124 Ga0207652_10201667 3300025921 Bacteria 1790
125 Ga0207652_11795758 3300025921 Bacteria 518
126 Ga0207690_10132618 3300025932 Bacteria 1825
127 Ga0207686_10786819 3300025934 Bacteria 762
128 Ga0207670_11421795 3300025936 Bacteria 589
129 Ga0207679_10641743 3300025945 Bacteria 960
130 Ga0207667_10071936 3300025949 Bacteria 3595
131 Ga0207667_10559871 3300025949 Bacteria 1156
132 Ga0207640_10123338 3300025981 Bacteria 1861
133 Ga0207639_10581918 3300026041 Bacteria 1031
134 Ga0207639_10728491 3300026041 Unclassified 921
135 Ga0207678_11239035 3300026067 Unclassified 660
136 Ga0207678_11353787 3300026067 Bacteria 629
137 Ga0207676_10746878 3300026095 Bacteria 951
138 Ga0207674_10140957 3300026116 Bacteria 2370
139 Ga0207698_10101834 3300026142 Bacteria 2383
140 Ga0207698_10140760 3300026142 Bacteria 2078
141 Ga0307515_10015653 3300028794 Bacteria 13957
142 Ga0265327_10000009 3300031251 Bacteria 616360
143 Ga0265327_10041643 3300031251 Bacteria 2474
144 Ga0307405_10000001 3300031731 Bacteria 1731270
145 Ga0307405_10467479 3300031731 Bacteria 1004
146 Ga0307406_10015410 3300031901 Bacteria 4423
147 Ga0307412_10000222 3300031911 Bacteria 38184
148 Ga0307412_10000610 3300031911 Bacteria 21043
149 Ga0307414_10308354 3300032004 Bacteria 1342
150 Ga0307414_10361921 3300032004 Bacteria 1248
151 Ga0307414_10875832 3300032004 Bacteria 822
152 Ga0307411_10007978 3300032005 Bacteria 5447
153 Ga0395899_0025727 3300037312 Bacteria 4442
154 Ga0395899_0197604 3300037312 Bacteria 1404
155 Ga0395900_0029018 3300037418 Bacteria 5674
156 Ga0395900_0280406 3300037418 Bacteria 1658
157 Ga0395898_0114483 3300037466 Bacteria 2584
158 Ga0395898_0254555 3300037466 Bacteria 1674
159 Ga0395898_1239732 3300037466 Bacteria 676
160 Ga0395905_0096932 3300037471 Bacteria 2769
161 Ga0395901_0002287 3300038443 Bacteria 19537
162 Ga0439465_0013304 3300041413 Bacteria 2568
163 Ga0451791_1762924 3300041451 Bacteria 599
164 Ga0451837_1675611 3300041494 Bacteria 622
165 Ga0439449_0400069 3300042007 Bacteria 521
166 Ga0466965_0399535 3300044683 Bacteria 759
167 Ga0466963_0713346 3300044694 Bacteria 708
168 Ga0466968_0203110 3300044735 Bacteria 929
169 Ga0466957_0000474 3300044842 Bacteria 19959
170 Ga0466959_0208073 3300045049 Bacteria 1360
171 Ga0495607_0100426 3300046501 Bacteria 1551
172 Ga0495606_0238961 3300046507 Bacteria 1014
173 Ga0495616_0019046 3300046513 Bacteria 3752
174 Ga0495632_0041253 3300046519 Bacteria 2320
175 Ga0495643_0035900 3300046522 Bacteria 2726
176 Ga0495643_0401685 3300046522 Bacteria 604
177 Ga0495625_0173470 3300046660 Bacteria 1438
178 Ga0496117_0241790 3300048920 Bacteria 991
179 Ga0496121_0065478 3300048924 Bacteria 2956
180 Ga0496122_0000448 3300048925 Bacteria 86293
181 Ga0496123_0149800 3300048926 Bacteria 1261
182 Ga0496125_0014934 3300048928 Bacteria 7541
183 Ga0501032_0143450 3300049569 Unclassified 1572
184 Ga0501034_0093313 3300049571 Bacteria 3006
185 Ga0501034_0267594 3300049571 Bacteria 1651
186 Ga0501038_0807418 3300049574 Bacteria 697
187 Ga0501039_0015357 3300049575 Bacteria 5862
188 Ga0501043_0095291 3300049579 Bacteria 2339
189 Ga0501043_0275860 3300049579 Bacteria 1290
190 Ga0501046_0400520 3300049580 Unclassified 991
191 Ga0501047_0064799 3300049581 Bacteria 3524
192 Ga0501070_0428844 3300049586 Bacteria 1067
193 Ga0501251_001549 3300049681 Bacteria 2159
194 Ga0501080_0907988 3300049742 Unclassified 767
195 Ga0501241_000018 3300049758 Bacteria 95195
196 Ga0501262_011186 3300049759 Bacteria 1132
197 Ga0501269_000035 3300049766 Bacteria 41924
198 Ga0501035_0199331 3300049822 Bacteria 1718
199 Ga0501035_0226018 3300049822 Bacteria 1597
200 Ga0501035_0303494 3300049822 Bacteria 1345
201 Ga0501044_0001399 3300049823 Bacteria 28286
202 Ga0501044_0027943 3300049823 Bacteria 5954
203 Ga0501044_0609919 3300049823 Bacteria 984
204 nmdc:mga0k408_114715_c1 3300050493 Unclassified 1593
205 nmdc:mga0a205_587770_c1 3300050515 Bacteria 967
206 Ga0500646_0104894 3300053090 Bacteria 892
207 Ga0500651_0401842 3300053093 Bacteria 769
208 Ga0500555_098481 3300053103 Bacteria 745
209 Ga0500556_0251935 3300053104 Bacteria 695
210 Ga0500568_0041186 3300053139 Bacteria 1857
211 Ga0500577_0191597 3300053142 Bacteria 880
212 Ga0500589_159836 3300053147 Bacteria 907
213 Ga0500622_0000130 3300053156 Bacteria 79522
214 Ga0501082_1037685 3300060353 Unclassified 717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0093313 Ga0501034_0093313_2138_2557 131
2 3300044735 Ga0466968_0203110 Ga0466968_0203110_508_918 133
3 iso_pu_bacteria 2522125168 2522553098 133
4 iso_pu_bacteria 2849281842 2849282075 133
5 iso_pu_bacteria 2965320100 2965320114 133
6 iso_pu_bacteria 2643221716 2644642377 134
7 iso_pu_bacteria 2643221725 2644685127 134
8 iso_pu_bacteria 2881359912 2881360034 134
9 iso_pu_bacteria 2919097161 2919098578 134
10 iso_pu_bacteria 8054307821 8054309647 134
11 3300025921 Ga0207652_11795758 Ga0207652_117957581 135
12 2124908027 MRS2a_Contig_12741 MRS2a_00598960 137
13 2162886007 SwRhRL2b_contig_3916980 SwRhRL2b_0658.00001630 137
14 3300001990 JGI24737J22298_10004899 JGI24737J22298_100048995 137
15 3300003316 rootH1_10056401 rootH1_100564012 137
16 3300003320 rootH2_10150022 rootH2_101500222 137
17 3300003322 rootL2_10333522 rootL2_103335222 137
18 3300005288 Ga0065714_10002967 Ga0065714_100029674 137
19 3300005288 Ga0065714_10175910 Ga0065714_101759102 137
20 3300005289 Ga0065704_10000436 Ga0065704_100004369 137
21 3300005293 Ga0065715_10093010 Ga0065715_100930102 137
22 3300005327 Ga0070658_10093506 Ga0070658_100935063 137
23 3300005327 Ga0070658_10352352 Ga0070658_103523522 137
24 3300005327 Ga0070658_10540276 Ga0070658_105402762 137
25 3300005327 Ga0070658_11292623 Ga0070658_112926231 137
26 3300005328 Ga0070676_10851879 Ga0070676_108518791 137
27 3300005329 Ga0070683_101680343 Ga0070683_1016803431 137
28 3300005331 Ga0070670_100987650 Ga0070670_1009876502 137
29 3300005336 Ga0070680_100350815 Ga0070680_1003508151 137
30 3300005337 Ga0070682_100519132 Ga0070682_1005191322 137
31 3300005339 Ga0070660_100004045 Ga0070660_1000040456 137
32 3300005339 Ga0070660_100169115 Ga0070660_1001691152 137
33 3300005339 Ga0070660_100772030 Ga0070660_1007720302 137
34 3300005344 Ga0070661_100250963 Ga0070661_1002509632 137
35 3300005355 Ga0070671_100790453 Ga0070671_1007904531 137
36 3300005366 Ga0070659_100014292 Ga0070659_1000142922 137
37 3300005366 Ga0070659_100031035 Ga0070659_1000310352 137
38 3300005367 Ga0070667_101800321 Ga0070667_1018003211 137
39 3300005455 Ga0070663_102141784 Ga0070663_1021417841 137
40 3300005458 Ga0070681_10048847 Ga0070681_100488471 137
41 3300005458 Ga0070681_11058724 Ga0070681_110587241 137
42 3300005530 Ga0070679_100001418 Ga0070679_10000141819 137
43 3300005530 Ga0070679_100010563 Ga0070679_1000105635 137
44 3300005530 Ga0070679_100255412 Ga0070679_1002554123 137
45 3300005530 Ga0070679_100724374 Ga0070679_1007243741 137
46 3300005535 Ga0070684_102118802 Ga0070684_1021188021 137
47 3300005539 Ga0068853_100948453 Ga0068853_1009484532 137
48 3300005539 Ga0068853_101650471 Ga0068853_1016504711 137
49 3300005563 Ga0068855_100048332 Ga0068855_1000483328 137
50 3300005577 Ga0068857_100180065 Ga0068857_1001800652 137
51 3300005578 Ga0068854_100260186 Ga0068854_1002601862 137
52 3300005578 Ga0068854_100300035 Ga0068854_1003000353 137
53 3300005616 Ga0068852_100169076 Ga0068852_1001690764 137
54 3300005616 Ga0068852_100600728 Ga0068852_1006007281 137
55 3300005616 Ga0068852_100673158 Ga0068852_1006731582 137
56 3300005618 Ga0068864_100381821 Ga0068864_1003818212 137
57 3300005985 Ga0081539_10493124 Ga0081539_104931241 137
58 3300006195 Ga0075366_10330755 Ga0075366_103307552 137
59 3300006358 Ga0068871_100171667 Ga0068871_1001716673 137
60 3300006852 Ga0075433_10629144 Ga0075433_106291441 137
61 3300009093 Ga0105240_10078706 Ga0105240_100787063 137
62 3300009093 Ga0105240_10183045 Ga0105240_101830452 137
63 3300009174 Ga0105241_10258931 Ga0105241_102589312 137
64 3300009174 Ga0105241_11738329 Ga0105241_117383292 137
65 3300009545 Ga0105237_10066628 Ga0105237_100666282 137
66 3300010375 Ga0105239_10028969 Ga0105239_100289696 137
67 3300010375 Ga0105239_11049836 Ga0105239_110498362 137
68 3300010375 Ga0105239_11940378 Ga0105239_119403781 137
69 3300013100 Ga0157373_10000002 Ga0157373_10000002177 137
70 3300013100 Ga0157373_10000698 Ga0157373_1000069816 137
71 3300013100 Ga0157373_10065607 Ga0157373_100656072 137
72 3300013100 Ga0157373_10117527 Ga0157373_101175272 137
73 3300013100 Ga0157373_10214390 Ga0157373_102143901 137
74 3300013100 Ga0157373_10471830 Ga0157373_104718301 137
75 3300013102 Ga0157371_10000079 Ga0157371_1000007963 137
76 3300013102 Ga0157371_10000691 Ga0157371_1000069120 137
77 3300013102 Ga0157371_10002456 Ga0157371_1000245621 137
78 3300013102 Ga0157371_10002560 Ga0157371_1000256017 137
79 3300013102 Ga0157371_10018706 Ga0157371_100187062 137
80 3300013102 Ga0157371_10025684 Ga0157371_100256841 137
81 3300013102 Ga0157371_10041465 Ga0157371_100414652 137
82 3300013102 Ga0157371_10072673 Ga0157371_100726734 137
83 3300013102 Ga0157371_10115853 Ga0157371_101158532 137
84 3300013102 Ga0157371_10751848 Ga0157371_107518481 137
85 3300013104 Ga0157370_10000399 Ga0157370_1000039927 137
86 3300013104 Ga0157370_10000770 Ga0157370_1000077014 137
87 3300013104 Ga0157370_10017224 Ga0157370_100172244 137
88 3300013104 Ga0157370_10048667 Ga0157370_100486676 137
89 3300013104 Ga0157370_10171127 Ga0157370_101711272 137
90 3300013104 Ga0157370_10407993 Ga0157370_104079932 137
91 3300013104 Ga0157370_10625263 Ga0157370_106252632 137
92 3300013104 Ga0157370_11465794 Ga0157370_114657942 137
93 3300013105 Ga0157369_10008862 Ga0157369_1000886212 137
94 3300013105 Ga0157369_10030928 Ga0157369_100309285 137
95 3300013105 Ga0157369_10057046 Ga0157369_100570464 137
96 3300013105 Ga0157369_10133696 Ga0157369_101336963 137
97 3300013105 Ga0157369_10527878 Ga0157369_105278782 137
98 3300013105 Ga0157369_10607307 Ga0157369_106073072 137
99 3300013105 Ga0157369_11786379 Ga0157369_117863792 137
100 3300013296 Ga0157374_11221777 Ga0157374_112217771 137
101 3300013297 Ga0157378_10078718 Ga0157378_100787183 137
102 3300013306 Ga0163162_10075859 Ga0163162_100758592 137
103 3300013307 Ga0157372_10000639 Ga0157372_1000063929 137
104 3300013307 Ga0157372_10014553 Ga0157372_100145537 137
105 3300013307 Ga0157372_10060798 Ga0157372_100607983 137
106 3300013307 Ga0157372_10260854 Ga0157372_102608542 137
107 3300013307 Ga0157372_10485777 Ga0157372_104857772 137
108 3300013307 Ga0157372_10508782 Ga0157372_105087822 137
109 3300013307 Ga0157372_10913181 Ga0157372_109131812 137
110 3300013308 Ga0157375_10000220 Ga0157375_1000022011 137
111 3300013308 Ga0157375_10094570 Ga0157375_100945702 137
112 3300013308 Ga0157375_10888258 Ga0157375_108882582 137
113 3300014325 Ga0163163_10725801 Ga0163163_107258012 137
114 3300015261 Ga0182006_1000999 Ga0182006_10009998 137
115 3300015261 Ga0182006_1016224 Ga0182006_10162243 137
116 3300015261 Ga0182006_1025695 Ga0182006_10256952 137
117 3300015261 Ga0182006_1040700 Ga0182006_10407002 137
118 3300015261 Ga0182006_1064189 Ga0182006_10641892 137
119 3300025909 Ga0207705_10024772 Ga0207705_100247724 137
120 3300025909 Ga0207705_10032752 Ga0207705_100327522 137
121 3300025912 Ga0207707_10887523 Ga0207707_108875232 137
122 3300025913 Ga0207695_10178161 Ga0207695_101781613 137
123 3300025913 Ga0207695_10705553 Ga0207695_107055532 137
124 3300025914 Ga0207671_10003362 Ga0207671_100033628 137
125 3300025914 Ga0207671_10594169 Ga0207671_105941692 137
126 3300025917 Ga0207660_10128885 Ga0207660_101288852 137
127 3300025917 Ga0207660_10317038 Ga0207660_103170381 137
128 3300025919 Ga0207657_10011684 Ga0207657_100116848 137
129 3300025919 Ga0207657_10012983 Ga0207657_100129838 137
130 3300025919 Ga0207657_10047382 Ga0207657_100473826 137
131 3300025920 Ga0207649_10487465 Ga0207649_104874651 137
132 3300025921 Ga0207652_10000029 Ga0207652_1000002967 137
133 3300025921 Ga0207652_10010197 Ga0207652_100101975 137
134 3300025921 Ga0207652_10128581 Ga0207652_101285812 137
135 3300025921 Ga0207652_10201667 Ga0207652_102016674 137
136 3300025932 Ga0207690_10132618 Ga0207690_101326182 137
137 3300025934 Ga0207686_10786819 Ga0207686_107868192 137
138 3300025936 Ga0207670_11421795 Ga0207670_114217951 137
139 3300025945 Ga0207679_10641743 Ga0207679_106417431 137
140 3300025949 Ga0207667_10071936 Ga0207667_100719363 137
141 3300025949 Ga0207667_10559871 Ga0207667_105598712 137
142 3300025981 Ga0207640_10123338 Ga0207640_101233382 137
143 3300026041 Ga0207639_10581918 Ga0207639_105819182 137
144 3300026041 Ga0207639_10728491 Ga0207639_107284912 137
145 3300026067 Ga0207678_11239035 Ga0207678_112390351 137
146 3300026067 Ga0207678_11353787 Ga0207678_113537872 137
147 3300026095 Ga0207676_10746878 Ga0207676_107468781 137
148 3300026116 Ga0207674_10140957 Ga0207674_101409572 137
149 3300026142 Ga0207698_10101834 Ga0207698_101018342 137
150 3300026142 Ga0207698_10140760 Ga0207698_101407602 137
151 3300028794 Ga0307515_10015653 Ga0307515_100156537 137
152 3300031251 Ga0265327_10000009 Ga0265327_10000009476 137
153 3300031251 Ga0265327_10041643 Ga0265327_100416432 137
154 3300031731 Ga0307405_10000001 Ga0307405_100000011237 137
155 3300031731 Ga0307405_10467479 Ga0307405_104674792 137
156 3300031901 Ga0307406_10015410 Ga0307406_100154105 137
157 3300031911 Ga0307412_10000222 Ga0307412_100002225 137
158 3300031911 Ga0307412_10000610 Ga0307412_100006102 137
159 3300032004 Ga0307414_10308354 Ga0307414_103083542 137
160 3300032004 Ga0307414_10361921 Ga0307414_103619211 137
161 3300032004 Ga0307414_10875832 Ga0307414_108758322 137
162 3300032005 Ga0307411_10007978 Ga0307411_100079787 137
163 3300037312 Ga0395899_0025727 Ga0395899_0025727_399_836 137
164 3300037312 Ga0395899_0197604 Ga0395899_0197604_25_444 137
165 3300037418 Ga0395900_0029018 Ga0395900_0029018_1845_2264 137
166 3300037418 Ga0395900_0280406 Ga0395900_0280406_399_836 137
167 3300037466 Ga0395898_0114483 Ga0395898_0114483_1325_1762 137
168 3300037466 Ga0395898_0254555 Ga0395898_0254555_586_1002 137
169 3300037466 Ga0395898_1239732 Ga0395898_1239732_98_517 137
170 3300037471 Ga0395905_0096932 Ga0395905_0096932_358_771 137
171 3300038443 Ga0395901_0002287 Ga0395901_0002287_975_1412 137
172 3300041413 Ga0439465_0013304 Ga0439465_0013304_1014_1430 137
173 3300041451 Ga0451791_1762924 Ga0451791_1762924_95_508 137
174 3300041494 Ga0451837_1675611 Ga0451837_1675611_60_476 137
175 3300042007 Ga0439449_0400069 Ga0439449_0400069_46_459 137
176 3300044683 Ga0466965_0399535 Ga0466965_0399535_289_702 137
177 3300044694 Ga0466963_0713346 Ga0466963_0713346_221_637 137
178 3300044842 Ga0466957_0000474 Ga0466957_0000474_17008_17514 137
179 3300045049 Ga0466959_0208073 Ga0466959_0208073_101_514 137
180 3300046501 Ga0495607_0100426 Ga0495607_0100426_20_439 137
181 3300046507 Ga0495606_0238961 Ga0495606_0238961_485_904 137
182 3300046513 Ga0495616_0019046 Ga0495616_0019046_1028_1447 137
183 3300046519 Ga0495632_0041253 Ga0495632_0041253_474_890 137
184 3300046522 Ga0495643_0035900 Ga0495643_0035900_1772_2191 137
185 3300046522 Ga0495643_0401685 Ga0495643_0401685_38_451 137
186 3300046660 Ga0495625_0173470 Ga0495625_0173470_991_1410 137
187 3300048920 Ga0496117_0241790 Ga0496117_0241790_127_546 137
188 3300048924 Ga0496121_0065478 Ga0496121_0065478_1469_1888 137
189 3300048925 Ga0496122_0000448 Ga0496122_0000448_44119_44535 137
190 3300048926 Ga0496123_0149800 Ga0496123_0149800_284_700 137
191 3300048928 Ga0496125_0014934 Ga0496125_0014934_354_773 137
192 3300049569 Ga0501032_0143450 Ga0501032_0143450_173_601 137
193 3300049571 Ga0501034_0267594 Ga0501034_0267594_216_740 137
194 3300049574 Ga0501038_0807418 Ga0501038_0807418_183_602 137
195 3300049575 Ga0501039_0015357 Ga0501039_0015357_3184_3612 137
196 3300049579 Ga0501043_0095291 Ga0501043_0095291_747_1175 137
197 3300049579 Ga0501043_0275860 Ga0501043_0275860_267_689 137
198 3300049580 Ga0501046_0400520 Ga0501046_0400520_203_631 137
199 3300049581 Ga0501047_0064799 Ga0501047_0064799_1893_2318 137
200 3300049586 Ga0501070_0428844 Ga0501070_0428844_259_783 137
201 3300049681 Ga0501251_001549 Ga0501251_001549_504_920 137
202 3300049742 Ga0501080_0907988 Ga0501080_0907988_249_677 137
203 3300049758 Ga0501241_000018 Ga0501241_000018_2644_3060 137
204 3300049759 Ga0501262_011186 Ga0501262_011186_636_1070 137
205 3300049766 Ga0501269_000035 Ga0501269_000035_40713_41129 137
206 3300049822 Ga0501035_0199331 Ga0501035_0199331_1180_1599 137
207 3300049822 Ga0501035_0226018 Ga0501035_0226018_15_431 137
208 3300049822 Ga0501035_0303494 Ga0501035_0303494_600_1124 137
209 3300049823 Ga0501044_0001399 Ga0501044_0001399_460_882 137
210 3300049823 Ga0501044_0027943 Ga0501044_0027943_4395_4823 137
211 3300049823 Ga0501044_0609919 Ga0501044_0609919_449_868 137
212 3300050493 nmdc:mga0k408_114715_c1 nmdc:mga0k408_114715_c1_457_870 137
213 3300050515 nmdc:mga0a205_587770_c1 nmdc:mga0a205_587770_c1_273_686 137
214 3300053090 Ga0500646_0104894 Ga0500646_0104894_12_425 137
215 3300053093 Ga0500651_0401842 Ga0500651_0401842_168_590 137
216 3300053103 Ga0500555_098481 Ga0500555_098481_71_493 137
217 3300053104 Ga0500556_0251935 Ga0500556_0251935_116_538 137
218 3300053139 Ga0500568_0041186 Ga0500568_0041186_919_1332 137
219 3300053142 Ga0500577_0191597 Ga0500577_0191597_141_563 137
220 3300053147 Ga0500589_159836 Ga0500589_159836_63_485 137
221 3300053156 Ga0500622_0000130 Ga0500622_0000130_38116_38553 137
222 3300060353 Ga0501082_1037685 Ga0501082_1037685_11_439 137
223 iso_pu_bacteria 2802428842 2802654040 137
224 iso_pu_bacteria 2977268062 2977269849 137
225 iso_pu_bacteria 8055419101 8055419226 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

33

162

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.945 1 137
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.938 1 137
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9347 1 134
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9344 1 133
1jl3-assembly3.cif.gz_C crystal structure of b. subtilis arsc 0.9305 2 137
ID Description Score Start End Superfamily
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9305 2 137 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9232 2 137 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8947 1 137 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.887 1 135 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8827 4 134 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A093XZ27-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.97 2 135 GO:0046685
AF-A0A1N6DYB7-F1-model_v4 Protein tyrosine phosphatase 0.9677 1 136 GO:0046685
AF-A0A7C5GVU1-F1-model_v4 Arsenate reductase ArsC 0.9634 2 135 GO:0046685
AF-A0A5R8KCJ9-F1-model_v4 Arsenate reductase ArsC 0.9617 4 135 GO:0046685
AF-A0A2I0P7U7-F1-model_v4 Low molecular weight phosphatase family protein 0.9607 2 131 GO:0046685

Feature Viewer

pLDDT pTM Quality
91.14 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map